F430049

General Info

Members Datasets Scaffolds Average Seq Length
384 251 384 142

Family's Representative Sequence

Representative Sequence 3300059503|Ga0587080_035639|Ga0587080_035639_116_619
Length 161
Sequence MAEKKATTKAAAAKSEKSVEGAALKLHHLRPAPGAKTAKTRVGRGEGSKGKTATKARYQVPERFEGGAMPLHMRLPKLRGFKNPFKVEYQVVNLDKLSALYPQGGDVTVDDLVAKGAVRDSAPVKVLGDGEISVKVNVTADKFSASAKEKIEAAGGSVTSA

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
93 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
94 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
95 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
113 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
239 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
244 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 5.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 11.2
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1004152 3300003792 Bacteria 6689
2 Ga0055540_1004715 3300003792 Bacteria 6034
3 Ga0058860_12162448 3300004801 Bacteria 733
4 Ga0070683_100113665 3300005329 Bacteria 2555
5 Ga0070683_100444800 3300005329 Bacteria 1237
6 Ga0070682_100151709 3300005337 Bacteria 1591
7 Ga0070682_100167049 3300005337 Bacteria 1525
8 Ga0070689_100213947 3300005340 Bacteria 1579
9 Ga0070661_100755021 3300005344 Bacteria 796
10 Ga0070675_100854487 3300005354 Bacteria 833
11 Ga0070673_101588614 3300005364 Bacteria 618
12 Ga0070659_100723906 3300005366 Bacteria 862
13 Ga0070705_100088938 3300005440 Bacteria 1918
14 Ga0070694_100311487 3300005444 Bacteria 1209
15 Ga0070663_100126619 3300005455 Bacteria 1935
16 Ga0070663_100251917 3300005455 Bacteria 1398
17 Ga0070663_100633567 3300005455 Bacteria 902
18 Ga0070662_100083476 3300005457 Bacteria 2385
19 Ga0070681_10132466 3300005458 Bacteria 2425
20 Ga0070684_100289088 3300005535 Bacteria 1503
21 Ga0068853_100442403 3300005539 Bacteria 1222
22 Ga0070696_100122169 3300005546 Bacteria 1886
23 Ga0070693_100057117 3300005547 Bacteria 2255
24 Ga0070704_100030462 3300005549 Bacteria 3616
25 Ga0070664_100126070 3300005564 Bacteria 2246
26 Ga0068856_100405080 3300005614 Bacteria 1384
27 Ga0068856_100501707 3300005614 Bacteria 1234
28 Ga0070702_100108241 3300005615 Bacteria 1718
29 Ga0068852_100769343 3300005616 Bacteria 976
30 Ga0068864_100728039 3300005618 Bacteria 971
31 Ga0068861_101342256 3300005719 Bacteria 697
32 Ga0068863_100221580 3300005841 Bacteria 1823
33 Ga0081455_10056772 3300005937 Bacteria 3322
34 Ga0075365_10211881 3300006038 Bacteria 1358
35 Ga0075363_100312411 3300006048 Bacteria 913
36 Ga0070715_10005567 3300006163 Bacteria 4211
37 Ga0075362_10187293 3300006177 Bacteria 1004
38 Ga0075367_10867273 3300006178 Bacteria 575
39 Ga0075369_10138742 3300006186 Bacteria 1108
40 Ga0075369_10464263 3300006186 Bacteria 600
41 Ga0097621_100689784 3300006237 Bacteria 939
42 Ga0075370_10237195 3300006353 Bacteria 1080
43 Ga0068871_100079492 3300006358 Bacteria 2713
44 Ga0068871_102158604 3300006358 Bacteria 531
45 Ga0075434_100041293 3300006871 Bacteria 4570
46 Ga0075429_100536119 3300006880 Bacteria 1026
47 Ga0075436_100071908 3300006914 Bacteria 2392
48 Ga0075435_100058154 3300007076 Bacteria 3130
49 Ga0105240_11860537 3300009093 Bacteria 627
50 Ga0111539_11161481 3300009094 Bacteria 897
51 Ga0105247_10230911 3300009101 Bacteria 1256
52 Ga0105247_10361125 3300009101 Bacteria 1024
53 Ga0114129_11209215 3300009147 Bacteria 941
54 Ga0105243_11233629 3300009148 Bacteria 762
55 Ga0105243_11441344 3300009148 Bacteria 710
56 Ga0105241_10069588 3300009174 Bacteria 2729
57 Ga0105242_10120106 3300009176 Bacteria 2254
58 Ga0105237_10039615 3300009545 Bacteria 4757
59 Ga0105237_10235088 3300009545 Bacteria 1834
60 Ga0105238_10824744 3300009551 Bacteria 944
61 Ga0105238_11199324 3300009551 Bacteria 783
62 Ga0105239_10030807 3300010375 Bacteria 5900
63 Ga0105239_11687202 3300010375 Bacteria 733
64 Ga0157343_1005699 3300012488 Bacteria 817
65 Ga0157371_10973365 3300013102 Bacteria 646
66 Ga0157378_10271900 3300013297 Bacteria 1630
67 Ga0157372_11217066 3300013307 Bacteria 870
68 Ga0157372_11299954 3300013307 Bacteria 839
69 Ga0157372_12462515 3300013307 Bacteria 597
70 Ga0157375_10287606 3300013308 Bacteria 1807
71 Ga0157375_10364554 3300013308 Bacteria 1611
72 Ga0157375_11372316 3300013308 Bacteria 832
73 Ga0157375_11665787 3300013308 Bacteria 755
74 Ga0163163_10700508 3300014325 Bacteria 1076
75 Ga0182008_10207458 3300014497 Bacteria 999
76 Ga0157379_10371909 3300014968 Bacteria 1310
77 Ga0157376_10020322 3300014969 Bacteria 5136
78 Ga0163161_10271202 3300017792 Bacteria 1328
79 Ga0197907_10006480 3300020069 Bacteria 5144
80 Ga0197907_10182491 3300020069 Bacteria 1029
81 Ga0197907_10881634 3300020069 Bacteria 2291
82 Ga0206354_10622447 3300020081 Bacteria 1374
83 Ga0213876_10087575 3300021384 Bacteria 1649
84 Ga0224712_10117673 3300022467 Bacteria 1147
85 Ga0209673_1008304 3300025273 Bacteria 4632
86 Ga0209051_1001135 3300025303 Bacteria 24362
87 Ga0209051_1029877 3300025303 Bacteria 2125
88 Ga0207692_10013590 3300025898 Bacteria 3535
89 Ga0207685_10000572 3300025905 Bacteria 6401
90 Ga0207699_10159282 3300025906 Bacteria 1501
91 Ga0207707_10247608 3300025912 Bacteria 1548
92 Ga0207695_10576545 3300025913 Bacteria 1006
93 Ga0207671_10133288 3300025914 Bacteria 1908
94 Ga0207671_10513077 3300025914 Bacteria 956
95 Ga0207700_10011797 3300025928 Bacteria 5594
96 Ga0207664_10006431 3300025929 Bacteria 8085
97 Ga0207690_10471783 3300025932 Bacteria 1012
98 Ga0207690_11588770 3300025932 Bacteria 547
99 Ga0207706_10027808 3300025933 Bacteria 5055
