F430030

General Info

Members Datasets Scaffolds Average Seq Length
384 198 768 199

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0456359|Ga0501074_0456359_59_748
Length 229
Sequence VSRPGCVWAAAPPTPASAAATNAPISRFRIVLLYNSPVSGNCYKVRLLLAHLGLSYEPVDVSVVDRSNRLELLGDLNPALRVPTVVLDDGRPLGESNAILWYFGDGTPYVPTDAYERAQVLQWMFFEQYSHEPMIAVARFLLRYSGEPDRFERQRERLLAGGYAALDAMERHLDGRAFFVGERYSIADIALYAYTHVAHEGDFDLAAHPAIRAWLGRVAAEPGHVTIDA

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 3.39
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0456359 3300049590 Bacteria 906
2 JGI25407J50210_10002885 3300003373 Bacteria 4092
3 JGI25407J50210_10037120 3300003373 Bacteria 1253
4 JGI25407J50210_10039985 3300003373 Bacteria 1202
5 Ga0065707_10156974 3300005295 Bacteria 1599
6 Ga0070658_10142447 3300005327 Bacteria 2003
7 Ga0070683_100055430 3300005329 Bacteria 3679
8 Ga0070683_100119161 3300005329 Bacteria 2493
9 Ga0070670_100174016 3300005331 Bacteria 1868
10 Ga0068868_100001603 3300005338 Bacteria 15430
11 Ga0068868_100045957 3300005338 Bacteria 3417
12 Ga0070687_100166925 3300005343 Bacteria 1306
13 Ga0070661_100138942 3300005344 Bacteria 1830
14 Ga0070661_100391976 3300005344 Bacteria 1097
15 Ga0070668_100084608 3300005347 Bacteria 2492
16 Ga0070688_100000506 3300005365 Bacteria 19723
17 Ga0070714_100069994 3300005435 Bacteria 3032
18 Ga0070713_100682398 3300005436 Bacteria 980
19 Ga0070713_100765963 3300005436 Bacteria 924
20 Ga0070708_100173959 3300005445 Bacteria 2011
21 Ga0070663_100016833 3300005455 Bacteria 4757
22 Ga0070678_100759728 3300005456 Bacteria 877
23 Ga0070685_10002367 3300005466 Bacteria 9704
24 Ga0070685_10032379 3300005466 Bacteria 2928
25 Ga0070685_10254258 3300005466 Bacteria 1165
26 Ga0070706_100020344 3300005467 Bacteria 6115
27 Ga0070707_100717160 3300005468 Bacteria 963
28 Ga0070698_100016241 3300005471 Bacteria 7858
29 Ga0070699_100007608 3300005518 Bacteria 9417
30 Ga0070699_100092841 3300005518 Bacteria 2640
31 Ga0070684_100010429 3300005535 Bacteria 7362
32 Ga0068855_100023014 3300005563 Bacteria 7467
33 Ga0070664_100038959 3300005564 Bacteria 4003
34 Ga0070664_100331796 3300005564 Bacteria 1380
35 Ga0068857_100016885 3300005577 Bacteria 6396
36 Ga0068856_100020372 3300005614 Bacteria 6441
37 Ga0070702_100003588 3300005615 Bacteria 6971
38 Ga0068852_100014346 3300005616 Bacteria 6096
39 Ga0068852_100174064 3300005616 Bacteria 2020
40 Ga0068864_100023924 3300005618 Bacteria 5134
41 Ga0068866_10201182 3300005718 Bacteria 1190
42 Ga0068870_10063379 3300005840 Bacteria 1994
43 Ga0068863_100354262 3300005841 Bacteria 1430
44 Ga0068862_101237750 3300005844 Bacteria 746
45 Ga0081455_10043677 3300005937 Bacteria 3917
46 Ga0081455_10044269 3300005937 Bacteria 3885
47 Ga0081455_10096024 3300005937 Bacteria 2391
48 Ga0081455_10188459 3300005937 Bacteria 1556
49 Ga0081538_10000134 3300005981 Bacteria 76605
50 Ga0081538_10000150 3300005981 Bacteria 72682
