F430084

General Info

Members Datasets Scaffolds Average Seq Length
385 172 770 203

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10029317|JGI25407J50210_100293172
Length 235
Sequence MFDTSGGHQAREVRALHSALMSRRIGVMGGTFDPIHHGHLVAAEEARWQFDLDRVVFVPTGRPWQKPVGVSPAEDRYLMTVIATASNPAFMVSRLELDHQGPTYTVDTLRRLRAQSPAGTRLFFITGADAVLQILTWKEPDQVLALAEFIAATRPSFALERLVKEVPGAAGRVHRMDIPALAISSTDIRARVARGAPIQYLVPDGVARYIHKHGLYRTPTGDEPPGEPXPSGGTQ

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
68 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
96 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
97 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
98 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
99 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
100 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
101 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
102 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
105 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.86
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10029317 3300003373 Bacteria 1426
2 JGI25406J46586_10031495 3300003203 Bacteria 1982
3 JGI25407J50210_10003717 3300003373 Bacteria 3678
4 JGI25407J50210_10016829 3300003373 Bacteria 1895
5 JGI25407J50210_10021812 3300003373 Bacteria 1664
6 JGI25407J50210_10022470 3300003373 Bacteria 1639
7 Ga0070658_10008865 3300005327 Bacteria 8085
8 Ga0070668_100156652 3300005347 Bacteria 1845
9 Ga0070703_10000138 3300005406 Bacteria 37506
10 Ga0070705_100241590 3300005440 Bacteria 1262
11 Ga0070705_100405480 3300005440 Bacteria 1011
12 Ga0070694_100519266 3300005444 Bacteria 950
13 Ga0070708_100006897 3300005445 Bacteria 9062
14 Ga0070708_100018246 3300005445 Bacteria 5871
15 Ga0070708_100028386 3300005445 Bacteria 4815
16 Ga0070708_100033611 3300005445 Bacteria 4456
17 Ga0070708_100083011 3300005445 Bacteria 2903
18 Ga0070708_100250725 3300005445 Bacteria 1663
19 Ga0070708_100713928 3300005445 Bacteria 943
20 Ga0070662_100039607 3300005457 Bacteria 3351
21 Ga0070685_10036346 3300005466 Bacteria 2784
22 Ga0070706_100002846 3300005467 Bacteria 17282
23 Ga0070706_100012633 3300005467 Bacteria 7815
24 Ga0070706_100024743 3300005467 Bacteria 5528
25 Ga0070706_100034814 3300005467 Bacteria 4650
26 Ga0070706_100368125 3300005467 Bacteria 1339
27 Ga0070707_100008741 3300005468 Bacteria 9392
28 Ga0070707_100019991 3300005468 Bacteria 6312
29 Ga0070707_100060074 3300005468 Bacteria 3645
30 Ga0070707_100113554 3300005468 Bacteria 2628
31 Ga0070698_100020317 3300005471 Bacteria 6959
32 Ga0070698_100021250 3300005471 Bacteria 6800
33 Ga0070698_100624846 3300005471 Bacteria 1018
34 Ga0070699_100351987 3300005518 Bacteria 1327
35 Ga0070699_100583980 3300005518 Bacteria 1018
36 Ga0070699_100990097 3300005518 Bacteria 771
37 Ga0070697_100263925 3300005536 Bacteria 1475
38 Ga0070704_100127170 3300005549 Bacteria 1968
39 Ga0068861_100102606 3300005719 Bacteria 2278
40 Ga0068851_10035262 3300005834 Bacteria 2500
41 Ga0068860_101494137 3300005843 Bacteria 697
42 Ga0081455_10002843 3300005937 Bacteria 20387
43 Ga0081455_10017639 3300005937 Bacteria 6833
44 Ga0081455_10037059 3300005937 Bacteria 4335
45 Ga0081455_10058086 3300005937 Bacteria 3276
46 Ga0081455_10292821 3300005937 Bacteria 1171
47 Ga0081538_10005309 3300005981 Bacteria 11602
48 Ga0081538_10005908 3300005981 Bacteria 10907
49 Ga0081538_10008225 3300005981 Bacteria 8893
50 Ga0081538_10008325 3300005981 Bacteria 8829
51 Ga0081538_10008993 3300005981 Bacteria 8391
52 Ga0081538_10094336 3300005981 Bacteria 1533
53 Ga0081538_10098692 3300005981 Bacteria 1479
54 Ga0081538_10106581 3300005981 Bacteria 1391
55 Ga0081538_10169368 3300005981 Bacteria 956
56 Ga0081538_10218167 3300005981 Bacteria 760
57 Ga0081539_10001512 3300005985 Bacteria 39176
