F430064

General Info

Members Datasets Scaffolds Average Seq Length
384 309 256 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2924718760|2924724377
Length 266
Sequence ILIVNPNTTASMTATIARAASAVAASSTEILAATSGMGPASIEGYYDEALAVPGLLDEIAGAERNGADAAVIACFDDTGLDAARALATIPVIGICEAALVTAAFIAQRFTVVTTMDRSRVPLEALVQRYGMQSKAKVRAADIPVLSLEDPASDAKSKLRSEIARALSEDRAEAIVLGCAGMADLMDELRREYGVPVIDGVAAAVKQAEALVAQGLSTSKRGAYAYPLAKPYAGALASFAPAVLAPANTDHVLNSVTGFYPKGNASG

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
9 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
10 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
11 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
12 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
13 2643221733 Bosea sp. Root381 Isolate Unclassified
14 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
15 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
16 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2751185800 Brucella pituitosa AA2 Isolate Unclassified
18 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
19 2818991436 Collimonas arenae 515 Isolate Unclassified
20 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
21 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
22 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
23 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
24 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
25 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
26 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
27 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
28 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
29 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
30 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
31 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
32 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
33 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
34 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
35 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
36 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
37 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
38 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
39 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
40 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
41 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
42 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
43 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
44 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
45 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
46 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
47 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
48 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
49 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
50 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
51 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
52 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
53 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
54 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
55 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
56 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
57 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
58 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
59 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
60 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
61 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
62 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
63 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
64 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
65 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
66 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
67 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
68 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
69 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
70 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
71 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
72 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
73 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
74 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
75 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
76 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
77 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
78 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
79 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
80 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
81 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
82 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
83 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
84 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
85 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
86 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
87 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
88 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
89 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
90 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
91 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
92 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
93 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
94 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