100 Ga0207706_10126491 3300025933 Bacteria 2248
101 Ga0207709_10915537 3300025935 Bacteria 713
102 Ga0207669_10961499 3300025937 Bacteria 716
103 Ga0207661_10477720 3300025944 Bacteria 1137
104 Ga0207679_10014438 3300025945 Bacteria 5195
105 Ga0207677_10268571 3300026023 Bacteria 1394
106 Ga0207703_12042854 3300026035 Bacteria 549
107 Ga0207678_10104325 3300026067 Bacteria 2419
108 Ga0207702_10339409 3300026078 Bacteria 1435
109 Ga0207641_10101552 3300026088 Bacteria 2535
110 Ga0207675_101569721 3300026118 Bacteria 679
111 Ga0207683_10669783 3300026121 Bacteria 961
112 Ga0207698_11728711 3300026142 Bacteria 641
113 Ga0268266_10240661 3300028379 Bacteria 1670
114 Ga0307515_10023996 3300028794 Bacteria 10651
115 Ga0307511_10343502 3300030521 Bacteria 646
116 Ga0316177_1027848 3300030731 Bacteria 5667
117 Ga0316176_1134316 3300030732 Bacteria 517
118 Ga0316176_1136806 3300030732 Bacteria 1464
119 Ga0314311_1073968 3300030733 Bacteria 1353
120 Ga0314311_1115631 3300030733 Bacteria 963
121 Ga0316178_1092554 3300030735 Bacteria 693
122 Ga0316178_1129293 3300030735 Bacteria 1385
123 Ga0316183_1010663 3300030742 Bacteria 1235
124 Ga0316181_1184592 3300030744 Bacteria 1540
125 Ga0316182_1321357 3300030745 Bacteria 1759
126 Ga0265327_10049310 3300031251 Bacteria 2209
127 Ga0307408_101213405 3300031548 Bacteria 704
128 Ga0307405_10821275 3300031731 Bacteria 780
129 Ga0307413_10640775 3300031824 Bacteria 875
130 Ga0307518_10043043 3300031838 Bacteria 3287
131 Ga0307409_100712916 3300031995 Bacteria 1004
132 Ga0307409_102052729 3300031995 Bacteria 601
133 Ga0307416_100683504 3300032002 Bacteria 1114
134 Ga0307416_100940737 3300032002 Bacteria 966
135 Ga0307414_10792953 3300032004 Bacteria 863
136 Ga0307411_10243671 3300032005 Bacteria 1409
137 Ga0307411_10299048 3300032005 Bacteria 1290
138 Ga0307415_100219583 3300032126 Bacteria 1523
139 Ga0307415_101180669 3300032126 Bacteria 720
140 Ga0373930_0033414 3300034816 Bacteria 1068
141 Ga0373950_0003307 3300034818 Bacteria 2295
142 Ga0373958_0027736 3300034819 Bacteria 1092
143 Ga0373959_0002984 3300034820 Bacteria 2688
144 Ga0373938_0108510 3300034957 Bacteria 704
145 Ga0373929_0013568 3300035085 Bacteria 1562
146 Ga0373940_0020690 3300035088 Bacteria 1674
147 Ga0373949_0063720 3300035090 Bacteria 953
148 Ga0373951_0005248 3300035091 Bacteria 3019
149 Ga0373952_0001703 3300035092 Bacteria 3997
150 Ga0373932_0037154 3300035112 Bacteria 1386
151 Ga0373939_0006080 3300035114 Bacteria 2899
152 Ga0373941_0014005 3300035115 Bacteria 2133
153 Ga0373960_0015520 3300035121 Bacteria 1945
154 Ga0373942_0050609 3300035207 Bacteria 1164
155 Ga0373962_0117968 3300035242 Bacteria 843
156 Ga0316574_0175992 3300035398 Bacteria 1377
157 Ga0373931_0046634 3300035691 Bacteria 2291
158 Ga0395905_0033921 3300037471 Bacteria 4794
159 Ga0395905_0233728 3300037471 Bacteria 1719
160 Ga0395901_0020078 3300038443 Bacteria 6838
161 Ga0436365_1927535 3300039437 Bacteria 2285
162 Ga0439466_0040172 3300041411 Bacteria 1565
163 Ga0451794_44842 3300041446 Bacteria 654
164 Ga0451791_0837055 3300041451 Bacteria 1151
165 Ga0451795_0304532 3300041456 Bacteria 834
166 Ga0451800_0000317 3300041459 Bacteria 807
167 Ga0451800_0423470 3300041459 Bacteria 1017
168 Ga0451807_1030011 3300041486 Bacteria 1003
169 Ga0451833_1085045 3300041491 Bacteria 1213
170 Ga0451837_0451591 3300041494 Bacteria 682
171 Ga0451841_0559219 3300041498 Bacteria 797
172 Ga0451843_0272354 3300041509 Bacteria 1968
173 Ga0450920_074000 3300042122 Bacteria 695
174 Ga0439434_0051656 3300042435 Bacteria 1275
175 Ga0466972_0052569 3300044658 Bacteria 1963
176 Ga0466965_0464070 3300044683 Bacteria 706
177 Ga0466966_0132932 3300044684 Bacteria 1523
178 Ga0466961_0010717 3300044693 Bacteria 5856
179 Ga0466961_0034813 3300044693 Bacteria 3233
180 Ga0466963_0150645 3300044694 Bacteria 1615
181 Ga0466964_0002255 3300044706 Bacteria 6836
182 Ga0466964_0037975 3300044706 Bacteria 1935
183 Ga0466964_0857590 3300044706 Bacteria 517
184 Ga0466971_0000019 3300044719 Bacteria 79360
185 Ga0466971_0129111 3300044719 Bacteria 1172
186 Ga0466971_0165932 3300044719 Bacteria 1035
187 Ga0466970_0031630 3300044765 Bacteria 2795
188 Ga0466957_0021350 3300044842 Bacteria 3815
189 Ga0466957_0046083 3300044842 Bacteria 2646
190 Ga0466957_0333245 3300044842 Bacteria 1026
191 Ga0466960_0167594 3300044901 Bacteria 1183
192 Ga0466959_0003104 3300045049 Bacteria 10766
193 Ga0466959_0020345 3300045049 Bacteria 4889
194 Ga0466959_0046466 3300045049 Bacteria 3194
195 Ga0466967_0151067 3300045976 Bacteria 2171
196 Ga0466967_0218928 3300045976 Bacteria 1808
197 Ga0466967_0267692 3300045976 Bacteria 1636
198 Ga0466967_0869057 3300045976 Bacteria 896
199 Ga0466967_0985070 3300045976 Bacteria 839
200 Ga0466967_2610170 3300045976 Bacteria 500
201 Ga0495629_0419904 3300046459 Bacteria 908
202 Ga0495629_0901842 3300046459 Bacteria 579
203 Ga0495641_0043589 3300046461 Bacteria 2075
204 Ga0495651_0062364 3300046462 Bacteria 2852
205 Ga0495653_0405944 3300046463 Bacteria 865
206 Ga0495582_0408869 3300046473 Bacteria 783
207 Ga0495662_0021946 3300046476 Bacteria 3085
208 Ga0495618_0478248 3300046514 Bacteria 753
209 Ga0495630_0323543 3300046517 Bacteria 1179
210 Ga0495667_0203803 3300046559 Bacteria 1266
211 Ga0495625_0045827 3300046660 Bacteria 3159
212 Ga0495635_0341284 3300046663 Bacteria 1000
213 Ga0495657_0210772 3300046675 Bacteria 1181
214 Ga0495623_0531881 3300046679 Bacteria 617
215 Ga0495649_0085690 3300046694 Bacteria 1682
216 Ga0495674_0312055 3300047319 Bacteria 1283