58 Ga0081539_10007037 3300005985 Bacteria 10417
59 Ga0081539_10014838 3300005985 Bacteria 5722
60 Ga0081539_10177991 3300005985 Bacteria 1000
61 Ga0075432_10080201 3300006058 Bacteria 1182
62 Ga0070716_100473312 3300006173 Bacteria 918
63 Ga0070712_100239068 3300006175 Bacteria 1446
64 Ga0075427_10004907 3300006194 Bacteria 1892
65 Ga0075428_100164689 3300006844 Bacteria 2405
66 Ga0075430_100180973 3300006846 Bacteria 1753
67 Ga0075430_100234559 3300006846 Bacteria 1521
68 Ga0075433_10166555 3300006852 Bacteria 1961
69 Ga0075433_10181620 3300006852 Bacteria 1872
70 Ga0075433_10549339 3300006852 Bacteria 1015
71 Ga0075434_100022579 3300006871 Bacteria 6128
72 Ga0075434_100061642 3300006871 Bacteria 3732
73 Ga0075434_100178770 3300006871 Bacteria 2141
74 Ga0075429_100152864 3300006880 Bacteria 2021
75 Ga0068865_100146191 3300006881 Bacteria 1788
76 Ga0075436_100185828 3300006914 Unclassified 1470
77 Ga0075435_100004192 3300007076 Bacteria 9886
78 Ga0075435_100051880 3300007076 Bacteria 3304
79 Ga0075435_100092897 3300007076 Bacteria 2492
80 Ga0099794_10000258 3300007265 Bacteria 18402
81 Ga0105240_10309651 3300009093 Unclassified 1804
82 Ga0111539_10202175 3300009094 Bacteria 2316
83 Ga0111539_10341588 3300009094 Bacteria 1743
84 Ga0111539_11175035 3300009094 Bacteria 891
85 Ga0111539_11485043 3300009094 Bacteria 786
86 Ga0105245_10288484 3300009098 Bacteria 1607
87 Ga0114129_10026426 3300009147 Bacteria 8219
88 Ga0114129_10044425 3300009147 Bacteria 6251
89 Ga0114129_10483377 3300009147 Bacteria 1620
90 Ga0114129_10560556 3300009147 Bacteria 1484
91 Ga0105242_10001352 3300009176 Bacteria 19340
92 Ga0105237_10000013 3300009545 Bacteria 297699
93 Ga0105249_10130888 3300009553 Bacteria 2395
94 Ga0105246_10584214 3300011119 Bacteria 963
95 Ga0157374_10160189 3300013296 Bacteria 2192
96 Ga0157378_10003609 3300013297 Bacteria 13697
97 Ga0163162_10165255 3300013306 Bacteria 2336
98 Ga0157375_10629395 3300013308 Bacteria 1230
99 Ga0163163_10320585 3300014325 Bacteria 1603
100 Ga0163161_10403169 3300017792 Bacteria 1097
101 Ga0213875_10055653 3300021388 Bacteria 1853
102 Ga0207653_10000236 3300025885 Bacteria 36753
103 Ga0207705_10007347 3300025909 Bacteria 8096
104 Ga0207684_10001764 3300025910 Bacteria 22852
105 Ga0207684_10002331 3300025910 Bacteria 19242
106 Ga0207684_10314857 3300025910 Bacteria 1349
107 Ga0207695_10785436 3300025913 Unclassified 832
108 Ga0207671_10000024 3300025914 Bacteria 274628
109 Ga0207693_10090786 3300025915 Bacteria 2394
110 Ga0207657_10157141 3300025919 Unclassified 1849
111 Ga0207646_10017530 3300025922 Bacteria 6699
112 Ga0207646_10073355 3300025922 Bacteria 3057
113 Ga0207646_10080768 3300025922 Bacteria 2907
114 Ga0207646_10278869 3300025922 Bacteria 1510
115 Ga0207706_10089044 3300025933 Bacteria 2714
116 Ga0207686_10001785 3300025934 Bacteria 11976
117 Ga0207669_10031356 3300025937 Bacteria 2969
118 Ga0207712_10626408 3300025961 Bacteria 933
119 Ga0207648_10403456 3300026089 Bacteria 1239
120 Ga0207675_100077166 3300026118 Bacteria 3121
121 Ga0207428_10041553 3300027907 Bacteria 3722
122 Ga0207428_10332227 3300027907 Bacteria 1121
123 Ga0307408_100050204 3300031548 Bacteria 2999
124 Ga0307408_100118684 3300031548 Bacteria 2046
125 Ga0307408_100381290 3300031548 Bacteria 1205
126 Ga0307408_100462994 3300031548 Bacteria 1102
127 Ga0316575_10007170 3300031665 Bacteria 4033
128 Ga0316575_10109234 3300031665 Unclassified 1128
129 Ga0316579_10002990 3300031691 Bacteria 6500
130 Ga0316579_10037340 3300031691 Bacteria 2244
131 Ga0316579_10144227 3300031691 Bacteria 1148
132 Ga0316578_10256608 3300031728 Unclassified 1048
133 Ga0307405_10005756 3300031731 Bacteria 6024
134 Ga0307405_10152173 3300031731 Bacteria 1628
135 Ga0307405_10188142 3300031731 Bacteria 1488