95 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
96 3004167301 Mesorhizobium loti 582 Isolate Unclassified
97 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
98 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
99 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
100 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
101 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
102 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
103 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
105 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
109 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
110 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
111 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
112 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
113 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
114 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
115 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
116 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
123 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
124 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
139 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
187 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
289 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
292 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
299 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
300 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
301 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
302 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
303 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
304 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
305 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
306 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
307 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
308 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
309 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.41
Metatranscriptomes 0.26
Isolates 33.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.54
Nodule 23.96
Rhizoplane 2.08
Rhizosphere 49.22
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1002249 3300002741 Bacteria 5188
2 JGI25406J46586_10016845 3300003203 Bacteria 3035
3 rootH2_10136943 3300003320 Bacteria 1290
4 JGI25404J52841_10008279 3300003659 Bacteria 2211
5 JGI25404J52841_10010355 3300003659 Bacteria 2006
6 JGI25404J52841_10031300 3300003659 Bacteria 1137
7 Ga0055542_1000572 3300003762 Bacteria 32254
8 Ga0070670_100478255 3300005331 Bacteria 1106
9 Ga0068869_100462514 3300005334 Bacteria 1053
10 Ga0068868_100465548 3300005338 Bacteria 1102
11 Ga0070660_100002828 3300005339 Bacteria 11942
12 Ga0070660_100183297 3300005339 Bacteria 1695
13 Ga0070668_100018971 3300005347 Bacteria 5168
14 Ga0070669_100089218 3300005353 Bacteria 2309
15 Ga0070674_100093981 3300005356 Bacteria 2171
16 Ga0070659_100044446 3300005366 Bacteria 3478
17 Ga0070667_100067488 3300005367 Bacteria 3041
18 Ga0070678_100253578 3300005456 Bacteria 1476
19 Ga0070678_100399354 3300005456 Bacteria 1194
20 Ga0068867_100080102 3300005459 Bacteria 2459
21 Ga0070706_100206866 3300005467 Bacteria 1833
22 Ga0070706_100232500 3300005467 Bacteria 1721
23 Ga0068853_100254454 3300005539 Bacteria 1613
24 Ga0070665_100387074 3300005548 Bacteria 1406
25 Ga0068855_100090106 3300005563 Bacteria 3540
26 Ga0070664_100294261 3300005564 Bacteria 1466
27 Ga0068857_100199321 3300005577 Bacteria 1825
28 Ga0068857_100255089 3300005577 Bacteria 1608
29 Ga0068854_100073996 3300005578 Bacteria 2498
30 Ga0068854_100077583 3300005578 Bacteria 2445
31 Ga0068852_100202176 3300005616 Bacteria 1880
32 Ga0081455_10072113 3300005937 Bacteria 2861
33 Ga0081540_1004182 3300005983 Bacteria 11108
34 Ga0081540_1015542 3300005983 Bacteria 4815
35 Ga0081540_1016296 3300005983 Bacteria 4657
36 Ga0081540_1068408 3300005983 Bacteria 1654
37 Ga0081539_10000921 3300005985 Bacteria 55381
38 Ga0075365_10031984 3300006038 Bacteria 3379
39 Ga0075365_10043065 3300006038 Bacteria 2954
40 Ga0075365_10133231 3300006038 Bacteria 1721
41 Ga0075365_10228024 3300006038 Bacteria 1307
42 Ga0075365_10361283 3300006038 Bacteria 1024
43 Ga0075368_10079831 3300006042 Bacteria 1330
44 Ga0075363_100005841 3300006048 Bacteria 5532
45 Ga0075363_100101051 3300006048 Bacteria 1596
46 Ga0075364_10006715 3300006051 Bacteria 6783
47 Ga0075364_10156191 3300006051 Bacteria 1539
48 Ga0075362_10011852 3300006177 Bacteria 3445
49 Ga0075362_10103672 3300006177 Bacteria 1332
50 Ga0075369_10031275 3300006186 Bacteria 2245
51 Ga0075370_10045300 3300006353 Bacteria 2488
52 Ga0075370_10147105 3300006353 Bacteria 1380
53 Ga0075430_100040958 3300006846 Bacteria 3920
54 Ga0075436_100366635 3300006914 Bacteria 1040
55 Ga0099794_10006532 3300007265 Bacteria 4732
56 Ga0099794_10019303 3300007265 Bacteria 3068
57 Ga0099795_10035000 3300007788 Bacteria 1753
58 Ga0105240_10146361 3300009093 Bacteria 2819
59 Ga0105242_10015326 3300009176 Bacteria 5952
60 Ga0105249_10290581 3300009553 Bacteria 1636
61 Ga0105239_10022015 3300010375 Bacteria 7027
62 Ga0105239_10093968 3300010375 Bacteria 3312
63 Ga0105239_10237313 3300010375 Bacteria 2047
64 Ga0105239_10515366 3300010375 Bacteria 1360
65 Ga0157370_10090636 3300013104 Bacteria 2871
66 Ga0157369_10125940 3300013105 Bacteria 2716
67 Ga0163163_10388918 3300014325 Bacteria 1452