51 Ga0081538_10001151 3300005981 Bacteria 27980
52 Ga0081538_10002658 3300005981 Bacteria 17238
53 Ga0081538_10002802 3300005981 Bacteria 16695
54 Ga0070717_10026686 3300006028 Bacteria 4611
55 Ga0070717_10429547 3300006028 Bacteria 1189
56 Ga0070717_10869068 3300006028 Bacteria 821
57 Ga0075365_10128548 3300006038 Bacteria 1752
58 Ga0075428_100028739 3300006844 Bacteria 6152
59 Ga0075428_100031025 3300006844 Bacteria 5910
60 Ga0075428_100116559 3300006844 Bacteria 2909
61 Ga0075428_100376582 3300006844 Bacteria 1522
62 Ga0075428_101007436 3300006844 Bacteria 882
63 Ga0075430_100007562 3300006846 Bacteria 9176
64 Ga0075430_100082185 3300006846 Bacteria 2699
65 Ga0075430_100182458 3300006846 Bacteria 1745
66 Ga0075431_100003203 3300006847 Bacteria 15834
67 Ga0075433_10243491 3300006852 Bacteria 1596
68 Ga0075434_100094778 3300006871 Bacteria 2990
69 Ga0075434_100317138 3300006871 Bacteria 1579
70 Ga0075434_100825883 3300006871 Bacteria 943
71 Ga0075434_100837038 3300006871 Bacteria 936
72 Ga0075429_100052141 3300006880 Bacteria 3559
73 Ga0075429_100209826 3300006880 Bacteria 1706
74 Ga0075429_100315662 3300006880 Bacteria 1368
75 Ga0068865_100007726 3300006881 Bacteria 6629
76 Ga0075436_100085638 3300006914 Bacteria 2188
77 Ga0075435_100224209 3300007076 Bacteria 1596
78 Ga0105250_10000022 3300009092 Bacteria 231610
79 Ga0105240_11446828 3300009093 Bacteria 721
80 Ga0111539_10021366 3300009094 Bacteria 7968
81 Ga0111539_10105516 3300009094 Bacteria 3305
82 Ga0111539_10341061 3300009094 Bacteria 1744
83 Ga0111539_10522846 3300009094 Bacteria 1382
84 Ga0111539_10544481 3300009094 Bacteria 1352
85 Ga0111539_11288892 3300009094 Bacteria 848
86 Ga0105245_10318962 3300009098 Bacteria 1530
87 Ga0114129_10067369 3300009147 Bacteria 4993
88 Ga0114129_10151105 3300009147 Bacteria 3178
89 Ga0114129_10265523 3300009147 Bacteria 2298
90 Ga0114129_10323885 3300009147 Bacteria 2048
91 Ga0105248_10191667 3300009177 Bacteria 2303
92 Ga0105249_10041065 3300009553 Bacteria 4204
93 Ga0105239_10033243 3300010375 Bacteria 5664
94 Ga0105246_10049642 3300011119 Bacteria 2874
95 Ga0157370_10027409 3300013104 Bacteria 5617
96 Ga0157370_10043649 3300013104 Bacteria 4313
97 Ga0157370_10098746 3300013104 Bacteria 2737
98 Ga0157369_10015605 3300013105 Bacteria 8560
99 Ga0157369_10043302 3300013105 Bacteria 4907
100 Ga0157374_10009892 3300013296 Bacteria 8184
101 Ga0157374_10658424 3300013296 Bacteria 1059
102 Ga0157372_10102442 3300013307 Bacteria 3270
103 Ga0163163_10016004 3300014325 Bacteria 6953
104 Ga0163163_10140549 3300014325 Bacteria 2457
105 Ga0157380_10895872 3300014326 Bacteria 913
106 Ga0157377_10001893 3300014745 Bacteria 9171
107 Ga0157376_10541350 3300014969 Bacteria 1151
108 Ga0182007_10042552 3300015262 Bacteria 1511
109 Ga0163161_10000140 3300017792 Bacteria 66684
110 Ga0213874_10000874 3300021377 Bacteria 6159
111 Ga0213876_10063670 3300021384 Bacteria 1947