136 Ga0307405_10281494 3300031731 Bacteria 1252
137 Ga0307405_10350578 3300031731 Bacteria 1138
138 Ga0316577_10001153 3300031733 Bacteria 12086
139 Ga0316577_10021620 3300031733 Bacteria 3570
140 Ga0316577_10050929 3300031733 Bacteria 2311
141 Ga0316577_10084819 3300031733 Bacteria 1772
142 Ga0316577_10105729 3300031733 Unclassified 1579
143 Ga0316577_10135031 3300031733 Bacteria 1389
144 Ga0316577_10146535 3300031733 Bacteria 1330
145 Ga0307413_10076342 3300031824 Bacteria 2129
146 Ga0307413_10238646 3300031824 Bacteria 1340
147 Ga0307413_10658305 3300031824 Bacteria 865
148 Ga0307410_10011575 3300031852 Bacteria 5052
149 Ga0307410_10041581 3300031852 Bacteria 3032
150 Ga0307410_10095305 3300031852 Bacteria 2122
151 Ga0307410_10118007 3300031852 Bacteria 1930
152 Ga0307410_10365727 3300031852 Bacteria 1156
153 Ga0307406_10209819 3300031901 Bacteria 1440
154 Ga0307406_10239446 3300031901 Bacteria 1360
155 Ga0307406_10330738 3300031901 Bacteria 1182
156 Ga0307407_10001201 3300031903 Bacteria 9164
157 Ga0307407_10027614 3300031903 Bacteria 3023
158 Ga0307407_10088214 3300031903 Bacteria 1894
159 Ga0307407_10272935 3300031903 Bacteria 1168
160 Ga0307412_10186770 3300031911 Bacteria 1564
161 Ga0307412_10230608 3300031911 Bacteria 1425
162 Ga0307412_10258906 3300031911 Bacteria 1355
163 Ga0307412_10461179 3300031911 Bacteria 1049
164 Ga0307412_10722157 3300031911 Bacteria 857
165 Ga0307409_100005376 3300031995 Bacteria 7357
166 Ga0307409_100049988 3300031995 Bacteria 3190
167 Ga0307409_100056912 3300031995 Bacteria 3026
168 Ga0307409_100103040 3300031995 Bacteria 2372
169 Ga0307409_100266001 3300031995 Bacteria 1576
170 Ga0307409_100360791 3300031995 Bacteria 1374
171 Ga0307416_100001334 3300032002 Bacteria 13291
172 Ga0307416_100027509 3300032002 Bacteria 4213
173 Ga0307416_100073470 3300032002 Bacteria 2851
174 Ga0307416_100144460 3300032002 Bacteria 2169
175 Ga0307416_100170599 3300032002 Bacteria 2024
176 Ga0307416_100258257 3300032002 Bacteria 1701
177 Ga0307416_100394246 3300032002 Bacteria 1419
178 Ga0307416_100486252 3300032002 Bacteria 1295
179 Ga0307416_100711149 3300032002 Bacteria 1094
180 Ga0307416_100883300 3300032002 Bacteria 993
181 Ga0307414_10045941 3300032004 Bacteria 2994
182 Ga0307414_10217195 3300032004 Bacteria 1567
183 Ga0307414_10404760 3300032004 Bacteria 1186
184 Ga0307415_100006496 3300032126 Bacteria 6315
185 Ga0307415_100043796 3300032126 Bacteria 2988
186 Ga0307415_100046179 3300032126 Bacteria 2925
187 Ga0307415_100067244 3300032126 Bacteria 2503
188 Ga0307415_100086631 3300032126 Bacteria 2254
189 Ga0307415_100100104 3300032126 Bacteria 2123
190 Ga0307415_100127941 3300032126 Bacteria 1917
191 Ga0307415_100199799 3300032126 Bacteria 1585
192 Ga0307415_100272774 3300032126 Bacteria 1386
193 Ga0307415_100369100 3300032126 Bacteria 1214
194 Ga0307415_100507655 3300032126 Bacteria 1055
195 Ga0316585_10001112 3300032137 Bacteria 7019
196 Ga0316574_0009443 3300035398 Bacteria 5466
197 Ga0316582_0000548 3300036647 Bacteria 14358
198 Ga0316582_0007482 3300036647 Bacteria 5818
199 Ga0316582_0036160 3300036647 Bacteria 3055
200 Ga0316582_0063665 3300036647 Bacteria 2370
201 Ga0316584_0001513 3300036712 Bacteria 14012
202 Ga0316584_0015279 3300036712 Bacteria 5487
203 Ga0316584_0042362 3300036712 Bacteria 3395
204 Ga0316584_0062572 3300036712 Bacteria 2787
205 Ga0316584_0073669 3300036712 Bacteria 2560
206 Ga0395899_0034512 3300037312 Bacteria 3800
207 Ga0395899_0266459 3300037312 Bacteria 1170
208 Ga0395899_0349015 3300037312 Bacteria 990
209 Ga0395900_0008944 3300037418 Bacteria 10271
210 Ga0395900_0025880 3300037418 Bacteria 6006
211 Ga0395900_0307125 3300037418 Bacteria 1571
212 Ga0395900_0396978 3300037418 Bacteria 1344
213 Ga0395900_0434941 3300037418 Bacteria 1271
