F430116

General Info

Members Datasets Scaffolds Average Seq Length
385 272 770 305

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10021868|Ga0070692_100218683
Length 359
Sequence MTGAVADERPVPLRVLKPVGERGSSSVVPSNPNSRVGRKRSPIAQGGVQMDATVVGIDVSKDRLDVYVYPSAEDFSVARNAEGLDALIARIGPLQAQAIAVEATGGFETVVVASLGGAGLPVIVVNPSQVRAFAQALGKRAKTDPIDAAVIARFVAATKPEIRALPDSETRLLADLVTRRRQIIQMMVAERQRERHLPSRHLKKSVARLLKALEKELSALDQGIDETVRGSPAWREKEDLLKTVPGVGNIVARTLLAELPELGQLDRRQIASLAGLAPFTRQSGRWRGKSLIGGGRSSVRAVLFLSAMVAKKHNPPLKTFHQRLIASGKPKMVALVAVARKLLTILNAILRDQRPWQPA

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
247 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
251 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
252 2738541293 Rhizobium sp. GV031 Isolate Unclassified
253 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
254 2765235841 Pseudomonas putida AA7 Isolate Unclassified
255 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
256 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
257 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
258 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
259 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
260 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
261 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
262 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
263 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
264 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
265 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
266 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
267 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
268 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
269 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
270 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
271 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
272 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.69
Metatranscriptomes 0
Isolates 8.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 5.45
Rhizoplane 3.9
Rhizosphere 75.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10021868 3300005345 Bacteria 3116
2 JGI25151J46595_10033530 3300003187 Bacteria 1977
3 JGI25151J46595_10053694 3300003187 Bacteria 1343
4 rootL2_10226982 3300003322 Bacteria 1201
5 Ga0055524_1005055 3300003775 Bacteria 5967
6 Ga0065704_10142020 3300005289 Bacteria 1508
7 Ga0070670_100053859 3300005331 Bacteria 3454
8 Ga0068869_100251144 3300005334 Bacteria 1412
9 Ga0070680_100089199 3300005336 Bacteria 2551
10 Ga0070689_100345004 3300005340 Bacteria 1248
11 Ga0070661_100014329 3300005344 Bacteria 5585
12 Ga0070668_100205297 3300005347 Bacteria 1619
13 Ga0070668_100315335 3300005347 Bacteria 1315
14 Ga0070671_100298250 3300005355 Bacteria 1372
15 Ga0070674_100270105 3300005356 Bacteria 1343
16 Ga0070674_100328473 3300005356 Bacteria 1229
17 Ga0070673_100050433 3300005364 Bacteria 3254
18 Ga0070667_100594550 3300005367 Bacteria 1019
19 Ga0070713_100231470 3300005436 Bacteria 1680
20 Ga0070710_10121724 3300005437 Bacteria 1580
21 Ga0070711_100259530 3300005439 Bacteria 1366
22 Ga0070711_100318598 3300005439 Bacteria 1242
23 Ga0070700_100043031 3300005441 Bacteria 2776
24 Ga0070700_100198400 3300005441 Bacteria 1408
25 Ga0070694_100120519 3300005444 Bacteria 1882
26 Ga0070663_100153427 3300005455 Bacteria 1768
27 Ga0070678_100196042 3300005456 Bacteria 1664
28 Ga0070678_100334515 3300005456 Bacteria 1297
29 Ga0070678_100350290 3300005456 Bacteria 1270
30 Ga0068867_100312887 3300005459 Bacteria 1298
31 Ga0070684_100054767 3300005535 Bacteria 3475
32 Ga0070672_100311872 3300005543 Bacteria 1336
33 Ga0070672_100518164 3300005543 Bacteria 1033
34 Ga0070686_100218502 3300005544 Bacteria 1376
35 Ga0070665_100336680 3300005548 Bacteria 1513