68 Ga0182008_10080961 3300014497 Bacteria 1598
69 Ga0182008_10229425 3300014497 Bacteria 952
70 Ga0182006_1020169 3300015261 Bacteria 2796
71 Ga0182006_1035071 3300015261 Bacteria 2003
72 Ga0182007_10003717 3300015262 Bacteria 7132
73 Ga0182007_10021046 3300015262 Bacteria 2322
74 Ga0182005_1000666 3300015265 Bacteria 16243
75 Ga0213874_10012424 3300021377 Bacteria 2184
76 Ga0209026_1000002 3300025250 Bacteria 1136158
77 Ga0209148_1000038 3300025254 Bacteria 493744
78 Ga0209759_1000156 3300025256 Bacteria 117222
79 Ga0209233_1004616 3300025261 Bacteria 4657
80 Ga0209455_1000376 3300025272 Bacteria 40749
81 Ga0207647_10123876 3300025904 Bacteria 1523
82 Ga0207705_10109608 3300025909 Bacteria 2039
83 Ga0207705_10291065 3300025909 Bacteria 1251
84 Ga0207695_10229941 3300025913 Bacteria 1759
85 Ga0207657_10005442 3300025919 Bacteria 13298
86 Ga0207657_10040975 3300025919 Bacteria 4099
87 Ga0207694_10100456 3300025924 Bacteria 2292
88 Ga0207694_10325203 3300025924 Bacteria 1270
89 Ga0207690_10163677 3300025932 Bacteria 1661
90 Ga0207706_10287512 3300025933 Bacteria 1433
91 Ga0207686_10036120 3300025934 Bacteria 2972
92 Ga0207669_10080638 3300025937 Bacteria 2082
93 Ga0207651_10435817 3300025960 Bacteria 1122
94 Ga0207668_10373995 3300025972 Bacteria 1197
95 Ga0207640_10005441 3300025981 Bacteria 6942
96 Ga0207640_10078345 3300025981 Bacteria 2249
97 Ga0207677_10023119 3300026023 Bacteria 3833
98 Ga0207648_10064480 3300026089 Bacteria 3193
99 Ga0207674_10005137 3300026116 Bacteria 15611
100 Ga0207683_10930751 3300026121 Bacteria 807
101 Ga0207698_10127105 3300026142 Bacteria 2170
102 Ga0209179_1032387 3300027512 Bacteria 1077
103 Ga0209588_1041080 3300027671 Bacteria 1493
104 Ga0268266_10052130 3300028379 Bacteria 3513
105 Ga0268266_10132228 3300028379 Bacteria 2233
106 Ga0265318_10033995 3300028577 Bacteria 1966
107 Ga0265762_1027668 3300030760 Bacteria 1065
108 Ga0265332_10105082 3300031238 Bacteria 1190
109 Ga0265328_10054403 3300031239 Bacteria 1469
110 Ga0265328_10126569 3300031239 Bacteria 955
111 Ga0265325_10133398 3300031241 Bacteria 1187
112 Ga0265313_10035567 3300031595 Bacteria 2508
113 Ga0307514_10000727 3300031649 Bacteria 56822
114 Ga0307412_10158909 3300031911 Bacteria 1677
115 Ga0307414_10074197 3300032004 Bacteria 2464
116 Ga0315911_1000047 3300033442 Bacteria 41134
117 Ga0373948_0009684 3300034817 Bacteria 1667
118 Ga0373959_0010346 3300034820 Bacteria 1628
119 Ga0373926_0019702 3300035083 Bacteria 2327
120 Ga0373936_0005431 3300035113 Bacteria 4806
121 Ga0373945_0034914 3300035116 Bacteria 1795
122 Ga0373956_0016103 3300035119 Bacteria 3136
123 Ga0373960_0047323 3300035121 Bacteria 1265
124 Ga0373943_0006824 3300035170 Bacteria 5122
125 Ga0373946_0003879 3300035171 Bacteria 5315
126 Ga0373924_0036418 3300035410 Bacteria 2000
127 Ga0373935_0000694 3300035692 Bacteria 17825
128 Ga0373935_0026016 3300035692 Bacteria 3608
129 Ga0373927_0000136 3300035695 Bacteria 56656
130 Ga0373933_0114842 3300035724 Bacteria 1682
131 Ga0373947_0000107 3300035725 Bacteria 41080
132 Ga0373937_0011780 3300036401 Bacteria 7673
133 Ga0373925_0009110 3300037068 Bacteria 7222
134 Ga0436364_1273186 3300037853 Bacteria 1799
135 Ga0436365_0995198 3300039437 Bacteria 16216
136 Ga0439465_0129565 3300041413 Bacteria 889
137 Ga0439441_009719 3300042001 Bacteria 1599
138 Ga0451576_0608729 3300045051 Bacteria 1148
139 Ga0466967_1454443 3300045976 Bacteria 683
140 Ga0495592_0021002 3300046454 Bacteria 4965
141 Ga0495592_0045627 3300046454 Bacteria 3269
142 Ga0495603_0000019 3300046455 Bacteria 65316
143 Ga0495629_0000073 3300046459 Bacteria 87538
144 Ga0495638_0043108 3300046460 Bacteria 2847
145 Ga0495638_0224385 3300046460 Bacteria 1049
146 Ga0495641_0005346 3300046461 Bacteria 8712
147 Ga0495653_0100833 3300046463 Bacteria 2092
148 Ga0495580_0000534 3300046472 Bacteria 32210
149 Ga0495580_0034696 3300046472 Bacteria 3631
150 Ga0495582_0000019 3300046473 Bacteria 91143
151 Ga0495639_0000088 3300046475 Bacteria 44334
152 Ga0495662_0001425 3300046476 Bacteria 11838
153 Ga0495664_0004528 3300046477 Bacteria 7602
154 Ga0495594_0000742 3300046499 Bacteria 16762
155 Ga0495608_0169732 3300046511 Bacteria 1384
156 Ga0495618_0319130 3300046514 Bacteria 962
157 Ga0495628_0004495 3300046516 Bacteria 12356
158 Ga0495630_0000212 3300046517 Bacteria 45914
159 Ga0495666_0096883 3300046526 Bacteria 1391
160 Ga0495652_0119225 3300046529 Bacteria 2108
161 Ga0495652_0225190 3300046529 Bacteria 1406
162 Ga0495665_0001847 3300046531 Bacteria 11443
163 Ga0495640_0008468 3300046533 Bacteria 8064
164 Ga0495587_0179193 3300046536 Bacteria 1202
165 Ga0495645_0011195 3300046543 Bacteria 6309
166 Ga0495645_0211666 3300046543 Bacteria 1309
167 Ga0495622_0002857 3300046557 Bacteria 8241
168 Ga0495622_0084186 3300046557 Bacteria 1463
169 Ga0495667_0006558 3300046559 Bacteria 7899
170 Ga0495668_0046309 3300046616 Bacteria 2416
171 Ga0495634_0000606 3300046642 Bacteria 34706
172 Ga0495625_0034472 3300046660 Bacteria 3736
173 Ga0495635_0003967 3300046663 Bacteria 10292
174 Ga0495588_0012506 3300046674 Bacteria 4014
175 Ga0495657_0102532 3300046675 Bacteria 1821
176 Ga0495657_0229099 3300046675 Bacteria 1125
177 Ga0495599_0019073 3300046678 Bacteria 4276
178 Ga0495646_0005464 3300046680 Bacteria 8035
179 Ga0495646_0072172 3300046680 Bacteria 2030
180 Ga0495647_0005197 3300046681 Bacteria 4263
181 Ga0495658_0000054 3300046683 Bacteria 57414