112 Ga0213876_10207950 3300021384 Bacteria 1040
113 Ga0207656_10058622 3300025321 Bacteria 1683
114 Ga0207696_1000568 3300025711 Bacteria 29106
115 Ga0207688_10001525 3300025901 Bacteria 12162
116 Ga0207643_10023281 3300025908 Bacteria 3415
117 Ga0207705_10468354 3300025909 Bacteria 978
118 Ga0207684_10024864 3300025910 Bacteria 5103
119 Ga0207663_10239679 3300025916 Bacteria 1329
120 Ga0207662_10195863 3300025918 Bacteria 1306
121 Ga0207649_10119290 3300025920 Bacteria 1776
122 Ga0207646_10013663 3300025922 Bacteria 7754
123 Ga0207650_10030676 3300025925 Bacteria 3875
124 Ga0207659_10000082 3300025926 Bacteria 57573
125 Ga0207687_10206975 3300025927 Bacteria 1537
126 Ga0207700_10194449 3300025928 Bacteria 1706
127 Ga0207700_10543236 3300025928 Bacteria 1031
128 Ga0207709_10348607 3300025935 Bacteria 1117
129 Ga0207709_10402331 3300025935 Bacteria 1047
130 Ga0207704_10240169 3300025938 Bacteria 1353
131 Ga0207661_10022395 3300025944 Bacteria 4759
132 Ga0207661_10056532 3300025944 Bacteria 3150
133 Ga0207679_10000801 3300025945 Bacteria 20458
134 Ga0207679_10449502 3300025945 Bacteria 1142
135 Ga0207667_10385278 3300025949 Bacteria 1428
136 Ga0207712_10211664 3300025961 Bacteria 1544
137 Ga0207677_10004205 3300026023 Bacteria 7707
138 Ga0207677_10130172 3300026023 Bacteria 1909
139 Ga0207678_10011982 3300026067 Bacteria 7614
140 Ga0207708_10040497 3300026075 Bacteria 3552
141 Ga0207702_11507459 3300026078 Bacteria 666
142 Ga0207676_10363246 3300026095 Bacteria 1342
143 Ga0207674_10011005 3300026116 Bacteria 10174
144 Ga0207683_10297327 3300026121 Bacteria 1477
145 Ga0207698_10306473 3300026142 Bacteria 1481
146 Ga0207428_10012174 3300027907 Bacteria 7568
147 Ga0207428_10025590 3300027907 Bacteria 4938
148 Ga0207428_10036080 3300027907 Bacteria 4036
149 Ga0373936_0002192 3300035113 Bacteria 7284
150 Ga0373945_0004179 3300035116 Bacteria 4583
151 Ga0373943_0011298 3300035170 Bacteria 4017
152 Ga0373946_0013584 3300035171 Bacteria 3064
153 Ga0373935_0007897 3300035692 Bacteria 6384
154 Ga0373947_0010964 3300035725 Bacteria 5201
155 Ga0395899_0002136 3300037312 Bacteria 16250
156 Ga0395899_0009951 3300037312 Bacteria 7293
157 Ga0395899_0011463 3300037312 Bacteria 6786
158 Ga0395900_0003702 3300037418 Bacteria 16428
159 Ga0395900_0013360 3300037418 Bacteria 8392
160 Ga0395900_0507173 3300037418 Bacteria 1156
161 Ga0395900_0701682 3300037418 Bacteria 945
162 Ga0395898_0032621 3300037466 Bacteria 5199
163 Ga0395898_0043103 3300037466 Bacteria 4447
164 Ga0395898_0055282 3300037466 Bacteria 3871
165 Ga0395898_0347673 3300037466 Unclassified 1414
166 Ga0395905_0011983 3300037471 Bacteria 8361
167 Ga0395905_0257770 3300037471 Bacteria 1628
168 Ga0395905_0444706 3300037471 Bacteria 1194
169 Ga0395905_0839465 3300037471 Unclassified 822
170 Ga0436364_0419860 3300037853 Bacteria 3652
171 Ga0395901_0008506 3300038443 Bacteria 10370
172 Ga0395901_0038015 3300038443 Bacteria 4978