36 Ga0068854_100290548 3300005578 Bacteria 1319
37 Ga0070702_100247182 3300005615 Bacteria 1207
38 Ga0068852_100212292 3300005616 Bacteria 1837
39 Ga0068859_100432933 3300005617 Bacteria 1412
40 Ga0068864_100426945 3300005618 Bacteria 1264
41 Ga0068866_10022970 3300005718 Bacteria 2895
42 Ga0068866_10157005 3300005718 Bacteria 1323
43 Ga0068861_100357471 3300005719 Bacteria 1283
44 Ga0068870_10205369 3300005840 Bacteria 1197
45 Ga0068863_100486299 3300005841 Bacteria 1214
46 Ga0068860_100254854 3300005843 Bacteria 1709
47 Ga0068860_100304639 3300005843 Bacteria 1562
48 Ga0068860_100422385 3300005843 Bacteria 1322
49 Ga0068862_100441363 3300005844 Bacteria 1225
50 Ga0081455_10136500 3300005937 Bacteria 1911
51 Ga0081538_10162706 3300005981 Bacteria 988
52 Ga0081540_1022423 3300005983 Bacteria 3729
53 Ga0081540_1098424 3300005983 Bacteria 1266
54 Ga0081539_10021039 3300005985 Bacteria 4377
55 Ga0081539_10073752 3300005985 Bacteria 1820
56 Ga0081539_10091769 3300005985 Bacteria 1568
57 Ga0081539_10127491 3300005985 Bacteria 1255
58 Ga0070717_10338813 3300006028 Bacteria 1342
59 Ga0075365_10192986 3300006038 Bacteria 1426
60 Ga0075368_10026994 3300006042 Bacteria 2211
61 Ga0075364_10034155 3300006051 Bacteria 3280
62 Ga0075367_10089029 3300006178 Bacteria 1876
63 Ga0075366_10110516 3300006195 Bacteria 1653
64 Ga0097621_100335137 3300006237 Bacteria 1342
65 Ga0097621_100388136 3300006237 Bacteria 1248
66 Ga0097621_100475096 3300006237 Bacteria 1129
67 Ga0068871_100079963 3300006358 Bacteria 2705
68 Ga0068871_100436029 3300006358 Bacteria 1172
69 Ga0075428_100322641 3300006844 Bacteria 1659
70 Ga0075430_100213571 3300006846 Bacteria 1601
71 Ga0075431_100350947 3300006847 Bacteria 1483
72 Ga0075433_10398159 3300006852 Bacteria 1215
73 Ga0075434_100447731 3300006871 Bacteria 1313
74 Ga0075429_100387299 3300006880 Bacteria 1224
75 Ga0068865_100278309 3300006881 Bacteria 1331
76 Ga0097620_100432946 3300006931 Bacteria 1412
77 Ga0105251_10107200 3300009011 Bacteria 1275
78 Ga0111539_10355578 3300009094 Bacteria 1704
79 Ga0105245_10453890 3300009098 Bacteria 1291
80 Ga0105245_10470289 3300009098 Bacteria 1269
81 Ga0105247_10053214 3300009101 Bacteria 2497
82 Ga0105243_10126281 3300009148 Bacteria 2164
83 Ga0105243_10140023 3300009148 Bacteria 2063
84 Ga0105243_10386434 3300009148 Bacteria 1296
85 Ga0105241_10184738 3300009174 Bacteria 1732
86 Ga0105242_10232483 3300009176 Bacteria 1653
87 Ga0105242_10537577 3300009176 Bacteria 1118
88 Ga0105248_10396793 3300009177 Bacteria 1553
89 Ga0105237_10308708 3300009545 Bacteria 1585
90 Ga0105238_10190412 3300009551 Bacteria 2027
91 Ga0105238_10564857 3300009551 Bacteria 1143
92 Ga0105249_10183112 3300009553 Bacteria 2039
93 Ga0105249_10390562 3300009553 Bacteria 1420
94 Ga0099796_10106210 3300010159 Bacteria 1063
95 Ga0105239_10373674 3300010375 Bacteria 1611
96 Ga0105246_10165708 3300011119 Bacteria 1688
97 Ga0157373_10137189 3300013100 Bacteria 1720
98 Ga0157374_10330447 3300013296 Bacteria 1512
99 Ga0163162_10124045 3300013306 Bacteria 2688
100 Ga0163162_10443158 3300013306 Bacteria 1431
101 Ga0157375_10256001 3300013308 Bacteria 1912
102 Ga0157375_10380737 3300013308 Bacteria 1578
103 Ga0163163_10324114 3300014325 Bacteria 1594
104 Ga0163163_10406524 3300014325 Bacteria 1420
105 Ga0163163_10531848 3300014325 Bacteria 1238
106 Ga0157380_10266515 3300014326 Bacteria 1559
107 Ga0157380_10314801 3300014326 Bacteria 1448
108 Ga0157376_10269340 3300014969 Bacteria 1599
109 Ga0163161_10168589 3300017792 Bacteria 1673
110 Ga0213872_10056482 3300021361 Bacteria 1778
111 Ga0213874_10055465 3300021377 Bacteria 1227
112 Ga0213876_10000420 3300021384 Bacteria 35366
113 Ga0213875_10017660 3300021388 Bacteria 3442
114 Ga0213871_10015401 3300021441 Bacteria 1828
115 Ga0213871_10016818 3300021441 Bacteria 1768