217 Ga0495674_0975881 3300047319 Bacteria 650
218 Ga0495626_0015031 3300048091 Bacteria 3968
219 Ga0496100_0045996 3300048903 Bacteria 2803
220 Ga0496101_0280952 3300048904 Bacteria 1301
221 Ga0496101_0973439 3300048904 Bacteria 667
222 Ga0496102_0030612 3300048905 Bacteria 4817
223 Ga0496102_0228130 3300048905 Bacteria 1756
224 Ga0496102_0325632 3300048905 Bacteria 1447
225 Ga0496103_0133264 3300048906 Bacteria 1587
226 Ga0496104_0077807 3300048907 Bacteria 3160
227 Ga0496104_0442719 3300048907 Bacteria 1211
228 Ga0496104_1177615 3300048907 Bacteria 670
229 Ga0496105_0394437 3300048908 Bacteria 1099
230 Ga0496106_0011966 3300048909 Bacteria 6405
231 Ga0496106_0206503 3300048909 Bacteria 1564
232 Ga0496107_0018694 3300048910 Bacteria 4882
233 Ga0496107_0042730 3300048910 Bacteria 3255
234 Ga0496108_0031392 3300048911 Bacteria 4408
235 Ga0496108_1044306 3300048911 Bacteria 696
236 Ga0496109_0480867 3300048912 Bacteria 1172
237 Ga0496109_0497966 3300048912 Bacteria 1150
238 Ga0496110_0200426 3300048913 Bacteria 1813
239 Ga0496110_0213365 3300048913 Bacteria 1755
240 Ga0496111_0095773 3300048914 Bacteria 2178
241 Ga0496111_0497992 3300048914 Bacteria 897
242 Ga0496112_0422639 3300048915 Bacteria 1271
243 Ga0496112_0518369 3300048915 Bacteria 1127
244 Ga0496112_0620815 3300048915 Bacteria 1012
245 Ga0496113_0336516 3300048916 Bacteria 1210
246 Ga0496113_0398193 3300048916 Bacteria 1105
247 Ga0496113_0691914 3300048916 Bacteria 814
248 Ga0496113_1150399 3300048916 Bacteria 607
249 Ga0496114_0010283 3300048917 Bacteria 7446
250 Ga0496114_0025058 3300048917 Bacteria 4873
251 Ga0496114_0054005 3300048917 Bacteria 3349
252 Ga0496114_0063800 3300048917 Bacteria 3084
253 Ga0496114_0112417 3300048917 Bacteria 2334
254 Ga0496115_0004035 3300048918 Bacteria 10597
255 Ga0496115_0144167 3300048918 Bacteria 1965
256 Ga0501306_001885 3300049127 Bacteria 2055
257 Ga0501309_013479 3300049129 Bacteria 1088
258 Ga0501309_070412 3300049129 Bacteria 574
259 Ga0501310_067098 3300049130 Bacteria 544
260 Ga0501307_032008 3300049162 Bacteria 733
261 Ga0501312_019754 3300049528 Bacteria 992
262 Ga0501312_045434 3300049528 Bacteria 728
263 Ga0501313_005633 3300049529 Bacteria 1330
264 Ga0501318_007107 3300049534 Bacteria 1160
265 Ga0501321_001521 3300049537 Bacteria 1865
266 Ga0501323_063174 3300049539 Bacteria 581
267 Ga0501031_0044403 3300049568 Bacteria 2900
268 Ga0501032_0000438 3300049569 Bacteria 34232
269 Ga0501032_0159986 3300049569 Bacteria 1479
270 Ga0501032_0474396 3300049569 Bacteria 800
271 Ga0501033_0001612 3300049570 Bacteria 19830
272 Ga0501033_0012866 3300049570 Bacteria 6382
273 Ga0501033_0232279 3300049570 Bacteria 1310
274 Ga0501033_1083200 3300049570 Bacteria 533
275 Ga0501034_0001245 3300049571 Bacteria 34615
276 Ga0501034_0555488 3300049571 Bacteria 1057
277 Ga0501034_1661504 3300049571 Bacteria 511
278 Ga0501036_0000668 3300049572 Bacteria 25177
279 Ga0501036_0003874 3300049572 Bacteria 12000
280 Ga0501036_0123965 3300049572 Bacteria 2182
281 Ga0501036_0249858 3300049572 Bacteria 1486
282 Ga0501036_0366861 3300049572 Bacteria 1202
283 Ga0501037_0000998 3300049573 Bacteria 20981
284 Ga0501037_0060775 3300049573 Bacteria 2756
285 Ga0501037_0226159 3300049573 Bacteria 1315
286 Ga0501038_0000265 3300049574 Bacteria 44237
287 Ga0501038_0009388 3300049574 Bacteria 8975
288 Ga0501038_1138623 3300049574 Bacteria 568
289 Ga0501039_0000814 3300049575 Bacteria 22509
290 Ga0501039_0057982 3300049575 Bacteria 2998
291 Ga0501039_0292962 3300049575 Bacteria 1279
292 Ga0501039_0307348 3300049575 Bacteria 1246
293 Ga0501040_0022758 3300049576 Bacteria 4198
294 Ga0501040_0064803 3300049576 Bacteria 2516
295 Ga0501041_0032251 3300049577 Bacteria 3166
296 Ga0501041_0082746 3300049577 Bacteria 1978
297 Ga0501041_0260710 3300049577 Bacteria 1090
298 Ga0501042_0011118 3300049578 Bacteria 6064
299 Ga0501042_0064088 3300049578 Bacteria 2626
300 Ga0501042_0901233 3300049578 Bacteria 644
301 Ga0501043_0001438 3300049579 Bacteria 20808
302 Ga0501043_0151092 3300049579 Bacteria 1817
303 Ga0501043_0693561 3300049579 Bacteria 744
304 Ga0501046_0001551 3300049580 Bacteria 21926
305 Ga0501046_0185627 3300049580 Bacteria 1553
306 Ga0501046_0325906 3300049580 Bacteria 1118
307 Ga0501046_1179617 3300049580 Bacteria 527
308 Ga0501047_0000855 3300049581 Bacteria 31151
309 Ga0501047_0016967 3300049581 Bacteria 6962
310 Ga0501047_0048540 3300049581 Bacteria 4099
311 Ga0501048_0000857 3300049582 Bacteria 22424
312 Ga0501048_0008384 3300049582 Bacteria 7814
313 Ga0501068_0076279 3300049584 Bacteria 2051
314 Ga0501069_0000506 3300049585 Bacteria 17812
315 Ga0501069_0057454 3300049585 Bacteria 2169
316 Ga0501069_0349314 3300049585 Bacteria 871
317 Ga0501070_0001773 3300049586 Bacteria 19097
318 Ga0501070_0004983 3300049586 Bacteria 11332
319 Ga0501070_0007652 3300049586 Bacteria 9170
320 Ga0501070_0114838 3300049586 Bacteria 2224
321 Ga0501070_0188691 3300049586 Bacteria 1695
322 Ga0501070_0425600 3300049586 Bacteria 1072
323 Ga0501071_0106954 3300049587 Bacteria 2065
324 Ga0501071_0115749 3300049587 Bacteria 1984
325 Ga0501071_0126629 3300049587 Bacteria 1896
326 Ga0501072_0264583 3300049588 Bacteria 1369
327 Ga0501073_0309151 3300049589 Bacteria 1090
328 Ga0501074_0000257 3300049590 Bacteria 30059
329 Ga0501074_0003766 3300049590 Bacteria 10779
330 Ga0501074_0014330 3300049590 Bacteria 5767
331 Ga0501074_0225337 3300049590 Bacteria 1335
332 Ga0501075_0086070 3300049591 Bacteria 2381
333 Ga0501075_0500559 3300049591 Bacteria 927