182 Ga0495613_0002573 3300046689 Bacteria 13649
183 Ga0495624_0000796 3300046690 Bacteria 24913
184 Ga0495600_0001715 3300046809 Bacteria 12247
185 Ga0495600_0108911 3300046809 Bacteria 1804
186 Ga0495660_0108137 3300046810 Bacteria 1422
187 Ga0495581_0000143 3300047315 Bacteria 31307
188 Ga0495604_0054869 3300047317 Bacteria 3073
189 Ga0495604_0215146 3300047317 Bacteria 1326
190 Ga0495674_0001338 3300047319 Bacteria 24025
191 Ga0495672_0000021 3300047320 Bacteria 422795
192 Ga0495672_0021856 3300047320 Bacteria 4167
193 Ga0495672_0032048 3300047320 Bacteria 3274
194 Ga0495676_0010652 3300047321 Bacteria 8327
195 Ga0495676_0162667 3300047321 Bacteria 1578
196 Ga0495680_0226852 3300047322 Bacteria 1331
197 Ga0495673_0013567 3300047469 Bacteria 4275
198 Ga0495684_0042971 3300047471 Bacteria 3460
199 Ga0495686_0075366 3300047472 Bacteria 2069
200 Ga0495593_0000270 3300047673 Bacteria 28153
201 Ga0495602_0061671 3300048088 Bacteria 3258
202 Ga0495602_0165802 3300048088 Bacteria 1719
203 Ga0495614_0005273 3300048089 Bacteria 5828
204 Ga0496100_0082726 3300048903 Bacteria 2172
205 Ga0496104_0708688 3300048907 Bacteria 914
206 Ga0496105_0816234 3300048908 Bacteria 708
207 Ga0496106_0000339 3300048909 Bacteria 32893
208 Ga0496106_0461325 3300048909 Bacteria 1021
209 Ga0496112_0050155 3300048915 Bacteria 4092
210 Ga0496114_0081747 3300048917 Bacteria 2730
211 Ga0496114_0731605 3300048917 Bacteria 866
212 Ga0496119_0015082 3300048922 Bacteria 5982
213 Ga0496121_0000091 3300048924 Bacteria 216685
214 Ga0496121_0202031 3300048924 Bacteria 1416
215 Ga0496121_0312657 3300048924 Bacteria 1061
216 Ga0496122_0018153 3300048925 Bacteria 6516
217 Ga0496122_0044525 3300048925 Bacteria 3461
218 Ga0496123_0021982 3300048926 Bacteria 4934
219 Ga0495678_129978 3300049459 Bacteria 835
220 Ga0501034_0027834 3300049571 Bacteria 5748
221 nmdc:mga03683_9734_c1 3300050489 Bacteria 3428
222 nmdc:mga03n38_27711_c1 3300050490 Bacteria 2353
223 nmdc:mga00v17_81420_c1 3300050491 Bacteria 2022
224 nmdc:mga0yw44_127620_c1 3300050492 Bacteria 1644
225 nmdc:mga0yw44_452015_c1 3300050492 Bacteria 871
226 nmdc:mga0yw44_9432_c1 3300050492 Bacteria 4935
227 nmdc:mga0k408_136694_c1 3300050493 Bacteria 1456
228 nmdc:mga06z11_109552_c1 3300050494 Bacteria 1527
229 nmdc:mga06z11_2193_c1 3300050494 Bacteria 7411
230 nmdc:mga06z11_92849_c1 3300050494 Bacteria 1642
231 nmdc:mga07m45_14289_c1 3300050496 Bacteria 4225
232 nmdc:mga0qj67_37106_c1 3300050509 Bacteria 3816
233 Ga0495601_0007456 3300053077 Bacteria 6417
234 Ga0500610_0048693 3300053079 Bacteria 2204
235 Ga0500610_0198671 3300053079 Bacteria 968
236 Ga0500635_0170225 3300053080 Bacteria 839
237 Ga0495655_0031412 3300053083 Bacteria 1292
238 Ga0500643_015637 3300053087 Bacteria 2595
239 Ga0500566_0001125 3300053094 Bacteria 15507
240 Ga0500595_000336 3300053119 Bacteria 30876
241 Ga0500595_015860 3300053119 Bacteria 2818
242 Ga0500658_0249836 3300053134 Bacteria 815
243 Ga0500568_0000005 3300053139 Bacteria 614296
244 Ga0500574_005566 3300053141 Bacteria 2464
245 Ga0500603_008164 3300053150 Bacteria 2314
246 Ga0500616_0064085 3300053153 Bacteria 1893
247 Ga0500616_0131416 3300053153 Unclassified 1182
248 Ga0500619_000176 3300053154 Bacteria 15500
249 Ga0500620_000385 3300053155 Bacteria 8175
250 Ga0500627_0050304 3300053158 Bacteria 1815
251 Ga0500627_0069768 3300053158 Bacteria 1555
252 Ga0500627_0181428 3300053158 Bacteria 947
253 Ga0500638_000529 3300053162 Bacteria 9538
254 Ga0500636_0035110 3300053177 Bacteria 2968
255 Ga0500637_0000289 3300053178 Bacteria 18843
256 Ga0500661_002949 3300055283 Bacteria 3202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10146361 Ga0105240_101463612 200
2 3300010375 Ga0105239_10093968 Ga0105239_100939682 200
3 3300015261 Ga0182006_1035071 Ga0182006_10350712 200
4 3300025913 Ga0207695_10229941 Ga0207695_102299412 200
5 3300048915 Ga0496112_0050155 Ga0496112_0050155_2376_3128 200
6 3300048908 Ga0496105_0816234 Ga0496105_0816234_54_671 203
7 3300003659 JGI25404J52841_10031300 JGI25404J52841_100313002 208
8 3300005983 Ga0081540_1016296 Ga0081540_10162968 208
9 3300003659 JGI25404J52841_10008279 JGI25404J52841_100082792 213
10 3300005983 Ga0081540_1015542 Ga0081540_10155423 213
11 3300046460 Ga0495638_0043108 Ga0495638_0043108_200_949 213
12 3300035116 Ga0373945_0034914 Ga0373945_0034914_578_1315 214
13 3300035692 Ga0373935_0026016 Ga0373935_0026016_628_1365 214
14 3300045976 Ga0466967_1454443 Ga0466967_1454443_15_662 214
15 3300046472 Ga0495580_0034696 Ga0495580_0034696_719_1456 214
16 3300053134 Ga0500658_0249836 Ga0500658_0249836_22_672 216
17 iso_pu_bacteria 2899275550 2899276829 218
18 3300033442 Ga0315911_1000047 Ga0315911_100004721 219
19 3300005467 Ga0070706_100206866 Ga0070706_1002068662 220
20 3300006914 Ga0075436_100366635 Ga0075436_1003666352 220
21 3300048925 Ga0496122_0044525 Ga0496122_0044525_1493_2197 220
22 iso_pu_bacteria 2511231221 2512037275 220
23 iso_pu_bacteria 8054002106 8054008243 220
24 3300047321 Ga0495676_0162667 Ga0495676_0162667_292_1029 221
25 3300048924 Ga0496121_0000091 Ga0496121_0000091_107822_108556 221
26 3300049571 Ga0501034_0027834 Ga0501034_0027834_1111_1854 221
27 3300006038 Ga0075365_10228024 Ga0075365_102280242 222
28 iso_pu_bacteria 8006933436 8006936834 224
29 iso_pu_bacteria 8006973647 8006976804 224
30 iso_pu_bacteria 2643221733 2644732788 225