116 Ga0213871_10017119 3300021441 Bacteria 1757
117 Ga0228598_1018424 3300024227 Bacteria 1376
118 Ga0209025_1051701 3300025294 Bacteria 1629
119 Ga0209256_1000530 3300025299 Bacteria 55312
120 Ga0207713_1090049 3300025735 Bacteria 1080
121 Ga0207642_10120946 3300025899 Bacteria 1350
122 Ga0207710_10023638 3300025900 Bacteria 2642
123 Ga0207688_10221538 3300025901 Bacteria 1140
124 Ga0207685_10062972 3300025905 Bacteria 1476
125 Ga0207699_10257308 3300025906 Bacteria 1205
126 Ga0207643_10165424 3300025908 Bacteria 1332
127 Ga0207654_10196711 3300025911 Bacteria 1325
128 Ga0207671_10271977 3300025914 Bacteria 1335
129 Ga0207693_10083844 3300025915 Bacteria 2497
130 Ga0207663_10134223 3300025916 Bacteria 1715
131 Ga0207649_10043034 3300025920 Bacteria 2759
132 Ga0207694_10180380 3300025924 Bacteria 1712
133 Ga0207650_10282553 3300025925 Bacteria 1352
134 Ga0207650_10319031 3300025925 Bacteria 1272
135 Ga0207659_10402524 3300025926 Bacteria 1145
136 Ga0207687_10313851 3300025927 Bacteria 1267
137 Ga0207700_10189329 3300025928 Bacteria 1728
138 Ga0207700_10316345 3300025928 Bacteria 1352
139 Ga0207644_10284408 3300025931 Bacteria 1328
140 Ga0207644_10422156 3300025931 Bacteria 1093
141 Ga0207686_10387520 3300025934 Bacteria 1061
142 Ga0207709_10181181 3300025935 Bacteria 1488
143 Ga0207709_10199216 3300025935 Bacteria 1429
144 Ga0207670_10321595 3300025936 Bacteria 1217
145 Ga0207669_10163970 3300025937 Bacteria 1573
146 Ga0207704_10203821 3300025938 Bacteria 1450
147 Ga0207691_10275018 3300025940 Bacteria 1450
148 Ga0207691_10336041 3300025940 Bacteria 1293
149 Ga0207711_10136186 3300025941 Bacteria 2206
150 Ga0207689_10141956 3300025942 Bacteria 1978
151 Ga0207667_10259573 3300025949 Bacteria 1777
152 Ga0207651_10466926 3300025960 Bacteria 1085
153 Ga0207712_10119105 3300025961 Bacteria 1994
154 Ga0207668_10341828 3300025972 Bacteria 1248
155 Ga0207640_10315868 3300025981 Bacteria 1242
156 Ga0207677_10292388 3300026023 Bacteria 1342
157 Ga0207678_10283525 3300026067 Bacteria 1422
158 Ga0207708_10249480 3300026075 Bacteria 1430
159 Ga0207641_10272124 3300026088 Bacteria 1589
160 Ga0207641_10490381 3300026088 Bacteria 1192
161 Ga0207648_10238444 3300026089 Bacteria 1619
162 Ga0207648_10429005 3300026089 Bacteria 1201
163 Ga0207676_10422036 3300026095 Bacteria 1251
164 Ga0207675_100387651 3300026118 Bacteria 1375
165 Ga0207683_10327585 3300026121 Bacteria 1404
166 Ga0209998_10039096 3300027717 Bacteria 1072
167 Ga0209813_10002026 3300027866 Bacteria 4594
168 Ga0224573_1003132 3300028019 Bacteria 1224
169 Ga0268266_10179585 3300028379 Bacteria 1926
170 Ga0268265_10462548 3300028380 Bacteria 1187
171 Ga0268264_10501230 3300028381 Bacteria 1184
172 Ga0265330_10015814 3300031235 Bacteria 3487
173 Ga0265328_10025187 3300031239 Bacteria 2242
174 Ga0265325_10019809 3300031241 Bacteria 3715
175 Ga0265325_10127738 3300031241 Bacteria 1220
176 Ga0265339_10021920 3300031249 Bacteria 3707
177 Ga0265331_10101719 3300031250 Bacteria 1322
178 Ga0265316_10270143 3300031344 Bacteria 1244
179 Ga0307508_10048844 3300031616 Bacteria 3769
180 Ga0265342_10061746 3300031712 Bacteria 2207
181 Ga0265342_10081437 3300031712 Bacteria 1869
182 Ga0265342_10172069 3300031712 Bacteria 1190
183 Ga0307516_10279470 3300031730 Bacteria 1352
184 Ga0307405_10279629 3300031731 Bacteria 1255
185 Ga0307413_10162502 3300031824 Bacteria 1570
186 Ga0307410_10184406 3300031852 Bacteria 1582
187 Ga0307407_10206900 3300031903 Bacteria 1319
188 Ga0307409_100557939 3300031995 Bacteria 1125
189 Ga0307416_100610957 3300032002 Bacteria 1171
190 Ga0307411_10058434 3300032005 Bacteria 2552
191 Ga0307415_100780407 3300032126 Bacteria 870
192 Ga0373938_0017356 3300034957 Bacteria 1416
193 Ga0373940_0005206 3300035088 Bacteria 2802
194 Ga0373923_0109957 3300035111 Bacteria 1223