334 Ga0501076_0084392 3300049592 Bacteria 2551
335 Ga0501076_0251907 3300049592 Bacteria 1445
336 Ga0501076_0853585 3300049592 Bacteria 751
337 Ga0501079_0030413 3300049741 Bacteria 4148
338 Ga0501080_0183395 3300049742 Bacteria 1925
339 Ga0501080_0202230 3300049742 Bacteria 1823
340 Ga0501080_0459148 3300049742 Bacteria 1141
341 Ga0501080_1718626 3300049742 Bacteria 529
342 Ga0501081_0008966 3300049743 Bacteria 6503
343 Ga0501081_0751875 3300049743 Bacteria 733
344 Ga0501083_0000801 3300049744 Bacteria 20607
345 Ga0501035_0001522 3300049822 Bacteria 23684
346 Ga0501035_0244039 3300049822 Bacteria 1527
347 Ga0501035_0813362 3300049822 Bacteria 746
348 Ga0501044_0002854 3300049823 Bacteria 19664
349 Ga0501044_0004036 3300049823 Bacteria 16463
350 Ga0501044_0529938 3300049823 Bacteria 1077
351 Ga0501045_0006942 3300049824 Bacteria 7848
352 nmdc:mga03n38_300522_c1 3300050490 Bacteria 862
353 nmdc:mga04h51_151570_c1 3300050495 Bacteria 886
354 nmdc:mga07m45_16557_c1 3300050496 Bacteria 3946
355 nmdc:mga0n895_25011_c1 3300050512 Bacteria 5636
356 nmdc:mga0rr50_6896_c1 3300050513 Bacteria 6966
357 nmdc:mga08x19_16321_c1 3300050514 Bacteria 4527
358 nmdc:mga0a205_549827_c1 3300050515 Bacteria 1010
359 nmdc:mga0sz30_144568_c1 3300050516 Bacteria 1051
360 nmdc:mga0sz30_31517_c1 3300050516 Bacteria 2194
361 Ga0495601_0566537 3300053077 Bacteria 730
362 Ga0495619_0333448 3300053085 Bacteria 1050
363 Ga0495619_0577754 3300053085 Bacteria 770
364 Ga0500641_0000363 3300053096 Bacteria 16791
365 Ga0500556_0000915 3300053104 Bacteria 16267
366 Ga0500562_006857 3300053108 Bacteria 2874
367 Ga0500593_000062 3300053117 Bacteria 39716
368 Ga0500568_0057023 3300053139 Bacteria 1521
369 Ga0500573_0372508 3300053140 Bacteria 686
370 Ga0500616_0051883 3300053153 Bacteria 2159
371 Ga0500616_0200725 3300053153 Bacteria 883
372 Ga0500627_0092238 3300053158 Bacteria 1356
373 Ga0500633_0086622 3300053160 Bacteria 1140
374 Ga0501084_0000487 3300054114 Bacteria 30390
375 Ga0501084_0014112 3300054114 Bacteria 6617
376 Ga0587080_035639 3300059503 Bacteria 887
377 Ga0587067_146815 3300059640 Bacteria 589
378 Ga0587079_052639 3300059647 Bacteria 859
379 Ga0501082_0665404 3300060353 Bacteria 911
380 Ga0466962_0000779 3300061719 Bacteria 14329
381 Ga0466962_0008065 3300061719 Bacteria 5049
382 Ga0466962_0430570 3300061719 Bacteria 663
383 Ga0466962_0678737 3300061719 Bacteria 528
384 Ga0530510_0466611 3300061734 Bacteria 955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_100126619 Ga0070663_1001266192 115
2 3300013297 Ga0157378_10271900 Ga0157378_102719002 115
3 3300026023 Ga0207677_10268571 Ga0207677_102685711 115
4 3300026121 Ga0207683_10669783 Ga0207683_106697832 118
5 3300061719 Ga0466962_0678737 Ga0466962_0678737_96_476 118
6 3300045976 Ga0466967_0869057 Ga0466967_0869057_79_525 122
7 3300035398 Ga0316574_0175992 Ga0316574_0175992_757_1245 126
8 3300046462 Ga0495651_0062364 Ga0495651_0062364_124_564 128
9 3300013308 Ga0157375_11665787 Ga0157375_116657871 132
10 3300005440 Ga0070705_100088938 Ga0070705_1000889383 133
11 3300005547 Ga0070693_100057117 Ga0070693_1000571173 133
12 3300005549 Ga0070704_100030462 Ga0070704_1000304624 133
13 3300005614 Ga0068856_100501707 Ga0068856_1005017072 133
14 3300006358 Ga0068871_100079492 Ga0068871_1000794923 133
15 3300009174 Ga0105241_10069588 Ga0105241_100695883 133
16 3300009551 Ga0105238_10824744 Ga0105238_108247442 133
17 3300013308 Ga0157375_10364554 Ga0157375_103645544 133
18 3300014969 Ga0157376_10020322 Ga0157376_100203224 133
19 3300025898 Ga0207692_10013590 Ga0207692_100135904 133
20 3300026142 Ga0207698_11728711 Ga0207698_117287111 133
21 3300035114 Ga0373939_0006080 Ga0373939_0006080_2040_2540 133
22 3300047319 Ga0495674_0975881 Ga0495674_0975881_23_523 133
23 3300048915 Ga0496112_0422639 Ga0496112_0422639_553_1053 133
24 3300049573 Ga0501037_0226159 Ga0501037_0226159_397_885 134
25 3300049577 Ga0501041_0082746 Ga0501041_0082746_1105_1593 134
26 3300046660 Ga0495625_0045827 Ga0495625_0045827_12_455 135
27 3300046694 Ga0495649_0085690 Ga0495649_0085690_115_558 135
28 3300048091 Ga0495626_0015031 Ga0495626_0015031_173_616 135
29 3300053108 Ga0500562_006857 Ga0500562_006857_1045_1488 135
30 3300053153 Ga0500616_0200725 Ga0500616_0200725_115_558 135
31 3300053158 Ga0500627_0092238 Ga0500627_0092238_832_1275 135
32 3300053160 Ga0500633_0086622 Ga0500633_0086622_505_948 135
33 3300031838 Ga0307518_10043043 Ga0307518_100430436 136
34 3300046559 Ga0495667_0203803 Ga0495667_0203803_611_1102 136
35 3300005337 Ga0070682_100151709 Ga0070682_1001517091 137
36 3300005344 Ga0070661_100755021 Ga0070661_1007550211 137
37 3300005444 Ga0070694_100311487 Ga0070694_1003114872 137
38 3300005458 Ga0070681_10132466 Ga0070681_101324662 137
39 3300005546 Ga0070696_100122169 Ga0070696_1001221693 137
40 3300005615 Ga0070702_100108241 Ga0070702_1001082412 137
41 3300005841 Ga0068863_100221580 Ga0068863_1002215802 137
42 3300006163 Ga0070715_10005567 Ga0070715_100055672 137
43 3300009101 Ga0105247_10230911 Ga0105247_102309112 137
44 3300009148 Ga0105243_11441344 Ga0105243_114413442 137
45 3300009545 Ga0105237_10235088 Ga0105237_102350883 137
46 3300014968 Ga0157379_10371909 Ga0157379_103719092 137
47 3300025905 Ga0207685_10000572 Ga0207685_100005725 137
48 3300025906 Ga0207699_10159282 Ga0207699_101592822 137
49 3300025912 Ga0207707_10247608 Ga0207707_102476082 137
50 3300025928 Ga0207700_10011797 Ga0207700_100117976 137
51 3300025929 Ga0207664_10006431 Ga0207664_1000643117 137
52 3300026035 Ga0207703_12042854 Ga0207703_120428541 137