31 iso_pu_bacteria 2818991436 2819545253 226
32 3300007265 Ga0099794_10006532 Ga0099794_100065325 227
33 3300007265 Ga0099794_10019303 Ga0099794_100193032 227
34 3300007788 Ga0099795_10035000 Ga0099795_100350002 227
35 3300027512 Ga0209179_1032387 Ga0209179_10323871 227
36 3300027671 Ga0209588_1041080 Ga0209588_10410802 227
37 3300031649 Ga0307514_10000727 Ga0307514_1000072710 227
38 3300053080 Ga0500635_0170225 Ga0500635_0170225_103_828 227
39 3300053094 Ga0500566_0001125 Ga0500566_0001125_4652_5377 227
40 3300053119 Ga0500595_000336 Ga0500595_000336_13662_14387 227
41 3300053150 Ga0500603_008164 Ga0500603_008164_1145_1870 227
42 3300053162 Ga0500638_000529 Ga0500638_000529_3854_4579 227
43 3300053177 Ga0500636_0035110 Ga0500636_0035110_451_1176 227
44 3300053178 Ga0500637_0000289 Ga0500637_0000289_4765_5490 227
45 3300055283 Ga0500661_002949 Ga0500661_002949_1278_2003 227
46 3300003659 JGI25404J52841_10010355 JGI25404J52841_100103553 228
47 3300005467 Ga0070706_100232500 Ga0070706_1002325001 228
48 3300005937 Ga0081455_10072113 Ga0081455_100721133 228
49 3300005983 Ga0081540_1004182 Ga0081540_100418213 228
50 3300005983 Ga0081540_1068408 Ga0081540_10684082 228
51 3300035083 Ga0373926_0019702 Ga0373926_0019702_823_1563 228
52 3300035113 Ga0373936_0005431 Ga0373936_0005431_3431_4171 228
53 3300035119 Ga0373956_0016103 Ga0373956_0016103_1034_1774 228
54 3300035170 Ga0373943_0006824 Ga0373943_0006824_745_1485 228
55 3300035171 Ga0373946_0003879 Ga0373946_0003879_1666_2406 228
56 3300035410 Ga0373924_0036418 Ga0373924_0036418_1001_1741 228
57 3300035692 Ga0373935_0000694 Ga0373935_0000694_7864_8604 228
58 3300035695 Ga0373927_0000136 Ga0373927_0000136_6140_6880 228
59 3300035724 Ga0373933_0114842 Ga0373933_0114842_812_1552 228
60 3300035725 Ga0373947_0000107 Ga0373947_0000107_4644_5384 228
61 3300036401 Ga0373937_0011780 Ga0373937_0011780_2543_3283 228
62 3300037068 Ga0373925_0009110 Ga0373925_0009110_3070_3810 228
63 3300046454 Ga0495592_0045627 Ga0495592_0045627_1002_1742 228
64 3300046455 Ga0495603_0000019 Ga0495603_0000019_1653_2393 228
65 3300046459 Ga0495629_0000073 Ga0495629_0000073_50885_51625 228
66 3300046461 Ga0495641_0005346 Ga0495641_0005346_4172_4912 228
67 3300046472 Ga0495580_0000534 Ga0495580_0000534_23535_24275 228
68 3300046473 Ga0495582_0000019 Ga0495582_0000019_49902_50642 228
69 3300046475 Ga0495639_0000088 Ga0495639_0000088_27972_28712 228
70 3300046476 Ga0495662_0001425 Ga0495662_0001425_10162_10902 228
71 3300046477 Ga0495664_0004528 Ga0495664_0004528_3914_4654 228
72 3300046499 Ga0495594_0000742 Ga0495594_0000742_11029_11769 228
73 3300046511 Ga0495608_0169732 Ga0495608_0169732_101_841 228
74 3300046514 Ga0495618_0319130 Ga0495618_0319130_89_829 228
75 3300046517 Ga0495630_0000212 Ga0495630_0000212_26151_26891 228
76 3300046526 Ga0495666_0096883 Ga0495666_0096883_350_1090 228
77 3300046529 Ga0495652_0119225 Ga0495652_0119225_1190_1930 228
78 3300046531 Ga0495665_0001847 Ga0495665_0001847_9052_9792 228
79 3300046533 Ga0495640_0008468 Ga0495640_0008468_5800_6540 228
80 3300046536 Ga0495587_0179193 Ga0495587_0179193_329_1069 228
81 3300046557 Ga0495622_0002857 Ga0495622_0002857_5377_6117 228
82 3300046559 Ga0495667_0006558 Ga0495667_0006558_3777_4517 228
83 3300046642 Ga0495634_0000606 Ga0495634_0000606_7891_8631 228
84 3300046663 Ga0495635_0003967 Ga0495635_0003967_3971_4711 228
85 3300046674 Ga0495588_0012506 Ga0495588_0012506_2987_3727 228
86 3300046675 Ga0495657_0229099 Ga0495657_0229099_101_841 228
87 3300046680 Ga0495646_0005464 Ga0495646_0005464_5141_5881 228
88 3300046681 Ga0495647_0005197 Ga0495647_0005197_117_857 228
89 3300046683 Ga0495658_0000054 Ga0495658_0000054_7488_8228 228
90 3300046689 Ga0495613_0002573 Ga0495613_0002573_1281_2021 228
91 3300046690 Ga0495624_0000796 Ga0495624_0000796_8677_9417 228
92 3300046809 Ga0495600_0108911 Ga0495600_0108911_375_1115 228
93 3300047315 Ga0495581_0000143 Ga0495581_0000143_3533_4273 228
94 3300047319 Ga0495674_0001338 Ga0495674_0001338_21110_21850 228
95 3300047320 Ga0495672_0032048 Ga0495672_0032048_253_981 228
96 3300047321 Ga0495676_0010652 Ga0495676_0010652_5547_6287 228
97 3300047322 Ga0495680_0226852 Ga0495680_0226852_260_1000 228
98 3300047469 Ga0495673_0013567 Ga0495673_0013567_2602_3342 228
99 3300047471 Ga0495684_0042971 Ga0495684_0042971_2538_3278 228
100 3300047673 Ga0495593_0000270 Ga0495593_0000270_26412_27152 228
101 3300048089 Ga0495614_0005273 Ga0495614_0005273_1984_2724 228
102 3300048909 Ga0496106_0461325 Ga0496106_0461325_52_783 228
103 3300048917 Ga0496114_0081747 Ga0496114_0081747_1183_1917 228
104 3300048924 Ga0496121_0202031 Ga0496121_0202031_349_1080 228
105 3300048924 Ga0496121_0312657 Ga0496121_0312657_92_826 228
106 iso_pu_bacteria 2513237096 2513659441 228
107 iso_pu_bacteria 8019555841 8019561859 228
108 iso_pu_bacteria 8056689827 8056692627 228
109 3300003203 JGI25406J46586_10016845 JGI25406J46586_100168452 229
110 3300003320 rootH2_10136943 rootH2_101369431 229
111 3300005338 Ga0068868_100465548 Ga0068868_1004655481 229
112 3300005339 Ga0070660_100002828 Ga0070660_10000282810 229
113 3300005339 Ga0070660_100183297 Ga0070660_1001832971 229
114 3300005356 Ga0070674_100093981 Ga0070674_1000939811 229
115 3300005366 Ga0070659_100044446 Ga0070659_1000444465 229
116 3300005456 Ga0070678_100253578 Ga0070678_1002535781 229
117 3300005456 Ga0070678_100399354 Ga0070678_1003993542 229