195 Ga0373932_0017852 3300035112 Bacteria 1827
196 Ga0373939_0008321 3300035114 Bacteria 2542
197 Ga0373941_0004988 3300035115 Bacteria 3094
198 Ga0373960_0026379 3300035121 Bacteria 1587
199 Ga0373955_0201962 3300035172 Bacteria 1183
200 Ga0373942_0011822 3300035207 Bacteria 2075
201 Ga0373931_0132567 3300035691 Bacteria 1436
202 Ga0373931_0184314 3300035691 Bacteria 1238
203 Ga0373935_0140199 3300035692 Bacteria 1633
204 Ga0373927_0106101 3300035695 Bacteria 1829
205 Ga0373927_0206806 3300035695 Bacteria 1289
206 Ga0373933_0235636 3300035724 Bacteria 1176
207 Ga0373937_0381056 3300036401 Bacteria 1337
208 Ga0373925_0158076 3300037068 Bacteria 1784
209 Ga0373925_0307260 3300037068 Bacteria 1281
210 Ga0436364_0305540 3300037853 Bacteria 1875
211 Ga0436364_0360698 3300037853 Bacteria 1089
212 Ga0436364_0982784 3300037853 Bacteria 1269
213 Ga0436365_0356745 3300039437 Bacteria 1142
214 Ga0436360_0378902 3300039438 Bacteria 2512
215 Ga0436360_0397721 3300039438 Bacteria 1808
216 Ga0436360_0615634 3300039438 Bacteria 1869
217 Ga0436360_0634468 3300039438 Bacteria 1638
218 Ga0436360_1116289 3300039438 Bacteria 2002
219 Ga0436361_0810179 3300039447 Bacteria 3003
220 Ga0436361_1095806 3300039447 Bacteria 1236
221 Ga0436363_0692641 3300039450 Bacteria 1429
222 Ga0436363_1200234 3300039450 Bacteria 1824
223 Ga0436363_1709373 3300039450 Bacteria 1079
224 Ga0436362_0210107 3300039453 Bacteria 1642
225 Ga0436362_0752429 3300039453 Bacteria 1941
226 Ga0439447_031706 3300041407 Bacteria 1325
227 Ga0439453_0004898 3300041408 Bacteria 2014
228 Ga0439441_009553 3300042001 Bacteria 1608
229 Ga0439450_043712 3300042008 Bacteria 1047
230 Ga0439455_0006249 3300042012 Bacteria 2462
231 Ga0439456_016098 3300042013 Bacteria 1563
232 Ga0439464_0047998 3300042439 Bacteria 1229
233 Ga0439460_0055855 3300042461 Bacteria 1194
234 Ga0466972_0090085 3300044658 Bacteria 1455
235 Ga0466960_0041402 3300044901 Bacteria 2183
236 Ga0451576_0479596 3300045051 Bacteria 1306
237 Ga0495622_0051682 3300046557 Bacteria 1906
238 Ga0495625_0174295 3300046660 Bacteria 1434
239 Ga0495659_0018565 3300046664 Bacteria 2319
240 Ga0495686_0049817 3300047472 Bacteria 2633
241 Ga0496100_0228039 3300048903 Bacteria 1369
242 Ga0496101_0258882 3300048904 Bacteria 1357
243 Ga0496101_0277542 3300048904 Bacteria 1309
244 Ga0496101_0299652 3300048904 Bacteria 1259
245 Ga0496102_0121031 3300048905 Bacteria 2444
246 Ga0496103_0233438 3300048906 Bacteria 1183
247 Ga0496104_0565717 3300048907 Bacteria 1047
248 Ga0496108_0372604 3300048911 Bacteria 1246
249 Ga0496110_0438255 3300048913 Bacteria 1191
250 Ga0496111_0086371 3300048914 Bacteria 2295
251 Ga0496113_0436751 3300048916 Bacteria 1052
252 Ga0496114_0329594 3300048917 Bacteria 1349
253 Ga0496114_0354171 3300048917 Bacteria 1298
254 Ga0496115_0344807 3300048918 Bacteria 1215
255 Ga0496117_0028295 3300048920 Bacteria 4344
256 Ga0496118_0042066 3300048921 Bacteria 3609
257 Ga0496118_0190482 3300048921 Bacteria 1227
258 Ga0496119_0140939 3300048922 Bacteria 1302
259 Ga0496120_0117381 3300048923 Bacteria 1381
260 Ga0496120_0120070 3300048923 Bacteria 1360
261 Ga0496121_0224259 3300048924 Bacteria 1321
262 Ga0496124_0165358 3300048927 Bacteria 1720
263 Ga0496124_0190967 3300048927 Bacteria 1567
264 Ga0496124_0235309 3300048927 Bacteria 1366
265 Ga0496124_0266633 3300048927 Bacteria 1256
266 Ga0496125_0001748 3300048928 Bacteria 30160
267 Ga0496125_0078489 3300048928 Bacteria 2537
268 Ga0496126_0141626 3300048929 Bacteria 2069
269 Ga0501031_0086124 3300049568 Bacteria 2048
270 Ga0501032_0067680 3300049569 Bacteria 2385
271 Ga0501032_0084856 3300049569 Bacteria 2105
272 Ga0501033_0075188 3300049570 Bacteria 2479
273 Ga0501033_0147350 3300049570 Bacteria 1699
274 Ga0501033_0250085 3300049570 Bacteria 1256
275 Ga0501034_0119856 3300049571 Bacteria 2617