214 Ga0395900_0637286 3300037418 Bacteria 1003
215 Ga0395898_0044769 3300037466 Bacteria 4353
216 Ga0395898_0092430 3300037466 Unclassified 2910
217 Ga0395898_0235427 3300037466 Bacteria 1746
218 Ga0395898_0978566 3300037466 Bacteria 782
219 Ga0395898_1036777 3300037466 Bacteria 755
220 Ga0395905_0118170 3300037471 Bacteria 2492
221 Ga0395905_0255963 3300037471 Bacteria 1635
222 Ga0316581_0000699 3300037588 Bacteria 6837
223 Ga0316581_0010811 3300037588 Bacteria 2539
224 Ga0436364_1044792 3300037853 Bacteria 1255
225 Ga0436364_1457976 3300037853 Bacteria 36311
226 Ga0395901_0023974 3300038443 Bacteria 6259
227 Ga0395901_0053362 3300038443 Bacteria 4200
228 Ga0395901_0464185 3300038443 Bacteria 1293
229 Ga0395901_0769255 3300038443 Bacteria 954
230 Ga0400489_15789 3300039093 Bacteria 1263
231 Ga0439448_0045792 3300042005 Bacteria 1424
232 Ga0439448_0049108 3300042005 Bacteria 1379
233 Ga0439448_0191553 3300042005 Bacteria 716
234 Ga0439450_023414 3300042008 Bacteria 1340
235 Ga0439451_014350 3300042009 Bacteria 1598
236 Ga0439454_002485 3300042011 Bacteria 1950
237 Ga0439454_006389 3300042011 Bacteria 1447
238 Ga0439455_0043513 3300042012 Bacteria 1156
239 Ga0439463_016764 3300042016 Bacteria 1812
240 Ga0439463_023466 3300042016 Bacteria 1545
241 Ga0450914_016801 3300042118 Bacteria 779
242 Ga0450923_005525 3300042125 Bacteria 2047
243 Ga0439444_0017615 3300042437 Bacteria 1228
244 Ga0439459_0032227 3300042438 Bacteria 1073
245 Ga0439459_0032480 3300042438 Bacteria 1070
246 Ga0439464_0004764 3300042439 Bacteria 3473
247 Ga0439464_0011349 3300042439 Bacteria 2360
248 Ga0439464_0030301 3300042439 Bacteria 1514
249 Ga0439464_0036917 3300042439 Bacteria 1384
250 Ga0439460_0002329 3300042461 Bacteria 4567
251 Ga0450916_008572 3300042530 Bacteria 1246
252 Ga0451577_0000006 3300042876 Bacteria 709265
253 Ga0439440_0009032 3300042993 Bacteria 2056
254 Ga0439440_0020312 3300042993 Bacteria 1488
255 Ga0439440_0116616 3300042993 Bacteria 739
256 Ga0453683_0000019 3300044673 Bacteria 287249
257 Ga0453683_0032251 3300044673 Bacteria 3306
258 Ga0453684_0000037 3300044712 Bacteria 709327
259 Ga0451576_0022576 3300045051 Bacteria 6822
260 Ga0495616_0239648 3300046513 Bacteria 783
261 Ga0495637_0180497 3300046520 Bacteria 783
262 Ga0495642_0129713 3300046528 Bacteria 1085
263 Ga0495633_0087910 3300046558 Bacteria 1445
264 Ga0495611_0121949 3300046648 Bacteria 1216
265 Ga0495661_0120235 3300046665 Bacteria 1452
266 Ga0495670_0091996 3300046691 Bacteria 1553
267 Ga0495670_0186974 3300046691 Bacteria 1095
268 Ga0495671_0301987 3300046692 Bacteria 770
269 Ga0495636_0218668 3300047318 Bacteria 874
270 Ga0495636_0219873 3300047318 Bacteria 872
271 Ga0495679_054908 3300047446 Bacteria 1185
272 Ga0496100_0113197 3300048903 Bacteria 1888
273 Ga0496101_0019378 3300048904 Bacteria 4644
274 Ga0496102_0427341 3300048905 Bacteria 1244
275 Ga0496103_0168920 3300048906 Bacteria 1404
276 Ga0496103_0587678 3300048906 Bacteria 710
277 Ga0496108_0128910 3300048911 Bacteria 2174
278 Ga0496109_0023534 3300048912 Bacteria 5468
279 Ga0496110_0286428 3300048913 Bacteria 1500
280 Ga0496110_0372954 3300048913 Bacteria 1300
281 Ga0496111_0747104 3300048914 Unclassified 710
282 Ga0496114_0161488 3300048917 Bacteria 1949
283 Ga0501031_0003631 3300049568 Bacteria 9929
284 Ga0501031_0013332 3300049568 Bacteria 5363
285 Ga0501031_0036826 3300049568 Bacteria 3192
286 Ga0501032_0028148 3300049569 Bacteria 3862
287 Ga0501032_0112601 3300049569 Bacteria 1800
288 Ga0501033_0017446 3300049570 Bacteria 5423
289 Ga0501034_1015517 3300049571 Bacteria 713
290 Ga0501036_0012841 3300049572 Bacteria 6952
291 Ga0501036_0021210 3300049572 Bacteria 5457
292 Ga0501036_0086414 3300049572 Bacteria 2651
293 Ga0501037_0007915 3300049573 Bacteria 7789