118 3300005459 Ga0068867_100080102 Ga0068867_1000801023 229
119 3300005539 Ga0068853_100254454 Ga0068853_1002544542 229
120 3300005563 Ga0068855_100090106 Ga0068855_1000901061 229
121 3300005564 Ga0070664_100294261 Ga0070664_1002942612 229
122 3300005577 Ga0068857_100255089 Ga0068857_1002550892 229
123 3300005578 Ga0068854_100073996 Ga0068854_1000739962 229
124 3300005616 Ga0068852_100202176 Ga0068852_1002021762 229
125 3300005985 Ga0081539_10000921 Ga0081539_1000092121 229
126 3300006846 Ga0075430_100040958 Ga0075430_1000409582 229
127 3300010375 Ga0105239_10022015 Ga0105239_100220155 229
128 3300010375 Ga0105239_10515366 Ga0105239_105153662 229
129 3300013104 Ga0157370_10090636 Ga0157370_100906362 229
130 3300014325 Ga0163163_10388918 Ga0163163_103889181 229
131 3300014497 Ga0182008_10080961 Ga0182008_100809612 229
132 3300021377 Ga0213874_10012424 Ga0213874_100124242 229
133 3300025904 Ga0207647_10123876 Ga0207647_101238762 229
134 3300025909 Ga0207705_10291065 Ga0207705_102910651 229
135 3300025919 Ga0207657_10005442 Ga0207657_100054426 229
136 3300025924 Ga0207694_10325203 Ga0207694_103252032 229
137 3300025960 Ga0207651_10435817 Ga0207651_104358172 229
138 3300025981 Ga0207640_10005441 Ga0207640_100054411 229
139 3300026023 Ga0207677_10023119 Ga0207677_100231192 229
140 3300026089 Ga0207648_10064480 Ga0207648_100644802 229
141 3300026116 Ga0207674_10005137 Ga0207674_100051373 229
142 3300026121 Ga0207683_10930751 Ga0207683_109307511 229
143 3300026142 Ga0207698_10127105 Ga0207698_101271052 229
144 3300028577 Ga0265318_10033995 Ga0265318_100339952 229
145 3300030760 Ga0265762_1027668 Ga0265762_10276682 229
146 3300031238 Ga0265332_10105082 Ga0265332_101050822 229
147 3300031239 Ga0265328_10054403 Ga0265328_100544032 229
148 3300034817 Ga0373948_0009684 Ga0373948_0009684_317_1057 229
149 3300034820 Ga0373959_0010346 Ga0373959_0010346_370_1110 229
150 3300035121 Ga0373960_0047323 Ga0373960_0047323_503_1243 229
151 3300037853 Ga0436364_1273186 Ga0436364_1273186_23_715 229
152 3300039437 Ga0436365_0995198 Ga0436365_0995198_14800_15534 229
153 3300045051 Ga0451576_0608729 Ga0451576_0608729_272_1003 229
154 3300046810 Ga0495660_0108137 Ga0495660_0108137_221_952 229
155 3300047320 Ga0495672_0000021 Ga0495672_0000021_397756_398487 229
156 3300048903 Ga0496100_0082726 Ga0496100_0082726_261_995 229
157 3300048922 Ga0496119_0015082 Ga0496119_0015082_1133_1864 229
158 3300048925 Ga0496122_0018153 Ga0496122_0018153_2294_3025 229
159 3300048926 Ga0496123_0021982 Ga0496123_0021982_3693_4424 229
160 3300049459 Ga0495678_129978 Ga0495678_129978_62_793 229
161 3300050509 nmdc:mga0qj67_37106_c1 nmdc:mga0qj67_37106_c1_1959_2690 229
162 iso_pu_bacteria 2565956521 2566037733 229
163 iso_pu_bacteria 2751185800 2753358199 229
164 3300015261 Ga0182006_1020169 Ga0182006_10201692 230
165 3300015262 Ga0182007_10003717 Ga0182007_100037177 230
166 3300015265 Ga0182005_1000666 Ga0182005_10006667 230
167 3300042001 Ga0439441_009719 Ga0439441_009719_711_1442 230
168 3300046454 Ga0495592_0021002 Ga0495592_0021002_1564_2304 230
169 3300046463 Ga0495653_0100833 Ga0495653_0100833_629_1369 230
170 3300046516 Ga0495628_0004495 Ga0495628_0004495_3285_4025 230
171 3300046529 Ga0495652_0225190 Ga0495652_0225190_62_802 230
172 3300046543 Ga0495645_0011195 Ga0495645_0011195_3940_4680 230
173 3300046557 Ga0495622_0084186 Ga0495622_0084186_409_1149 230
174 3300046675 Ga0495657_0102532 Ga0495657_0102532_700_1440 230
175 3300046678 Ga0495599_0019073 Ga0495599_0019073_716_1456 230
176 3300046680 Ga0495646_0072172 Ga0495646_0072172_969_1709 230
177 3300046809 Ga0495600_0001715 Ga0495600_0001715_2783_3523 230
178 3300047317 Ga0495604_0054869 Ga0495604_0054869_1319_2059 230
179 3300047317 Ga0495604_0215146 Ga0495604_0215146_605_1300 230
180 3300048088 Ga0495602_0061671 Ga0495602_0061671_450_1190 230
181 3300048088 Ga0495602_0165802 Ga0495602_0165802_187_927 230
182 3300048909 Ga0496106_0000339 Ga0496106_0000339_21118_21870 230
183 3300050494 nmdc:mga06z11_109552_c1 nmdc:mga06z11_109552_c1_185_916 230
184 3300053077 Ga0495601_0007456 Ga0495601_0007456_1042_1782 230
185 3300053119 Ga0500595_015860 Ga0500595_015860_1718_2458 230
186 3300053141 Ga0500574_005566 Ga0500574_005566_1287_2027 230
187 3300053154 Ga0500619_000176 Ga0500619_000176_11959_12699 230
188 iso_pu_bacteria 2687453392 2688597883 230
189 iso_pu_bacteria 2757320392 2757571601 230
190 iso_pu_bacteria 2871451962 2871453030 230
191 iso_pu_bacteria 2917554339 2917558544 230
192 3300005331 Ga0070670_100478255 Ga0070670_1004782551 231
193 3300005334 Ga0068869_100462514 Ga0068869_1004625142 231
194 3300005347 Ga0070668_100018971 Ga0070668_1000189712 231
195 3300005353 Ga0070669_100089218 Ga0070669_1000892181 231
196 3300005367 Ga0070667_100067488 Ga0070667_1000674883 231
197 3300005577 Ga0068857_100199321 Ga0068857_1001993212 231
198 3300009176 Ga0105242_10015326 Ga0105242_100153264 231
199 3300009553 Ga0105249_10290581 Ga0105249_102905812 231
200 3300025933 Ga0207706_10287512 Ga0207706_102875121 231
201 3300025934 Ga0207686_10036120 Ga0207686_100361203 231
202 3300025972 Ga0207668_10373995 Ga0207668_103739951 231
203 3300031239 Ga0265328_10126569 Ga0265328_101265692 231
204 3300031241 Ga0265325_10133398 Ga0265325_101333981 231
205 3300031595 Ga0265313_10035567 Ga0265313_100355672 231
206 3300048907 Ga0496104_0708688 Ga0496104_0708688_141_896 231
207 3300050493 nmdc:mga0k408_136694_c1 nmdc:mga0k408_136694_c1_449_1225 231