276 Ga0501034_0256426 3300049571 Bacteria 1692
277 Ga0501034_0437492 3300049571 Bacteria 1227
278 Ga0501034_0450261 3300049571 Bacteria 1205
279 Ga0501034_0454305 3300049571 Bacteria 1198
280 Ga0501034_0468777 3300049571 Bacteria 1175
281 Ga0501036_0033674 3300049572 Bacteria 4332
282 Ga0501036_0135994 3300049572 Bacteria 2074
283 Ga0501037_0155803 3300049573 Bacteria 1630
284 Ga0501037_0204535 3300049573 Bacteria 1394
285 Ga0501037_0258257 3300049573 Bacteria 1217
286 Ga0501037_0260915 3300049573 Bacteria 1210
287 Ga0501038_0077053 3300049574 Bacteria 2815
288 Ga0501038_0113816 3300049574 Bacteria 2238
289 Ga0501038_0257409 3300049574 Bacteria 1380
290 Ga0501038_0289192 3300049574 Bacteria 1288
291 Ga0501040_0267896 3300049576 Bacteria 1219
292 Ga0501042_0205673 3300049578 Bacteria 1419
293 Ga0501042_0571424 3300049578 Bacteria 822
294 Ga0501043_0078190 3300049579 Bacteria 2599
295 Ga0501043_0274111 3300049579 Bacteria 1294
296 Ga0501043_0385279 3300049579 Bacteria 1061
297 Ga0501046_0114302 3300049580 Bacteria 2059
298 Ga0501046_0257616 3300049580 Bacteria 1282
299 Ga0501047_0009691 3300049581 Bacteria 9106
300 Ga0501047_0071158 3300049581 Bacteria 3348
301 Ga0501047_0231094 3300049581 Bacteria 1703
302 Ga0501047_0308031 3300049581 Bacteria 1425
303 Ga0501048_0098166 3300049582 Bacteria 2066
304 Ga0501067_0080158 3300049583 Bacteria 1809
305 Ga0501067_0160286 3300049583 Bacteria 1253
306 Ga0501068_0094730 3300049584 Bacteria 1845
307 Ga0501068_0187711 3300049584 Bacteria 1308
308 Ga0501069_0052581 3300049585 Bacteria 2268
309 Ga0501069_0152450 3300049585 Bacteria 1328
310 Ga0501070_0017308 3300049586 Bacteria 6052
311 Ga0501070_0246620 3300049586 Bacteria 1461
312 Ga0501071_0319272 3300049587 Bacteria 1179
313 Ga0501071_0345295 3300049587 Bacteria 1132
314 Ga0501072_0068586 3300049588 Bacteria 2799
315 Ga0501073_0086865 3300049589 Bacteria 2175
316 Ga0501073_0243189 3300049589 Bacteria 1242
317 Ga0501073_0323798 3300049589 Bacteria 1064
318 Ga0501074_0080742 3300049590 Bacteria 2332
319 Ga0501074_0229818 3300049590 Bacteria 1320
320 Ga0501076_0232020 3300049592 Bacteria 1509
321 Ga0501076_0384377 3300049592 Bacteria 1154
322 Ga0501079_0250402 3300049741 Bacteria 1384
323 Ga0501080_0020950 3300049742 Bacteria 6050
324 Ga0501080_0080296 3300049742 Bacteria 3031
325 Ga0501081_0285693 3300049743 Bacteria 1208
326 Ga0501083_0194314 3300049744 Bacteria 1324
327 Ga0501083_0265161 3300049744 Bacteria 1117
328 Ga0501035_0096299 3300049822 Bacteria 2600
329 Ga0501035_0108124 3300049822 Bacteria 2438
330 Ga0501035_0173841 3300049822 Bacteria 1859
331 Ga0501044_0088275 3300049823 Bacteria 3130
332 Ga0501044_0179121 3300049823 Bacteria 2087
333 Ga0501044_0422348 3300049823 Bacteria 1243
334 Ga0501045_0095239 3300049824 Bacteria 2202
335 Ga0501045_0242875 3300049824 Bacteria 1340
336 nmdc:mga00v17_101656_c1 3300050491 Bacteria 1815
337 nmdc:mga0yw44_200819_c1 3300050492 Bacteria 1317
338 nmdc:mga0k408_132644_c1 3300050493 Bacteria 1479
339 nmdc:mga09592_512809_c1 3300050508 Bacteria 1032
340 nmdc:mga0qj67_231040_c1 3300050509 Bacteria 1501
341 nmdc:mga08y16_272211_c1 3300050511 Bacteria 1748
342 nmdc:mga0n895_496620_c1 3300050512 Bacteria 1230
343 Ga0500566_0116960 3300053094 Bacteria 1442
344 Ga0500614_034892 3300053123 Bacteria 1250
345 Ga0500655_023578 3300053133 Bacteria 1162
346 Ga0500588_0047367 3300053146 Bacteria 1325
347 Ga0500603_016490 3300053150 Bacteria 1754
348 Ga0500627_0070530 3300053158 Bacteria 1547
349 Ga0500627_0094620 3300053158 Bacteria 1338
350 Ga0501082_0222386 3300060353 Bacteria 1643
351 Ga0501082_0318586 3300060353 Bacteria 1355
352 Ga0530510_0271120 3300061734 Bacteria 1266
353 Ga0530510_0288031 3300061734 Bacteria 1228
354 2509145717 2508501127 Bacteria 7037543
355 2509388165 2509276021 Bacteria 7634384