294 Ga0501037_0209310 3300049573 Bacteria 1376
295 Ga0501038_0012311 3300049574 Bacteria 7815
296 Ga0501038_0049315 3300049574 Bacteria 3641
297 Ga0501038_0157889 3300049574 Bacteria 1845
298 Ga0501039_0006084 3300049575 Bacteria 9161
299 Ga0501040_0004184 3300049576 Bacteria 9389
300 Ga0501040_0004229 3300049576 Bacteria 9345
301 Ga0501040_0010802 3300049576 Bacteria 5968
302 Ga0501041_0017303 3300049577 Bacteria 4289
303 Ga0501041_0161160 3300049577 Bacteria 1402
304 Ga0501041_0184714 3300049577 Unclassified 1305
305 Ga0501042_0002172 3300049578 Bacteria 11946
306 Ga0501043_0034226 3300049579 Bacteria 3996
307 Ga0501043_0217176 3300049579 Bacteria 1480
308 Ga0501043_0244732 3300049579 Bacteria 1383
309 Ga0501046_0004922 3300049580 Bacteria 12012
310 Ga0501046_0020465 3300049580 Bacteria 5470
311 Ga0501048_0009760 3300049582 Bacteria 7197
312 Ga0501048_0473706 3300049582 Bacteria 897
313 Ga0501068_0114172 3300049584 Bacteria 1681
314 Ga0501068_0141508 3300049584 Bacteria 1508
315 Ga0501068_0220036 3300049584 Bacteria 1207
316 Ga0501069_0094220 3300049585 Bacteria 1694
317 Ga0501070_0334668 3300049586 Bacteria 1230
318 Ga0501070_0337134 3300049586 Bacteria 1225
319 Ga0501070_0350424 3300049586 Bacteria 1198
320 Ga0501071_0001632 3300049587 Bacteria 13173
321 Ga0501071_0021820 3300049587 Bacteria 4462
322 Ga0501071_0150569 3300049587 Bacteria 1735
323 Ga0501072_0004544 3300049588 Bacteria 10549
324 Ga0501072_0066004 3300049588 Bacteria 2854
325 Ga0501074_0003709 3300049590 Bacteria 10831
326 Ga0501074_0197640 3300049590 Bacteria 1433
327 Ga0501075_0114286 3300049591 Bacteria 2052
328 Ga0501076_0003550 3300049592 Bacteria 10958
329 Ga0501076_0005239 3300049592 Bacteria 9296
330 Ga0501076_0180391 3300049592 Bacteria 1721
331 Ga0501076_0836843 3300049592 Bacteria 759
332 Ga0501077_0000779 3300049593 Bacteria 19273
333 Ga0501077_0094963 3300049593 Bacteria 1890
334 Ga0501079_0004077 3300049741 Bacteria 10822
335 Ga0501079_0039427 3300049741 Bacteria 3643
336 Ga0501079_0684741 3300049741 Bacteria 807
337 Ga0501080_0014508 3300049742 Bacteria 7258
338 Ga0501080_0167232 3300049742 Bacteria 2029
339 Ga0501081_0003874 3300049743 Bacteria 9588
340 Ga0501081_0023268 3300049743 Bacteria 4152
341 Ga0501083_0079945 3300049744 Bacteria 2168
342 Ga0501083_0100733 3300049744 Bacteria 1905
343 Ga0501035_0048971 3300049822 Bacteria 3788
344 Ga0501045_0000777 3300049824 Bacteria 20521
345 Ga0501045_0003669 3300049824 Bacteria 10559
346 Ga0501045_0072555 3300049824 Bacteria 2534
347 Ga0501045_0326209 3300049824 Unclassified 1142
348 nmdc:mga05p37_330493_c1 3300050507 Bacteria 1801
349 nmdc:mga05p37_415575_c1 3300050507 Bacteria 1567
350 nmdc:mga05p37_641891_c1 3300050507 Bacteria 1191
351 nmdc:mga05p37_80133_c1 3300050507 Bacteria 4022
352 nmdc:mga09592_151391_c1 3300050508 Bacteria 2002
353 nmdc:mga0qj67_145625_c1 3300050509 Bacteria 1921
354 nmdc:mga0qj67_427685_c1 3300050509 Bacteria 1067
355 nmdc:mga06r32_210978_c1 3300050510 Bacteria 1930
356 nmdc:mga08y16_150009_c1 3300050511 Bacteria 2424
357 nmdc:mga08y16_529995_c1 3300050511 Bacteria 1194
358 nmdc:mga08y16_774951_c1 3300050511 Bacteria 954
359 nmdc:mga0n895_294641_c1 3300050512 Bacteria 1645
360 nmdc:mga0n895_401286_c1 3300050512 Bacteria 1387
361 nmdc:mga0n895_411232_c1 3300050512 Bacteria 1368
362 nmdc:mga0n895_43673_c1 3300050512 Bacteria 4368
363 nmdc:mga0rr50_128488_c1 3300050513 Bacteria 2026
364 nmdc:mga0rr50_27124_c1 3300050513 Bacteria 4006
365 nmdc:mga0rr50_42893_c1 3300050513 Bacteria 3307
366 nmdc:mga0rr50_751754_c1 3300050513 Bacteria 832
367 nmdc:mga08x19_170463_c1 3300050514 Unclassified 1482
368 nmdc:mga08x19_459373_c1 3300050514 Bacteria 897
369 nmdc:mga0a205_135660_c1 3300050515 Bacteria 2362