208 3300053087 Ga0500643_015637 Ga0500643_015637_664_1401 231
209 iso_pu_bacteria 2597490356 2599106208 231
210 iso_pu_bacteria 2846952575 2846956006 231
211 iso_pu_bacteria 2848858292 2848862243 231
212 iso_pu_bacteria 2885350715 2885354748 231
213 iso_pu_bacteria 8005658619 8005662023 231
214 3300006048 Ga0075363_100005841 Ga0075363_1000058412 232
215 3300006177 Ga0075362_10011852 Ga0075362_100118524 232
216 3300050489 nmdc:mga03683_9734_c1 nmdc:mga03683_9734_c1_2036_2773 232
217 3300050490 nmdc:mga03n38_27711_c1 nmdc:mga03n38_27711_c1_622_1359 232
218 3300053139 Ga0500568_0000005 Ga0500568_0000005_506396_507139 232
219 iso_pu_bacteria 2738541317 2738948435 232
220 iso_pu_bacteria 2913308742 2913313224 232
221 iso_pu_bacteria 2996310559 2996311049 232
222 3300015262 Ga0182007_10021046 Ga0182007_100210462 233
223 3300047320 Ga0495672_0021856 Ga0495672_0021856_405_1151 233
224 3300053153 Ga0500616_0064085 Ga0500616_0064085_445_1194 233
225 iso_pu_bacteria 2889790730 2889791340 233
226 iso_pu_bacteria 2889914905 2889920390 233
227 3300002741 JGI25157J39369_1002249 JGI25157J39369_10022492 235
228 3300003762 Ga0055542_1000572 Ga0055542_100057226 235
229 3300005548 Ga0070665_100387074 Ga0070665_1003870742 235
230 3300005578 Ga0068854_100077583 Ga0068854_1000775833 235
231 3300006038 Ga0075365_10031984 Ga0075365_100319843 235
232 3300006038 Ga0075365_10043065 Ga0075365_100430653 235
233 3300006038 Ga0075365_10133231 Ga0075365_101332312 235
234 3300006038 Ga0075365_10361283 Ga0075365_103612832 235
235 3300006042 Ga0075368_10079831 Ga0075368_100798312 235
236 3300006048 Ga0075363_100101051 Ga0075363_1001010511 235
237 3300006051 Ga0075364_10006715 Ga0075364_100067155 235
238 3300006051 Ga0075364_10156191 Ga0075364_101561912 235
239 3300006177 Ga0075362_10103672 Ga0075362_101036722 235
240 3300006186 Ga0075369_10031275 Ga0075369_100312752 235
241 3300006353 Ga0075370_10045300 Ga0075370_100453002 235
242 3300006353 Ga0075370_10147105 Ga0075370_101471052 235
243 3300010375 Ga0105239_10237313 Ga0105239_102373132 235
244 3300013105 Ga0157369_10125940 Ga0157369_101259402 235
245 3300014497 Ga0182008_10229425 Ga0182008_102294252 235
246 3300025250 Ga0209026_1000002 Ga0209026_1000002807 235
247 3300025254 Ga0209148_1000038 Ga0209148_1000038455 235
248 3300025256 Ga0209759_1000156 Ga0209759_100015618 235
249 3300025261 Ga0209233_1004616 Ga0209233_10046165 235
250 3300025272 Ga0209455_1000376 Ga0209455_100037643 235
251 3300025909 Ga0207705_10109608 Ga0207705_101096083 235
252 3300025919 Ga0207657_10040975 Ga0207657_100409754 235
253 3300025924 Ga0207694_10100456 Ga0207694_101004563 235
254 3300025932 Ga0207690_10163677 Ga0207690_101636772 235
255 3300025937 Ga0207669_10080638 Ga0207669_100806382 235
256 3300025981 Ga0207640_10078345 Ga0207640_100783452 235
257 3300028379 Ga0268266_10052130 Ga0268266_100521302 235
258 3300028379 Ga0268266_10132228 Ga0268266_101322282 235
259 3300031911 Ga0307412_10158909 Ga0307412_101589092 235
260 3300032004 Ga0307414_10074197 Ga0307414_100741972 235
261 3300041413 Ga0439465_0129565 Ga0439465_0129565_74_829 235
262 3300046460 Ga0495638_0224385 Ga0495638_0224385_112_864 235
263 3300046543 Ga0495645_0211666 Ga0495645_0211666_494_1246 235
264 3300046616 Ga0495668_0046309 Ga0495668_0046309_503_1249 235
265 3300046660 Ga0495625_0034472 Ga0495625_0034472_1086_1838 235
266 3300047472 Ga0495686_0075366 Ga0495686_0075366_1024_1770 235
267 3300048917 Ga0496114_0731605 Ga0496114_0731605_39_791 235
268 3300050491 nmdc:mga00v17_81420_c1 nmdc:mga00v17_81420_c1_1152_1904 235
269 3300050492 nmdc:mga0yw44_127620_c1 nmdc:mga0yw44_127620_c1_408_1160 235
270 3300050492 nmdc:mga0yw44_452015_c1 nmdc:mga0yw44_452015_c1_57_809 235
271 3300050492 nmdc:mga0yw44_9432_c1 nmdc:mga0yw44_9432_c1_2108_2854 235
272 3300050494 nmdc:mga06z11_2193_c1 nmdc:mga06z11_2193_c1_6545_7297 235
273 3300050494 nmdc:mga06z11_92849_c1 nmdc:mga06z11_92849_c1_48_794 235
274 3300050496 nmdc:mga07m45_14289_c1 nmdc:mga07m45_14289_c1_1259_2005 235
275 3300053079 Ga0500610_0048693 Ga0500610_0048693_1101_1850 235
276 3300053079 Ga0500610_0198671 Ga0500610_0198671_96_842 235
277 3300053083 Ga0495655_0031412 Ga0495655_0031412_347_1099 235
278 3300053153 Ga0500616_0131416 Ga0500616_0131416_162_926 235
279 3300053155 Ga0500620_000385 Ga0500620_000385_4556_5305 235
280 3300053158 Ga0500627_0050304 Ga0500627_0050304_331_1077 235
281 3300053158 Ga0500627_0069768 Ga0500627_0069768_475_1221 235
282 3300053158 Ga0500627_0181428 Ga0500627_0181428_177_923 235
283 iso_pu_bacteria 2508501123 2509115329 235
284 iso_pu_bacteria 2508501127 2509141332 235
285 iso_pu_bacteria 2512875016 2512930230 235
286 iso_pu_bacteria 2512875024 2512957978 235
287 iso_pu_bacteria 2513237164 2514032881 235
288 iso_pu_bacteria 2513237305 2514420759 235
289 iso_pu_bacteria 2588253730 2588515877 235
290 iso_pu_bacteria 2597489875 2597815571 235
291 iso_pu_bacteria 2721755686 2723574541 235
292 iso_pu_bacteria 2841734538 2841735332 235
293 iso_pu_bacteria 2856320880 2856321633 235
294 iso_pu_bacteria 2856320880 2856324721 235
295 iso_pu_bacteria 2856342000 2856345668 235
296 iso_pu_bacteria 2856356410 2856361306 235
297 iso_pu_bacteria 2869162929 2869166896 235
298 iso_pu_bacteria 2869278585 2869281286 235
299 iso_pu_bacteria 2869278585 2869284515 235
300 iso_pu_bacteria 2871474448 2871479151 235
301 iso_pu_bacteria 2871488783 2871493137 235