356 2509388652 2509276021 Bacteria 7634384
357 2738803675 2738541293 Bacteria 7065685
358 2765468094 2765235802 Bacteria 5618596
359 2765582515 2765235841 Bacteria 6137024
360 2765584065 2765235841 Bacteria 6137024
361 2765584541 2765235841 Bacteria 6137024
362 2765585691 2765235841 Bacteria 6137024
363 2765586742 2765235841 Bacteria 6137024
364 2765586749 2765235841 Bacteria 6137024
365 2776911611 2775507049 Bacteria 6284736
366 2776912339 2775507049 Bacteria 6284736
367 2856356083 2856349417 Bacteria 6230045
368 2856358245 2856356410 Bacteria 6297484
369 2878757676 2878753008 Bacteria 6922523
370 2881159356 2881155292 Bacteria 6461656
371 2881159470 2881155292 Bacteria 6461656
372 2881161296 2881155292 Bacteria 6461656
373 2881856093 2881853255 Bacteria 6698367
374 2881868401 2881861095 Bacteria 7128710
375 2885343731 2885342637 Bacteria 7011821
376 2885352284 2885350715 Bacteria 6787678
377 2893067915 2893066018 Bacteria 6158120
378 2924790081 2924784321 Bacteria 7416538
379 2961128300 2961127735 Bacteria 7196641
380 2961175656 2961170736 Bacteria 7072258
381 2970508305 2970503327 Bacteria 7099517
382 2977826791 2977821940 Bacteria 6906439
383 2979813441 2979808191 Bacteria 7179355
384 8004379198 8004374579 Bacteria 6898112
385 8056386816 8056382006 Bacteria 6408074
386 Ga0070692_10021868
387 JGI25151J46595_10033530
388 JGI25151J46595_10053694
389 rootL2_10226982
390 Ga0055524_1005055
391 Ga0065704_10142020
392 Ga0070670_100053859
393 Ga0068869_100251144
394 Ga0070680_100089199
395 Ga0070689_100345004
396 Ga0070661_100014329
397 Ga0070668_100205297
398 Ga0070668_100315335
399 Ga0070671_100298250
400 Ga0070674_100270105
401 Ga0070674_100328473
402 Ga0070673_100050433
403 Ga0070667_100594550
404 Ga0070713_100231470
405 Ga0070710_10121724
406 Ga0070711_100259530
407 Ga0070711_100318598
408 Ga0070700_100043031
409 Ga0070700_100198400
410 Ga0070694_100120519
411 Ga0070663_100153427
412 Ga0070678_100196042
413 Ga0070678_100334515
414 Ga0070678_100350290
415 Ga0068867_100312887
416 Ga0070684_100054767
417 Ga0070672_100311872
418 Ga0070672_100518164
419 Ga0070686_100218502
420 Ga0070665_100336680
421 Ga0068854_100290548
422 Ga0070702_100247182
423 Ga0068852_100212292
424 Ga0068859_100432933
425 Ga0068864_100426945
426 Ga0068866_10022970
427 Ga0068866_10157005
428 Ga0068861_100357471
429 Ga0068870_10205369
430 Ga0068863_100486299
431 Ga0068860_100254854
432 Ga0068860_100304639
433 Ga0068860_100422385
434 Ga0068862_100441363
435 Ga0081455_10136500
436 Ga0081538_10162706
437 Ga0081540_1022423
438 Ga0081540_1098424
439 Ga0081539_10021039
440 Ga0081539_10073752
441 Ga0081539_10091769
442 Ga0081539_10127491
443 Ga0070717_10338813
444 Ga0075365_10192986
445 Ga0075368_10026994
446 Ga0075364_10034155
447 Ga0075367_10089029
448 Ga0075366_10110516
449 Ga0097621_100335137
450 Ga0097621_100388136
451 Ga0097621_100475096
452 Ga0068871_100079963
453 Ga0068871_100436029
454 Ga0075428_100322641
455 Ga0075430_100213571
456 Ga0075431_100350947
457 Ga0075433_10398159
458 Ga0075434_100447731
459 Ga0075429_100387299
460 Ga0068865_100278309
461 Ga0097620_100432946
462 Ga0105251_10107200
463 Ga0111539_10355578
464 Ga0105245_10453890
465 Ga0105245_10470289
466 Ga0105247_10053214
467 Ga0105243_10126281
468 Ga0105243_10140023
469 Ga0105243_10386434
470 Ga0105241_10184738
471 Ga0105242_10232483
472 Ga0105242_10537577
473 Ga0105248_10396793
474 Ga0105237_10308708
475 Ga0105238_10190412
476 Ga0105238_10564857
477 Ga0105249_10183112
478 Ga0105249_10390562
479 Ga0099796_10106210
480 Ga0105239_10373674
481 Ga0105246_10165708
482 Ga0157373_10137189
483 Ga0157374_10330447
484 Ga0163162_10124045
485 Ga0163162_10443158
486 Ga0157375_10256001
487 Ga0157375_10380737
488 Ga0163163_10324114
489 Ga0163163_10406524
490 Ga0163163_10531848
491 Ga0157380_10266515