370 nmdc:mga0a205_20178_c1 3300050515 Bacteria 6287
371 nmdc:mga0a205_241853_c1 3300050515 Bacteria 1686
372 Ga0501084_0003572 3300054114 Bacteria 12619
373 Ga0501084_0006581 3300054114 Bacteria 9548
374 Ga0501084_0020502 3300054114 Bacteria 5513
375 Ga0590075_000534 3300059424 Bacteria 10273
376 Ga0590075_014904 3300059424 Bacteria 1903
377 Ga0590077_006165 3300059426 Bacteria 2458
378 Ga0590077_016121 3300059426 Bacteria 1566
379 Ga0501082_0006128 3300060353 Bacteria 10438
380 Ga0501082_0006781 3300060353 Bacteria 9897
381 Ga0501082_0494995 3300060353 Bacteria 1068
382 Ga0501082_0673998 3300060353 Bacteria 905
383 Ga0530510_0000751 3300061734 Bacteria 21029
384 Ga0530510_0145612 3300061734 Bacteria 1747
385 Ga0530510_0673037 3300061734 Bacteria 788
386 JGI25407J50210_10029317
387 JGI25406J46586_10031495
388 JGI25407J50210_10003717
389 JGI25407J50210_10016829
390 JGI25407J50210_10021812
391 JGI25407J50210_10022470
392 Ga0070658_10008865
393 Ga0070668_100156652
394 Ga0070703_10000138
395 Ga0070705_100241590
396 Ga0070705_100405480
397 Ga0070694_100519266
398 Ga0070708_100006897
399 Ga0070708_100018246
400 Ga0070708_100028386
401 Ga0070708_100033611
402 Ga0070708_100083011
403 Ga0070708_100250725
404 Ga0070708_100713928
405 Ga0070662_100039607
406 Ga0070685_10036346
407 Ga0070706_100002846
408 Ga0070706_100012633
409 Ga0070706_100024743
410 Ga0070706_100034814
411 Ga0070706_100368125
412 Ga0070707_100008741
413 Ga0070707_100019991
414 Ga0070707_100060074
415 Ga0070707_100113554
416 Ga0070698_100020317
417 Ga0070698_100021250
418 Ga0070698_100624846
419 Ga0070699_100351987
420 Ga0070699_100583980
421 Ga0070699_100990097
422 Ga0070697_100263925
423 Ga0070704_100127170
424 Ga0068861_100102606
425 Ga0068851_10035262
426 Ga0068860_101494137
427 Ga0081455_10002843
428 Ga0081455_10017639
429 Ga0081455_10037059
430 Ga0081455_10058086
431 Ga0081455_10292821
432 Ga0081538_10005309
433 Ga0081538_10005908
434 Ga0081538_10008225
435 Ga0081538_10008325
436 Ga0081538_10008993
437 Ga0081538_10094336
438 Ga0081538_10098692
439 Ga0081538_10106581
440 Ga0081538_10169368
441 Ga0081538_10218167
442 Ga0081539_10001512
443 Ga0081539_10007037
444 Ga0081539_10014838
445 Ga0081539_10177991
446 Ga0075432_10080201
447 Ga0070716_100473312
448 Ga0070712_100239068
449 Ga0075427_10004907
450 Ga0075428_100164689
451 Ga0075430_100180973
452 Ga0075430_100234559
453 Ga0075433_10166555
454 Ga0075433_10181620
455 Ga0075433_10549339
456 Ga0075434_100022579
457 Ga0075434_100061642
458 Ga0075434_100178770
459 Ga0075429_100152864
460 Ga0068865_100146191
461 Ga0075436_100185828
462 Ga0075435_100004192
463 Ga0075435_100051880
464 Ga0075435_100092897
465 Ga0099794_10000258
466 Ga0105240_10309651
467 Ga0111539_10202175
468 Ga0111539_10341588
469 Ga0111539_11175035
470 Ga0111539_11485043
471 Ga0105245_10288484
472 Ga0114129_10026426
473 Ga0114129_10044425
474 Ga0114129_10483377
475 Ga0114129_10560556
476 Ga0105242_10001352
477 Ga0105237_10000013
478 Ga0105249_10130888
479 Ga0105246_10584214
480 Ga0157374_10160189
481 Ga0157378_10003609
482 Ga0163162_10165255
483 Ga0157375_10629395
484 Ga0163163_10320585
485 Ga0163161_10403169
486 Ga0213875_10055653
487 Ga0207653_10000236
488 Ga0207705_10007347
489 Ga0207684_10001764
490 Ga0207684_10002331
491 Ga0207684_10314857
492 Ga0207695_10785436
493 Ga0207671_10000024
494 Ga0207693_10090786
495 Ga0207657_10157141
496 Ga0207646_10017530
497 Ga0207646_10073355
498 Ga0207646_10080768
499 Ga0207646_10278869
500 Ga0207706_10089044
501 Ga0207686_10001785
502 Ga0207669_10031356
503 Ga0207712_10626408
504 Ga0207648_10403456
505 Ga0207675_100077166
506 Ga0207428_10041553
507 Ga0207428_10332227
508 Ga0307408_100050204
509 Ga0307408_100118684
510 Ga0307408_100381290
511 Ga0307408_100462994
512 Ga0316575_10007170
513 Ga0316575_10109234