53 3300026088 Ga0207641_10101552 Ga0207641_101015522 137
54 3300034816 Ga0373930_0033414 Ga0373930_0033414_198_698 137
55 3300034818 Ga0373950_0003307 Ga0373950_0003307_1630_2130 137
56 3300034819 Ga0373958_0027736 Ga0373958_0027736_356_856 137
57 3300034820 Ga0373959_0002984 Ga0373959_0002984_762_1262 137
58 3300034957 Ga0373938_0108510 Ga0373938_0108510_88_588 137
59 3300035085 Ga0373929_0013568 Ga0373929_0013568_487_987 137
60 3300035088 Ga0373940_0020690 Ga0373940_0020690_640_1140 137
61 3300035090 Ga0373949_0063720 Ga0373949_0063720_192_692 137
62 3300035091 Ga0373951_0005248 Ga0373951_0005248_2205_2705 137
63 3300035092 Ga0373952_0001703 Ga0373952_0001703_852_1352 137
64 3300035112 Ga0373932_0037154 Ga0373932_0037154_694_1194 137
65 3300035115 Ga0373941_0014005 Ga0373941_0014005_249_749 137
66 3300035121 Ga0373960_0015520 Ga0373960_0015520_137_637 137
67 3300035207 Ga0373942_0050609 Ga0373942_0050609_149_649 137
68 3300035242 Ga0373962_0117968 Ga0373962_0117968_250_750 137
69 3300035691 Ga0373931_0046634 Ga0373931_0046634_1313_1813 137
70 3300045976 Ga0466967_0218928 Ga0466967_0218928_171_638 137
71 3300048903 Ga0496100_0045996 Ga0496100_0045996_98_598 137
72 3300048905 Ga0496102_0325632 Ga0496102_0325632_640_1140 137
73 3300048906 Ga0496103_0133264 Ga0496103_0133264_642_1142 137
74 3300048907 Ga0496104_0077807 Ga0496104_0077807_193_693 137
75 3300048908 Ga0496105_0394437 Ga0496105_0394437_65_565 137
76 3300048909 Ga0496106_0011966 Ga0496106_0011966_247_747 137
77 3300048910 Ga0496107_0042730 Ga0496107_0042730_77_577 137
78 3300048911 Ga0496108_0031392 Ga0496108_0031392_3375_3875 137
79 3300048912 Ga0496109_0480867 Ga0496109_0480867_44_544 137
80 3300048913 Ga0496110_0200426 Ga0496110_0200426_1121_1621 137
81 3300048914 Ga0496111_0095773 Ga0496111_0095773_975_1475 137
82 3300048915 Ga0496112_0518369 Ga0496112_0518369_265_723 137
83 3300048916 Ga0496113_0336516 Ga0496113_0336516_158_658 137
84 3300048917 Ga0496114_0010283 Ga0496114_0010283_649_1149 137
85 3300048918 Ga0496115_0004035 Ga0496115_0004035_4335_4835 137
86 3300003792 Ga0055540_1004152 Ga0055540_10041526 138
87 3300003792 Ga0055540_1004715 Ga0055540_10047155 138
88 3300004801 Ga0058860_12162448 Ga0058860_121624482 138
89 3300005329 Ga0070683_100113665 Ga0070683_1001136652 138
90 3300005329 Ga0070683_100444800 Ga0070683_1004448002 138
91 3300005337 Ga0070682_100167049 Ga0070682_1001670491 138
92 3300005340 Ga0070689_100213947 Ga0070689_1002139471 138
93 3300005354 Ga0070675_100854487 Ga0070675_1008544871 138
94 3300005364 Ga0070673_101588614 Ga0070673_1015886141 138
95 3300005366 Ga0070659_100723906 Ga0070659_1007239062 138
96 3300005455 Ga0070663_100251917 Ga0070663_1002519172 138
97 3300005455 Ga0070663_100633567 Ga0070663_1006335672 138
98 3300005457 Ga0070662_100083476 Ga0070662_1000834763 138
99 3300005535 Ga0070684_100289088 Ga0070684_1002890883 138
100 3300005539 Ga0068853_100442403 Ga0068853_1004424031 138
101 3300005564 Ga0070664_100126070 Ga0070664_1001260703 138
102 3300005614 Ga0068856_100405080 Ga0068856_1004050803 138
103 3300005616 Ga0068852_100769343 Ga0068852_1007693432 138
104 3300005618 Ga0068864_100728039 Ga0068864_1007280391 138
105 3300005719 Ga0068861_101342256 Ga0068861_1013422562 138
106 3300005937 Ga0081455_10056772 Ga0081455_100567724 138
107 3300006038 Ga0075365_10211881 Ga0075365_102118813 138
108 3300006048 Ga0075363_100312411 Ga0075363_1003124112 138
109 3300006177 Ga0075362_10187293 Ga0075362_101872931 138
110 3300006178 Ga0075367_10867273 Ga0075367_108672732 138
111 3300006186 Ga0075369_10138742 Ga0075369_101387422 138
112 3300006186 Ga0075369_10464263 Ga0075369_104642632 138
113 3300006237 Ga0097621_100689784 Ga0097621_1006897841 138
114 3300006353 Ga0075370_10237195 Ga0075370_102371951 138
115 3300006358 Ga0068871_102158604 Ga0068871_1021586041 138
116 3300006871 Ga0075434_100041293 Ga0075434_10004129310 138
117 3300006880 Ga0075429_100536119 Ga0075429_1005361192 138
118 3300006914 Ga0075436_100071908 Ga0075436_1000719084 138
119 3300007076 Ga0075435_100058154 Ga0075435_1000581542 138
120 3300009093 Ga0105240_11860537 Ga0105240_118605371 138
121 3300009094 Ga0111539_11161481 Ga0111539_111614812 138
122 3300009101 Ga0105247_10361125 Ga0105247_103611252 138
123 3300009147 Ga0114129_11209215 Ga0114129_112092153 138
124 3300009148 Ga0105243_11233629 Ga0105243_112336292 138
125 3300009176 Ga0105242_10120106 Ga0105242_101201061 138
126 3300009545 Ga0105237_10039615 Ga0105237_100396154 138
127 3300009551 Ga0105238_11199324 Ga0105238_111993242 138
128 3300010375 Ga0105239_10030807 Ga0105239_100308073 138
129 3300010375 Ga0105239_11687202 Ga0105239_116872021 138
130 3300012488 Ga0157343_1005699 Ga0157343_10056992 138
131 3300013102 Ga0157371_10973365 Ga0157371_109733651 138
132 3300013307 Ga0157372_11217066 Ga0157372_112170662 138
133 3300013307 Ga0157372_11299954 Ga0157372_112999542 138
134 3300013307 Ga0157372_12462515 Ga0157372_124625151 138
135 3300013308 Ga0157375_10287606 Ga0157375_102876062 138
136 3300013308 Ga0157375_11372316 Ga0157375_113723163 138
137 3300014325 Ga0163163_10700508 Ga0163163_107005082 138
138 3300014497 Ga0182008_10207458 Ga0182008_102074581 138
139 3300017792 Ga0163161_10271202 Ga0163161_102712023 138
140 3300020069 Ga0197907_10006480 Ga0197907_1000648010 138
141 3300020069 Ga0197907_10182491 Ga0197907_101824913 138
142 3300020069 Ga0197907_10881634 Ga0197907_108816343 138
143 3300020081 Ga0206354_10622447 Ga0206354_106224471 138
144 3300021384 Ga0213876_10087575 Ga0213876_100875751 138