492 Ga0157380_10314801
493 Ga0157376_10269340
494 Ga0163161_10168589
495 Ga0213872_10056482
496 Ga0213874_10055465
497 Ga0213876_10000420
498 Ga0213875_10017660
499 Ga0213871_10015401
500 Ga0213871_10016818
501 Ga0213871_10017119
502 Ga0228598_1018424
503 Ga0209025_1051701
504 Ga0209256_1000530
505 Ga0207713_1090049
506 Ga0207642_10120946
507 Ga0207710_10023638
508 Ga0207688_10221538
509 Ga0207685_10062972
510 Ga0207699_10257308
511 Ga0207643_10165424
512 Ga0207654_10196711
513 Ga0207671_10271977
514 Ga0207693_10083844
515 Ga0207663_10134223
516 Ga0207649_10043034
517 Ga0207694_10180380
518 Ga0207650_10282553
519 Ga0207650_10319031
520 Ga0207659_10402524
521 Ga0207687_10313851
522 Ga0207700_10189329
523 Ga0207700_10316345
524 Ga0207644_10284408
525 Ga0207644_10422156
526 Ga0207686_10387520
527 Ga0207709_10181181
528 Ga0207709_10199216
529 Ga0207670_10321595
530 Ga0207669_10163970
531 Ga0207704_10203821
532 Ga0207691_10275018
533 Ga0207691_10336041
534 Ga0207711_10136186
535 Ga0207689_10141956
536 Ga0207667_10259573
537 Ga0207651_10466926
538 Ga0207712_10119105
539 Ga0207668_10341828
540 Ga0207640_10315868
541 Ga0207677_10292388
542 Ga0207678_10283525
543 Ga0207708_10249480
544 Ga0207641_10272124
545 Ga0207641_10490381
546 Ga0207648_10238444
547 Ga0207648_10429005
548 Ga0207676_10422036
549 Ga0207675_100387651
550 Ga0207683_10327585
551 Ga0209998_10039096
552 Ga0209813_10002026
553 Ga0224573_1003132
554 Ga0268266_10179585
555 Ga0268265_10462548
556 Ga0268264_10501230
557 Ga0265330_10015814
558 Ga0265328_10025187
559 Ga0265325_10019809
560 Ga0265325_10127738
561 Ga0265339_10021920
562 Ga0265331_10101719
563 Ga0265316_10270143
564 Ga0307508_10048844
565 Ga0265342_10061746
566 Ga0265342_10081437
567 Ga0265342_10172069
568 Ga0307516_10279470
569 Ga0307405_10279629
570 Ga0307413_10162502
571 Ga0307410_10184406
572 Ga0307407_10206900
573 Ga0307409_100557939
574 Ga0307416_100610957
575 Ga0307411_10058434
576 Ga0307415_100780407
577 Ga0373938_0017356
578 Ga0373940_0005206
579 Ga0373923_0109957
580 Ga0373932_0017852
581 Ga0373939_0008321
582 Ga0373941_0004988
583 Ga0373960_0026379
584 Ga0373955_0201962
585 Ga0373942_0011822
586 Ga0373931_0132567
587 Ga0373931_0184314
588 Ga0373935_0140199
589 Ga0373927_0106101
590 Ga0373927_0206806
591 Ga0373933_0235636
592 Ga0373937_0381056
593 Ga0373925_0158076
594 Ga0373925_0307260
595 Ga0436364_0305540
596 Ga0436364_0360698
597 Ga0436364_0982784
598 Ga0436365_0356745
599 Ga0436360_0378902
600 Ga0436360_0397721
601 Ga0436360_0615634
602 Ga0436360_0634468
603 Ga0436360_1116289
604 Ga0436361_0810179
605 Ga0436361_1095806
606 Ga0436363_0692641
607 Ga0436363_1200234
608 Ga0436363_1709373
609 Ga0436362_0210107
610 Ga0436362_0752429
611 Ga0439447_031706
612 Ga0439453_0004898
613 Ga0439441_009553
614 Ga0439450_043712
615 Ga0439455_0006249
616 Ga0439456_016098
617 Ga0439464_0047998
618 Ga0439460_0055855
619 Ga0466972_0090085
620 Ga0466960_0041402
621 Ga0451576_0479596
622 Ga0495622_0051682
623 Ga0495625_0174295
624 Ga0495659_0018565
625 Ga0495686_0049817
626 Ga0496100_0228039
627 Ga0496101_0258882
628 Ga0496101_0277542
629 Ga0496101_0299652
630 Ga0496102_0121031
631 Ga0496103_0233438
632 Ga0496104_0565717
633 Ga0496108_0372604
634 Ga0496110_0438255
635 Ga0496111_0086371
636 Ga0496113_0436751
637 Ga0496114_0329594
638 Ga0496114_0354171
639 Ga0496115_0344807
640 Ga0496117_0028295
641 Ga0496118_0042066
642 Ga0496118_0190482
643 Ga0496119_0140939
644 Ga0496120_0117381
645 Ga0496120_0120070
646 Ga0496121_0224259
647 Ga0496124_0165358
648 Ga0496124_0190967
649 Ga0496124_0235309
650 Ga0496124_0266633
651 Ga0496125_0001748
652 Ga0496125_0078489
653 Ga0496126_0141626
654 Ga0501031_0086124
655 Ga0501032_0067680
656 Ga0501032_0084856
657 Ga0501033_0075188
658 Ga0501033_0147350
659 Ga0501033_0250085
660 Ga0501034_0119856