514 Ga0316579_10002990
515 Ga0316579_10037340
516 Ga0316579_10144227
517 Ga0316578_10256608
518 Ga0307405_10005756
519 Ga0307405_10152173
520 Ga0307405_10188142
521 Ga0307405_10281494
522 Ga0307405_10350578
523 Ga0316577_10001153
524 Ga0316577_10021620
525 Ga0316577_10050929
526 Ga0316577_10084819
527 Ga0316577_10105729
528 Ga0316577_10135031
529 Ga0316577_10146535
530 Ga0307413_10076342
531 Ga0307413_10238646
532 Ga0307413_10658305
533 Ga0307410_10011575
534 Ga0307410_10041581
535 Ga0307410_10095305
536 Ga0307410_10118007
537 Ga0307410_10365727
538 Ga0307406_10209819
539 Ga0307406_10239446
540 Ga0307406_10330738
541 Ga0307407_10001201
542 Ga0307407_10027614
543 Ga0307407_10088214
544 Ga0307407_10272935
545 Ga0307412_10186770
546 Ga0307412_10230608
547 Ga0307412_10258906
548 Ga0307412_10461179
549 Ga0307412_10722157
550 Ga0307409_100005376
551 Ga0307409_100049988
552 Ga0307409_100056912
553 Ga0307409_100103040
554 Ga0307409_100266001
555 Ga0307409_100360791
556 Ga0307416_100001334
557 Ga0307416_100027509
558 Ga0307416_100073470
559 Ga0307416_100144460
560 Ga0307416_100170599
561 Ga0307416_100258257
562 Ga0307416_100394246
563 Ga0307416_100486252
564 Ga0307416_100711149
565 Ga0307416_100883300
566 Ga0307414_10045941
567 Ga0307414_10217195
568 Ga0307414_10404760
569 Ga0307415_100006496
570 Ga0307415_100043796
571 Ga0307415_100046179
572 Ga0307415_100067244
573 Ga0307415_100086631
574 Ga0307415_100100104
575 Ga0307415_100127941
576 Ga0307415_100199799
577 Ga0307415_100272774
578 Ga0307415_100369100
579 Ga0307415_100507655
580 Ga0316585_10001112
581 Ga0316574_0009443
582 Ga0316582_0000548
583 Ga0316582_0007482
584 Ga0316582_0036160
585 Ga0316582_0063665
586 Ga0316584_0001513
587 Ga0316584_0015279
588 Ga0316584_0042362
589 Ga0316584_0062572
590 Ga0316584_0073669
591 Ga0395899_0034512
592 Ga0395899_0266459
593 Ga0395899_0349015
594 Ga0395900_0008944
595 Ga0395900_0025880
596 Ga0395900_0307125
597 Ga0395900_0396978
598 Ga0395900_0434941
599 Ga0395900_0637286
600 Ga0395898_0044769
601 Ga0395898_0092430
602 Ga0395898_0235427
603 Ga0395898_0978566
604 Ga0395898_1036777
605 Ga0395905_0118170
606 Ga0395905_0255963
607 Ga0316581_0000699
608 Ga0316581_0010811
609 Ga0436364_1044792
610 Ga0436364_1457976
611 Ga0395901_0023974
612 Ga0395901_0053362
613 Ga0395901_0464185
614 Ga0395901_0769255
615 Ga0400489_15789
616 Ga0439448_0045792
617 Ga0439448_0049108
618 Ga0439448_0191553
619 Ga0439450_023414
620 Ga0439451_014350
621 Ga0439454_002485
622 Ga0439454_006389
623 Ga0439455_0043513
624 Ga0439463_016764
625 Ga0439463_023466
626 Ga0450914_016801
627 Ga0450923_005525
628 Ga0439444_0017615
629 Ga0439459_0032227
630 Ga0439459_0032480
631 Ga0439464_0004764
632 Ga0439464_0011349
633 Ga0439464_0030301
634 Ga0439464_0036917
635 Ga0439460_0002329
636 Ga0450916_008572
637 Ga0451577_0000006
638 Ga0439440_0009032
639 Ga0439440_0020312
640 Ga0439440_0116616
641 Ga0453683_0000019
642 Ga0453683_0032251
643 Ga0453684_0000037
644 Ga0451576_0022576
645 Ga0495616_0239648
646 Ga0495637_0180497
647 Ga0495642_0129713
648 Ga0495633_0087910
649 Ga0495611_0121949
650 Ga0495661_0120235
651 Ga0495670_0091996
652 Ga0495670_0186974
653 Ga0495671_0301987
654 Ga0495636_0218668
655 Ga0495636_0219873
656 Ga0495679_054908
657 Ga0496100_0113197
658 Ga0496101_0019378
659 Ga0496102_0427341
660 Ga0496103_0168920
661 Ga0496103_0587678
662 Ga0496108_0128910
663 Ga0496109_0023534
664 Ga0496110_0286428
665 Ga0496110_0372954
666 Ga0496111_0747104
667 Ga0496114_0161488
668 Ga0501031_0003631
669 Ga0501031_0013332
670 Ga0501031_0036826
671 Ga0501032_0028148
672 Ga0501032_0112601
673 Ga0501033_0017446
674 Ga0501034_1015517
675 Ga0501036_0012841
676 Ga0501036_0021210
677 Ga0501036_0086414
678 Ga0501037_0007915
679 Ga0501037_0209310
680 Ga0501038_0012311