145 3300022467 Ga0224712_10117673 Ga0224712_101176731 138
146 3300025273 Ga0209673_1008304 Ga0209673_10083043 138
147 3300025303 Ga0209051_1001135 Ga0209051_100113527 138
148 3300025303 Ga0209051_1029877 Ga0209051_10298772 138
149 3300025913 Ga0207695_10576545 Ga0207695_105765451 138
150 3300025914 Ga0207671_10133288 Ga0207671_101332882 138
151 3300025914 Ga0207671_10513077 Ga0207671_105130773 138
152 3300025932 Ga0207690_10471783 Ga0207690_104717832 138
153 3300025932 Ga0207690_11588770 Ga0207690_115887701 138
154 3300025933 Ga0207706_10027808 Ga0207706_100278083 138
155 3300025933 Ga0207706_10126491 Ga0207706_101264912 138
156 3300025935 Ga0207709_10915537 Ga0207709_109155371 138
157 3300025937 Ga0207669_10961499 Ga0207669_109614991 138
158 3300025944 Ga0207661_10477720 Ga0207661_104777202 138
159 3300025945 Ga0207679_10014438 Ga0207679_100144383 138
160 3300026067 Ga0207678_10104325 Ga0207678_101043253 138
161 3300026078 Ga0207702_10339409 Ga0207702_103394093 138
162 3300026118 Ga0207675_101569721 Ga0207675_1015697212 138
163 3300028379 Ga0268266_10240661 Ga0268266_102406613 138
164 3300028794 Ga0307515_10023996 Ga0307515_1002399615 138
165 3300030521 Ga0307511_10343502 Ga0307511_103435021 138
166 3300030731 Ga0316177_1027848 Ga0316177_10278482 138
167 3300030732 Ga0316176_1134316 Ga0316176_11343161 138
168 3300030732 Ga0316176_1136806 Ga0316176_11368063 138
169 3300030733 Ga0314311_1073968 Ga0314311_10739683 138
170 3300030733 Ga0314311_1115631 Ga0314311_11156311 138
171 3300030735 Ga0316178_1092554 Ga0316178_10925542 138
172 3300030735 Ga0316178_1129293 Ga0316178_11292932 138
173 3300030742 Ga0316183_1010663 Ga0316183_10106632 138
174 3300030744 Ga0316181_1184592 Ga0316181_11845923 138
175 3300030745 Ga0316182_1321357 Ga0316182_13213572 138
176 3300031251 Ga0265327_10049310 Ga0265327_100493101 138
177 3300031548 Ga0307408_101213405 Ga0307408_1012134052 138
178 3300031731 Ga0307405_10821275 Ga0307405_108212751 138
179 3300031824 Ga0307413_10640775 Ga0307413_106407753 138
180 3300031995 Ga0307409_100712916 Ga0307409_1007129161 138
181 3300031995 Ga0307409_102052729 Ga0307409_1020527291 138
182 3300032002 Ga0307416_100683504 Ga0307416_1006835042 138
183 3300032002 Ga0307416_100940737 Ga0307416_1009407372 138
184 3300032004 Ga0307414_10792953 Ga0307414_107929532 138
185 3300032005 Ga0307411_10243671 Ga0307411_102436712 138
186 3300032005 Ga0307411_10299048 Ga0307411_102990483 138
187 3300032126 Ga0307415_100219583 Ga0307415_1002195832 138
188 3300032126 Ga0307415_101180669 Ga0307415_1011806692 138
189 3300037471 Ga0395905_0033921 Ga0395905_0033921_2692_3162 138
190 3300037471 Ga0395905_0233728 Ga0395905_0233728_1083_1523 138
191 3300038443 Ga0395901_0020078 Ga0395901_0020078_827_1297 138
192 3300039437 Ga0436365_1927535 Ga0436365_1927535_272_712 138
193 3300041411 Ga0439466_0040172 Ga0439466_0040172_425_865 138
194 3300041446 Ga0451794_44842 Ga0451794_44842_166_606 138
195 3300041451 Ga0451791_0837055 Ga0451791_0837055_358_798 138
196 3300041456 Ga0451795_0304532 Ga0451795_0304532_132_593 138
197 3300041459 Ga0451800_0000317 Ga0451800_0000317_143_583 138
198 3300041459 Ga0451800_0423470 Ga0451800_0423470_413_853 138
199 3300041486 Ga0451807_1030011 Ga0451807_1030011_526_966 138
200 3300041491 Ga0451833_1085045 Ga0451833_1085045_377_817 138
201 3300041494 Ga0451837_0451591 Ga0451837_0451591_59_499 138
202 3300041498 Ga0451841_0559219 Ga0451841_0559219_39_479 138
203 3300041509 Ga0451843_0272354 Ga0451843_0272354_323_763 138
204 3300042122 Ga0450920_074000 Ga0450920_074000_158_598 138
205 3300042435 Ga0439434_0051656 Ga0439434_0051656_492_935 138
206 3300044658 Ga0466972_0052569 Ga0466972_0052569_894_1334 138
207 3300044683 Ga0466965_0464070 Ga0466965_0464070_14_454 138
208 3300044684 Ga0466966_0132932 Ga0466966_0132932_552_992 138
209 3300044693 Ga0466961_0010717 Ga0466961_0010717_5323_5793 138
210 3300044693 Ga0466961_0034813 Ga0466961_0034813_1582_2043 138
211 3300044694 Ga0466963_0150645 Ga0466963_0150645_443_883 138
212 3300044706 Ga0466964_0002255 Ga0466964_0002255_5178_5618 138
213 3300044706 Ga0466964_0037975 Ga0466964_0037975_967_1407 138
214 3300044706 Ga0466964_0857590 Ga0466964_0857590_39_500 138
215 3300044719 Ga0466971_0000019 Ga0466971_0000019_3358_3828 138
216 3300044719 Ga0466971_0129111 Ga0466971_0129111_372_833 138
217 3300044719 Ga0466971_0165932 Ga0466971_0165932_482_922 138
218 3300044765 Ga0466970_0031630 Ga0466970_0031630_418_858 138
219 3300044842 Ga0466957_0021350 Ga0466957_0021350_833_1291 138
220 3300044842 Ga0466957_0046083 Ga0466957_0046083_1303_1743 138
221 3300044842 Ga0466957_0333245 Ga0466957_0333245_308_769 138
222 3300044901 Ga0466960_0167594 Ga0466960_0167594_657_1148 138
223 3300045049 Ga0466959_0003104 Ga0466959_0003104_5909_6379 138
224 3300045049 Ga0466959_0020345 Ga0466959_0020345_4009_4470 138
225 3300045049 Ga0466959_0046466 Ga0466959_0046466_1290_1751 138
226 3300045976 Ga0466967_0151067 Ga0466967_0151067_499_939 138
227 3300045976 Ga0466967_0267692 Ga0466967_0267692_815_1255 138
228 3300045976 Ga0466967_0985070 Ga0466967_0985070_145_588 138
229 3300045976 Ga0466967_2610170 Ga0466967_2610170_26_466 138
230 3300046459 Ga0495629_0419904 Ga0495629_0419904_393_881 138
231 3300046459 Ga0495629_0901842 Ga0495629_0901842_126_566 138
232 3300046461 Ga0495641_0043589 Ga0495641_0043589_463_903 138
233 3300046463 Ga0495653_0405944 Ga0495653_0405944_33_476 138
234 3300046473 Ga0495582_0408869 Ga0495582_0408869_26_466 138
235 3300046476 Ga0495662_0021946 Ga0495662_0021946_2174_2626 138