661 Ga0501034_0256426
662 Ga0501034_0437492
663 Ga0501034_0450261
664 Ga0501034_0454305
665 Ga0501034_0468777
666 Ga0501036_0033674
667 Ga0501036_0135994
668 Ga0501037_0155803
669 Ga0501037_0204535
670 Ga0501037_0258257
671 Ga0501037_0260915
672 Ga0501038_0077053
673 Ga0501038_0113816
674 Ga0501038_0257409
675 Ga0501038_0289192
676 Ga0501040_0267896
677 Ga0501042_0205673
678 Ga0501042_0571424
679 Ga0501043_0078190
680 Ga0501043_0274111
681 Ga0501043_0385279
682 Ga0501046_0114302
683 Ga0501046_0257616
684 Ga0501047_0009691
685 Ga0501047_0071158
686 Ga0501047_0231094
687 Ga0501047_0308031
688 Ga0501048_0098166
689 Ga0501067_0080158
690 Ga0501067_0160286
691 Ga0501068_0094730
692 Ga0501068_0187711
693 Ga0501069_0052581
694 Ga0501069_0152450
695 Ga0501070_0017308
696 Ga0501070_0246620
697 Ga0501071_0319272
698 Ga0501071_0345295
699 Ga0501072_0068586
700 Ga0501073_0086865
701 Ga0501073_0243189
702 Ga0501073_0323798
703 Ga0501074_0080742
704 Ga0501074_0229818
705 Ga0501076_0232020
706 Ga0501076_0384377
707 Ga0501079_0250402
708 Ga0501080_0020950
709 Ga0501080_0080296
710 Ga0501081_0285693
711 Ga0501083_0194314
712 Ga0501083_0265161
713 Ga0501035_0096299
714 Ga0501035_0108124
715 Ga0501035_0173841
716 Ga0501044_0088275
717 Ga0501044_0179121
718 Ga0501044_0422348
719 Ga0501045_0095239
720 Ga0501045_0242875
721 nmdc:mga00v17_101656_c1
722 nmdc:mga0yw44_200819_c1
723 nmdc:mga0k408_132644_c1
724 nmdc:mga09592_512809_c1
725 nmdc:mga0qj67_231040_c1
726 nmdc:mga08y16_272211_c1
727 nmdc:mga0n895_496620_c1
728 Ga0500566_0116960
729 Ga0500614_034892
730 Ga0500655_023578
731 Ga0500588_0047367
732 Ga0500603_016490
733 Ga0500627_0070530
734 Ga0500627_0094620
735 Ga0501082_0222386
736 Ga0501082_0318586
737 Ga0530510_0271120
738 Ga0530510_0288031
739 2509145717
740 2509388165
741 2509388652
742 2738803675
743 2765468094
744 2765582515
745 2765584065
746 2765584541
747 2765585691
748 2765586742
749 2765586749
750 2776911611
751 2776912339
752 2856356083
753 2856358245
754 2878757676
755 2881159356
756 2881159470
757 2881161296
758 2881856093
759 2881868401
760 2885343731
761 2885352284
762 2893067915
763 2924790081
764 2961128300
765 2961175656
766 2970508305
767 2977826791
768 2979813441
769 8004379198
770 8056386816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

238

322

0.95

PF01548

DEDD_Tnp_IS110

Transposase

55

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7upo-assembly1.cif.gz_A crystal structure of designed heterotrimeric assembly dht03 0.8941 117 180
6wa9-assembly1.cif.gz_M structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.8654 122 181
6wa9-assembly1.cif.gz_Q structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.8575 121 176
6wa9-assembly1.cif.gz_O structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.8431 119 177
6wa9-assembly1.cif.gz_T structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.8228 113 179
ID Description Score Start End Superfamily
af_O96189_50_173_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9822 118 180 1.20.58.70
af_O88384_1_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.9356 116 182 1.20.58.400
af_Q6DHF1_14_110_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9104 119 186 1.10.287.1060
af_Q1RLQ9_15_111_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.904 119 186 1.10.287.1060
af_Q9QXV3_13_110_6.10.140.1740 Special;Helix non-globular;Helix Hairpins; 0.8954 119 186 6.10.140.1740
ID Description Score Start End GO Terms
AF-A0A136HJ86-F1-model_v4 Transposase IS116/IS110/IS902 family protein 0.9682 116 207
AF-A0A839UVT4-F1-model_v4 Transposase 0.9511 2 76
AF-A0A660V8Z8-F1-model_v4 IS110 family transposase 0.9446 1 106 GO:0003677
GO:0004803
GO:0006313
AF-A0A2H0G8Z6-F1-model_v4 IS110 family transposase 0.9441 1 90
AF-J0VYJ0-F1-model_v4 deleted 0.9421 1 77

Map