681 Ga0501038_0049315
682 Ga0501038_0157889
683 Ga0501039_0006084
684 Ga0501040_0004184
685 Ga0501040_0004229
686 Ga0501040_0010802
687 Ga0501041_0017303
688 Ga0501041_0161160
689 Ga0501041_0184714
690 Ga0501042_0002172
691 Ga0501043_0034226
692 Ga0501043_0217176
693 Ga0501043_0244732
694 Ga0501046_0004922
695 Ga0501046_0020465
696 Ga0501048_0009760
697 Ga0501048_0473706
698 Ga0501068_0114172
699 Ga0501068_0141508
700 Ga0501068_0220036
701 Ga0501069_0094220
702 Ga0501070_0334668
703 Ga0501070_0337134
704 Ga0501070_0350424
705 Ga0501071_0001632
706 Ga0501071_0021820
707 Ga0501071_0150569
708 Ga0501072_0004544
709 Ga0501072_0066004
710 Ga0501074_0003709
711 Ga0501074_0197640
712 Ga0501075_0114286
713 Ga0501076_0003550
714 Ga0501076_0005239
715 Ga0501076_0180391
716 Ga0501076_0836843
717 Ga0501077_0000779
718 Ga0501077_0094963
719 Ga0501079_0004077
720 Ga0501079_0039427
721 Ga0501079_0684741
722 Ga0501080_0014508
723 Ga0501080_0167232
724 Ga0501081_0003874
725 Ga0501081_0023268
726 Ga0501083_0079945
727 Ga0501083_0100733
728 Ga0501035_0048971
729 Ga0501045_0000777
730 Ga0501045_0003669
731 Ga0501045_0072555
732 Ga0501045_0326209
733 nmdc:mga05p37_330493_c1
734 nmdc:mga05p37_415575_c1
735 nmdc:mga05p37_641891_c1
736 nmdc:mga05p37_80133_c1
737 nmdc:mga09592_151391_c1
738 nmdc:mga0qj67_145625_c1
739 nmdc:mga0qj67_427685_c1
740 nmdc:mga06r32_210978_c1
741 nmdc:mga08y16_150009_c1
742 nmdc:mga08y16_529995_c1
743 nmdc:mga08y16_774951_c1
744 nmdc:mga0n895_294641_c1
745 nmdc:mga0n895_401286_c1
746 nmdc:mga0n895_411232_c1
747 nmdc:mga0n895_43673_c1
748 nmdc:mga0rr50_128488_c1
749 nmdc:mga0rr50_27124_c1
750 nmdc:mga0rr50_42893_c1
751 nmdc:mga0rr50_751754_c1
752 nmdc:mga08x19_170463_c1
753 nmdc:mga08x19_459373_c1
754 nmdc:mga0a205_135660_c1
755 nmdc:mga0a205_20178_c1
756 nmdc:mga0a205_241853_c1
757 Ga0501084_0003572
758 Ga0501084_0006581
759 Ga0501084_0020502
760 Ga0590075_000534
761 Ga0590075_014904
762 Ga0590077_006165
763 Ga0590077_016121
764 Ga0501082_0006128
765 Ga0501082_0006781
766 Ga0501082_0494995
767 Ga0501082_0673998
768 Ga0530510_0000751
769 Ga0530510_0145612
770 Ga0530510_0673037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

27

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1o-assembly2.cif.gz_B structure of mycobacterium tuberculosis nadd in complex with nadp 0.9423 3 193
5das-assembly3.cif.gz_D structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2 0.9403 1 193
4s1o-assembly1.cif.gz_A structure of mycobacterium tuberculosis nadd in complex with nadp 0.9364 3 193
5das-assembly3.cif.gz_B structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2 0.9363 1 193
4ymi-assembly1.cif.gz_A crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abcessus in complex with nadp 0.9322 3 193
ID Description Score Start End Superfamily
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9236 3 193 3.40.50.620
af_Q9XXM2_4_220_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9235 2 193 3.40.50.620
af_Q0DWH7_26_248_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9148 4 200 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9089 3 193 3.40.50.620
af_A0A0R0EKS6_1_167_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9025 53 193 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A239YZ02-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9687 2 193 GO:0004515
GO:0005524
GO:0009435
AF-A0A419Y4Z9-F1-model_v4 deleted 0.9652 2 193
AF-A0A7C2YMQ2-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9637 4 194 GO:0004515
GO:0005524
GO:0009435
AF-A0A7X7ZTX7-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.963 8 193 GO:0004515
GO:0005524
GO:0009435
AF-A0A285HIE1-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9616 8 193 GO:0004515
GO:0005524
GO:0009435

Map