236 3300046514 Ga0495618_0478248 Ga0495618_0478248_297_737 138
237 3300046517 Ga0495630_0323543 Ga0495630_0323543_374_826 138
238 3300046663 Ga0495635_0341284 Ga0495635_0341284_515_955 138
239 3300046675 Ga0495657_0210772 Ga0495657_0210772_545_985 138
240 3300046679 Ga0495623_0531881 Ga0495623_0531881_123_575 138
241 3300047319 Ga0495674_0312055 Ga0495674_0312055_187_627 138
242 3300048904 Ga0496101_0280952 Ga0496101_0280952_103_543 138
243 3300048904 Ga0496101_0973439 Ga0496101_0973439_199_639 138
244 3300048905 Ga0496102_0030612 Ga0496102_0030612_1245_1685 138
245 3300048905 Ga0496102_0228130 Ga0496102_0228130_29_469 138
246 3300048907 Ga0496104_0442719 Ga0496104_0442719_136_576 138
247 3300048907 Ga0496104_1177615 Ga0496104_1177615_113_553 138
248 3300048909 Ga0496106_0206503 Ga0496106_0206503_582_1022 138
249 3300048910 Ga0496107_0018694 Ga0496107_0018694_943_1383 138
250 3300048911 Ga0496108_1044306 Ga0496108_1044306_59_499 138
251 3300048912 Ga0496109_0497966 Ga0496109_0497966_219_659 138
252 3300048913 Ga0496110_0213365 Ga0496110_0213365_29_469 138
253 3300048914 Ga0496111_0497992 Ga0496111_0497992_125_565 138
254 3300048915 Ga0496112_0620815 Ga0496112_0620815_539_979 138
255 3300048916 Ga0496113_0398193 Ga0496113_0398193_643_1095 138
256 3300048916 Ga0496113_0691914 Ga0496113_0691914_349_789 138
257 3300048916 Ga0496113_1150399 Ga0496113_1150399_87_527 138
258 3300048917 Ga0496114_0025058 Ga0496114_0025058_4375_4863 138
259 3300048917 Ga0496114_0054005 Ga0496114_0054005_1026_1466 138
260 3300048917 Ga0496114_0063800 Ga0496114_0063800_1343_1783 138
261 3300048917 Ga0496114_0112417 Ga0496114_0112417_1300_1740 138
262 3300048918 Ga0496115_0144167 Ga0496115_0144167_381_821 138
263 3300049127 Ga0501306_001885 Ga0501306_001885_873_1349 138
264 3300049129 Ga0501309_013479 Ga0501309_013479_460_900 138
265 3300049129 Ga0501309_070412 Ga0501309_070412_87_548 138
266 3300049130 Ga0501310_067098 Ga0501310_067098_56_496 138
267 3300049162 Ga0501307_032008 Ga0501307_032008_97_537 138
268 3300049528 Ga0501312_019754 Ga0501312_019754_54_497 138
269 3300049528 Ga0501312_045434 Ga0501312_045434_104_544 138
270 3300049529 Ga0501313_005633 Ga0501313_005633_360_800 138
271 3300049534 Ga0501318_007107 Ga0501318_007107_580_1056 138
272 3300049537 Ga0501321_001521 Ga0501321_001521_774_1214 138
273 3300049539 Ga0501323_063174 Ga0501323_063174_114_554 138
274 3300049568 Ga0501031_0044403 Ga0501031_0044403_432_872 138
275 3300049569 Ga0501032_0000438 Ga0501032_0000438_20133_20609 138
276 3300049569 Ga0501032_0159986 Ga0501032_0159986_165_605 138
277 3300049569 Ga0501032_0474396 Ga0501032_0474396_82_522 138
278 3300049570 Ga0501033_0001612 Ga0501033_0001612_2441_2917 138
279 3300049570 Ga0501033_0012866 Ga0501033_0012866_1286_1726 138
280 3300049570 Ga0501033_0232279 Ga0501033_0232279_436_876 138
281 3300049570 Ga0501033_1083200 Ga0501033_1083200_10_450 138
282 3300049571 Ga0501034_0001245 Ga0501034_0001245_17360_17836 138
283 3300049571 Ga0501034_0555488 Ga0501034_0555488_352_792 138
284 3300049571 Ga0501034_1661504 Ga0501034_1661504_56_496 138
285 3300049572 Ga0501036_0000668 Ga0501036_0000668_5517_5993 138
286 3300049572 Ga0501036_0003874 Ga0501036_0003874_6871_7311 138
287 3300049572 Ga0501036_0123965 Ga0501036_0123965_1130_1570 138
288 3300049572 Ga0501036_0249858 Ga0501036_0249858_399_839 138
289 3300049572 Ga0501036_0366861 Ga0501036_0366861_588_1028 138
290 3300049573 Ga0501037_0000998 Ga0501037_0000998_17968_18444 138
291 3300049573 Ga0501037_0060775 Ga0501037_0060775_1560_2000 138
292 3300049574 Ga0501038_0000265 Ga0501038_0000265_31035_31511 138
293 3300049574 Ga0501038_0009388 Ga0501038_0009388_4001_4441 138
294 3300049574 Ga0501038_1138623 Ga0501038_1138623_56_496 138
295 3300049575 Ga0501039_0000814 Ga0501039_0000814_2279_2755 138
296 3300049575 Ga0501039_0057982 Ga0501039_0057982_1042_1482 138
297 3300049575 Ga0501039_0292962 Ga0501039_0292962_515_997 138
298 3300049575 Ga0501039_0307348 Ga0501039_0307348_599_1039 138
299 3300049576 Ga0501040_0022758 Ga0501040_0022758_559_999 138
300 3300049576 Ga0501040_0064803 Ga0501040_0064803_1811_2287 138
301 3300049577 Ga0501041_0032251 Ga0501041_0032251_1512_1952 138
302 3300049577 Ga0501041_0260710 Ga0501041_0260710_496_936 138
303 3300049578 Ga0501042_0011118 Ga0501042_0011118_4118_4558 138
304 3300049578 Ga0501042_0064088 Ga0501042_0064088_129_605 138
305 3300049578 Ga0501042_0901233 Ga0501042_0901233_106_591 138
306 3300049579 Ga0501043_0001438 Ga0501043_0001438_2365_2841 138
307 3300049579 Ga0501043_0151092 Ga0501043_0151092_499_939 138
308 3300049579 Ga0501043_0693561 Ga0501043_0693561_30_470 138
309 3300049580 Ga0501046_0001551 Ga0501046_0001551_19125_19601 138
310 3300049580 Ga0501046_0185627 Ga0501046_0185627_634_1074 138
311 3300049580 Ga0501046_0325906 Ga0501046_0325906_31_471 138
312 3300049580 Ga0501046_1179617 Ga0501046_1179617_51_491 138
313 3300049581 Ga0501047_0000855 Ga0501047_0000855_17968_18444 138
314 3300049581 Ga0501047_0016967 Ga0501047_0016967_4067_4507 138
315 3300049581 Ga0501047_0048540 Ga0501047_0048540_738_1178 138
316 3300049582 Ga0501048_0000857 Ga0501048_0000857_19326_19802 138
317 3300049582 Ga0501048_0008384 Ga0501048_0008384_6755_7195 138
318 3300049584 Ga0501068_0076279 Ga0501068_0076279_1494_1934 138
319 3300049585 Ga0501069_0000506 Ga0501069_0000506_3839_4315 138
320 3300049585 Ga0501069_0057454 Ga0501069_0057454_700_1140 138
321 3300049585 Ga0501069_0349314 Ga0501069_0349314_397_837 138