302 iso_pu_bacteria 2874123672 2874123987 235
303 iso_pu_bacteria 2874139085 2874139853 235
304 iso_pu_bacteria 2874139085 2874141048 235
305 iso_pu_bacteria 2874168670 2874170266 235
306 iso_pu_bacteria 2876363079 2876366205 235
307 iso_pu_bacteria 2878738818 2878739947 235
308 iso_pu_bacteria 2878738818 2878742830 235
309 iso_pu_bacteria 2878753008 2878757182 235
310 iso_pu_bacteria 2878788777 2878792571 235
311 iso_pu_bacteria 2881155292 2881161154 235
312 iso_pu_bacteria 2881845957 2881850336 235
313 iso_pu_bacteria 2881853255 2881855155 235
314 iso_pu_bacteria 2881861095 2881867678 235
315 iso_pu_bacteria 2882632389 2882632663 235
316 iso_pu_bacteria 2882912400 2882919456 235
317 iso_pu_bacteria 2885312484 2885315588 235
318 iso_pu_bacteria 2885318864 2885319527 235
319 iso_pu_bacteria 2885342637 2885345177 235
320 iso_pu_bacteria 2888337043 2888340990 235
321 iso_pu_bacteria 2888343758 2888349329 235
322 iso_pu_bacteria 2903448605 2903452409 235
323 iso_pu_bacteria 2903492973 2903500909 235
324 iso_pu_bacteria 2903521522 2903524073 235
325 iso_pu_bacteria 2903528002 2903533744 235
326 iso_pu_bacteria 2924718760 2924719924 235
327 iso_pu_bacteria 2924718760 2924724377 235
328 iso_pu_bacteria 2924754689 2924757885 235
329 iso_pu_bacteria 2924762789 2924763460 235
330 iso_pu_bacteria 2924776078 2924777546 235
331 iso_pu_bacteria 2924776078 2924780630 235
332 iso_pu_bacteria 2924784321 2924786486 235
333 iso_pu_bacteria 2937822353 2937823604 235
334 iso_pu_bacteria 2937836603 2937842148 235
335 iso_pu_bacteria 2937848649 2937854400 235
336 iso_pu_bacteria 2937877337 2937879870 235
337 iso_pu_bacteria 2937877337 2937883689 235
338 iso_pu_bacteria 2937972304 2937974534 235
339 iso_pu_bacteria 2937972304 2937976192 235
340 iso_pu_bacteria 2958034702 2958037248 235
341 iso_pu_bacteria 2958034702 2958038943 235
342 iso_pu_bacteria 2958041894 2958046960 235
343 iso_pu_bacteria 2958041894 2958056223 235
344 iso_pu_bacteria 2958064165 2958067473 235
345 iso_pu_bacteria 2958071322 2958075671 235
346 iso_pu_bacteria 2958084443 2958087048 235
347 iso_pu_bacteria 2958084443 2958090967 235
348 iso_pu_bacteria 2958092219 2958098056 235
349 iso_pu_bacteria 2958144490 2958144981 235
350 iso_pu_bacteria 2961127735 2961132773 235
351 iso_pu_bacteria 2961170736 2961175489 235
352 iso_pu_bacteria 2963644680 2963649001 235
353 iso_pu_bacteria 2967996073 2967999509 235
354 iso_pu_bacteria 2968003550 2968007867 235
355 iso_pu_bacteria 2968016561 2968016830 235
356 iso_pu_bacteria 2968016561 2968019933 235
357 iso_pu_bacteria 2968083720 2968084189 235
358 iso_pu_bacteria 2970469710 2970470273 235
359 iso_pu_bacteria 2970469710 2970473254 235
360 iso_pu_bacteria 2970503327 2970508077 235
361 iso_pu_bacteria 2970524798 2970531087 235
362 iso_pu_bacteria 2970540015 2970542725 235
363 iso_pu_bacteria 2970593180 2970595890 235
364 iso_pu_bacteria 2970593180 2970599131 235
365 iso_pu_bacteria 2977821940 2977826341 235
366 iso_pu_bacteria 2977922695 2977926814 235
367 iso_pu_bacteria 2977986579 2977988091 235
368 iso_pu_bacteria 2979808191 2979813261 235
369 iso_pu_bacteria 2987666974 2987667713 235
370 iso_pu_bacteria 2989771324 2989775281 235
371 iso_pu_bacteria 2996348954 2996351554 235
372 iso_pu_bacteria 3004167301 3004170520 235
373 iso_pu_bacteria 3004211236 3004214974 235
374 iso_pu_bacteria 3004218560 3004222435 235
375 iso_pu_bacteria 3004275668 3004278254 235
376 iso_pu_bacteria 3004289098 3004290629 235
377 iso_pu_bacteria 3004289098 3004295279 235
378 iso_pu_bacteria 3004334049 3004339820 235
379 iso_pu_bacteria 637000159 637080010 235
380 iso_pu_bacteria 8004374579 8004378757 235
381 iso_pu_bacteria 8004395343 8004395540 235
382 iso_pu_bacteria 8004633249 8004636847 235
383 iso_pu_bacteria 8055617313 8055623754 235
384 iso_pu_bacteria 8056875544 8056879810 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

1

207

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qvk-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9663 2 229
3qvj-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9658 2 229
5lfd-assembly1.cif.gz_A crystal structure of allantoin racemase from pseudomonas fluorescens allr 0.9485 2 222
3qvk-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9343 2 229
3qvj-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9338 2 229
ID Description Score Start End Superfamily
3qvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9572 2 229 3.40.50.12500
5lfdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9485 2 222 3.40.50.12500
af_O74886_3_236_3.40.50.12500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9329 2 215 3.40.50.12500
af_Q09921_2_237_3.40.50.12500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9204 2 214 3.40.50.12500
3qvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9098 2 229 3.40.50.12500
ID Description Score Start End GO Terms
AF-A0A527ZGD1-F1-model_v4 Aspartate/glutamate racemase family protein 1.002 35 187 GO:0036361
AF-A0A441U6J9-F1-model_v4 Aspartate/glutamate racemase family protein 0.9968 2 229 GO:0036361
AF-A0A7W3WF67-F1-model_v4 deleted 0.9954 1 235
AF-A0A527ZGD1-F1-model_v4 Aspartate/glutamate racemase family protein 0.9951 35 187 GO:0036361
AF-A0A444KIW8-F1-model_v4 Aspartate/glutamate racemase family protein 0.9923 1 160 GO:0036361

Feature Viewer

pLDDT pTM Quality
94.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map