322 3300049586 Ga0501070_0001773 Ga0501070_0001773_2340_2816 138
323 3300049586 Ga0501070_0004983 Ga0501070_0004983_9137_9577 138
324 3300049586 Ga0501070_0007652 Ga0501070_0007652_2628_3068 138
325 3300049586 Ga0501070_0114838 Ga0501070_0114838_615_1055 138
326 3300049586 Ga0501070_0188691 Ga0501070_0188691_996_1436 138
327 3300049586 Ga0501070_0425600 Ga0501070_0425600_408_848 138
328 3300049587 Ga0501071_0106954 Ga0501071_0106954_37_477 138
329 3300049587 Ga0501071_0115749 Ga0501071_0115749_1070_1510 138
330 3300049587 Ga0501071_0126629 Ga0501071_0126629_820_1302 138
331 3300049588 Ga0501072_0264583 Ga0501072_0264583_727_1167 138
332 3300049589 Ga0501073_0309151 Ga0501073_0309151_131_571 138
333 3300049590 Ga0501074_0000257 Ga0501074_0000257_15921_16397 138
334 3300049590 Ga0501074_0003766 Ga0501074_0003766_6387_6827 138
335 3300049590 Ga0501074_0014330 Ga0501074_0014330_1557_1997 138
336 3300049590 Ga0501074_0225337 Ga0501074_0225337_506_946 138
337 3300049591 Ga0501075_0086070 Ga0501075_0086070_1305_1745 138
338 3300049591 Ga0501075_0500559 Ga0501075_0500559_62_502 138
339 3300049592 Ga0501076_0084392 Ga0501076_0084392_1056_1496 138
340 3300049592 Ga0501076_0251907 Ga0501076_0251907_218_694 138
341 3300049592 Ga0501076_0853585 Ga0501076_0853585_10_450 138
342 3300049741 Ga0501079_0030413 Ga0501079_0030413_1005_1445 138
343 3300049742 Ga0501080_0183395 Ga0501080_0183395_71_511 138
344 3300049742 Ga0501080_0202230 Ga0501080_0202230_1292_1732 138
345 3300049742 Ga0501080_0459148 Ga0501080_0459148_674_1114 138
346 3300049742 Ga0501080_1718626 Ga0501080_1718626_51_491 138
347 3300049743 Ga0501081_0008966 Ga0501081_0008966_50_490 138
348 3300049743 Ga0501081_0751875 Ga0501081_0751875_168_608 138
349 3300049744 Ga0501083_0000801 Ga0501083_0000801_16945_17421 138
350 3300049822 Ga0501035_0001522 Ga0501035_0001522_16914_17390 138
351 3300049822 Ga0501035_0244039 Ga0501035_0244039_497_937 138
352 3300049822 Ga0501035_0813362 Ga0501035_0813362_287_727 138
353 3300049823 Ga0501044_0002854 Ga0501044_0002854_2275_2751 138
354 3300049823 Ga0501044_0004036 Ga0501044_0004036_10696_11136 138
355 3300049823 Ga0501044_0529938 Ga0501044_0529938_423_863 138
356 3300049824 Ga0501045_0006942 Ga0501045_0006942_978_1418 138
357 3300050490 nmdc:mga03n38_300522_c1 nmdc:mga03n38_300522_c1_300_740 138
358 3300050495 nmdc:mga04h51_151570_c1 nmdc:mga04h51_151570_c1_256_696 138
359 3300050496 nmdc:mga07m45_16557_c1 nmdc:mga07m45_16557_c1_1252_1698 138
360 3300050512 nmdc:mga0n895_25011_c1 nmdc:mga0n895_25011_c1_1346_1846 138
361 3300050513 nmdc:mga0rr50_6896_c1 nmdc:mga0rr50_6896_c1_1051_1551 138
362 3300050514 nmdc:mga08x19_16321_c1 nmdc:mga08x19_16321_c1_157_657 138
363 3300050515 nmdc:mga0a205_549827_c1 nmdc:mga0a205_549827_c1_434_934 138
364 3300050516 nmdc:mga0sz30_144568_c1 nmdc:mga0sz30_144568_c1_413_853 138
365 3300050516 nmdc:mga0sz30_31517_c1 nmdc:mga0sz30_31517_c1_39_482 138
366 3300053077 Ga0495601_0566537 Ga0495601_0566537_74_514 138
367 3300053085 Ga0495619_0333448 Ga0495619_0333448_77_517 138
368 3300053085 Ga0495619_0577754 Ga0495619_0577754_211_651 138
369 3300053096 Ga0500641_0000363 Ga0500641_0000363_1617_2060 138
370 3300053104 Ga0500556_0000915 Ga0500556_0000915_4960_5400 138
371 3300053117 Ga0500593_000062 Ga0500593_000062_22384_22824 138
372 3300053139 Ga0500568_0057023 Ga0500568_0057023_767_1207 138
373 3300053140 Ga0500573_0372508 Ga0500573_0372508_104_568 138
374 3300053153 Ga0500616_0051883 Ga0500616_0051883_845_1309 138
375 3300054114 Ga0501084_0000487 Ga0501084_0000487_18068_18544 138
376 3300054114 Ga0501084_0014112 Ga0501084_0014112_5778_6218 138
377 3300059503 Ga0587080_035639 Ga0587080_035639_116_619 138
378 3300059640 Ga0587067_146815 Ga0587067_146815_13_516 138
379 3300059647 Ga0587079_052639 Ga0587079_052639_255_758 138
380 3300060353 Ga0501082_0665404 Ga0501082_0665404_245_685 138
381 3300061719 Ga0466962_0000779 Ga0466962_0000779_11240_11710 138
382 3300061719 Ga0466962_0008065 Ga0466962_0008065_949_1410 138
383 3300061719 Ga0466962_0430570 Ga0466962_0430570_53_493 138
384 3300061734 Ga0530510_0466611 Ga0530510_0466611_437_877 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

40

159

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.9221 67 138
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.9031 115 137
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.869 66 136
6n8j-assembly1.cif.gz_Q cryo-em structure of late nuclear (ln) pre-60s ribosomal subunit 0.7902 67 138
8hl5-assembly1.cif.gz_L18E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.7819 60 138
ID Description Score Start End Superfamily
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9613 66 137 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9486 66 137 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9247 66 138 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9247 58 138 3.100.10.10
af_P54022_5_121_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9167 66 138 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A6B3F858-F1-model_v4 50S ribosomal protein L15 0.9926 60 138 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.9881 59 138 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.976 59 138 GO:0003735
GO:0006412
GO:0022625
AF-A0A6B3F858-F1-model_v4 50S ribosomal protein L15 0.9683 60 138 GO:0003735
GO:0006412
GO:0022625
AF-A0A2U2RQ39-F1-model_v4 50S ribosomal protein L15 0.9676 69 138 GO:0005840
GO:1990904

Feature Viewer

pLDDT pTM Quality
79.2 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map