173 Ga0395901_0085986 3300038443 Bacteria 3288
174 Ga0395901_0138655 3300038443 Bacteria 2556
175 Ga0395901_0718919 3300038443 Bacteria 994
176 Ga0436365_1328530 3300039437 Bacteria 2383
177 Ga0436360_1289881 3300039438 Bacteria 764
178 Ga0436363_1377217 3300039450 Bacteria 23253
179 Ga0450918_008055 3300042531 Bacteria 1855
180 Ga0466965_0021816 3300044683 Bacteria 3086
181 Ga0466966_0079573 3300044684 Bacteria 2042
182 Ga0466961_0043087 3300044693 Bacteria 2891
183 Ga0466963_0015455 3300044694 Bacteria 4727
184 Ga0466963_0071460 3300044694 Bacteria 2336
185 Ga0466971_0015991 3300044719 Bacteria 3306
186 Ga0466968_0050863 3300044735 Bacteria 1769
187 Ga0466968_0053613 3300044735 Bacteria 1728
188 Ga0466970_0142200 3300044765 Bacteria 1322
189 Ga0466957_0027369 3300044842 Bacteria 3388
190 Ga0466957_0106574 3300044842 Bacteria 1773
191 Ga0466959_0050325 3300045049 Bacteria 3059
192 Ga0466959_0206958 3300045049 Bacteria 1364
193 Ga0466958_0022860 3300045836 Bacteria 3666
194 Ga0466958_0024121 3300045836 Bacteria 3577
195 Ga0466958_0240674 3300045836 Bacteria 1156
196 Ga0466967_0003922 3300045976 Bacteria 9880
197 Ga0466967_0021004 3300045976 Bacteria 5290
198 Ga0466967_0035563 3300045976 Bacteria 4242
199 Ga0466967_0076828 3300045976 Bacteria 3004
200 Ga0466967_0268997 3300045976 Bacteria 1633
201 Ga0495603_0085898 3300046455 Bacteria 1842
202 Ga0495629_0003232 3300046459 Bacteria 12344
203 Ga0495641_0051075 3300046461 Bacteria 1889
204 Ga0495582_0044657 3300046473 Bacteria 2441
205 Ga0495582_0142640 3300046473 Bacteria 1358
206 Ga0495662_0032074 3300046476 Bacteria 2538
207 Ga0495594_0039276 3300046499 Bacteria 2588
208 Ga0495586_0143388 3300046535 Bacteria 1341
209 Ga0495634_0153717 3300046642 Bacteria 1453
210 Ga0495635_0031635 3300046663 Bacteria 3672
211 Ga0495588_0155957 3300046674 Bacteria 1207
212 Ga0495647_0049348 3300046681 Bacteria 1630
213 Ga0495658_0012327 3300046683 Bacteria 4325
214 Ga0495658_0023279 3300046683 Bacteria 3287
215 Ga0495613_0007668 3300046689 Bacteria 8033
216 Ga0495600_0111702 3300046809 Bacteria 1779
217 Ga0495581_0001036 3300047315 Bacteria 15039
218 Ga0495676_0058981 3300047321 Bacteria 3017
219 Ga0495680_0004183 3300047322 Bacteria 13864
220 Ga0495686_0017655 3300047472 Bacteria 4802
221 Ga0495614_0024728 3300048089 Bacteria 2592
222 Ga0496100_0272920 3300048903 Bacteria 1258
223 Ga0496100_0306603 3300048903 Bacteria 1189
224 Ga0496102_0069486 3300048905 Bacteria 3233
225 Ga0496102_0226961 3300048905 Bacteria 1761
226 Ga0496102_0314199 3300048905 Bacteria 1476
227 Ga0496102_0724552 3300048905 Bacteria 917
228 Ga0496102_0762718 3300048905 Bacteria 890
229 Ga0496104_0131104 3300048907 Bacteria 2408
230 Ga0496105_0083889 3300048908 Bacteria 2631
231 Ga0496110_0312797 3300048913 Bacteria 1430
232 Ga0496111_0040504 3300048914 Bacteria 3342
233 Ga0496113_0033986 3300048916 Bacteria 3717
234 Ga0496114_0178310 3300048917 Bacteria 1854
235 Ga0501031_0009266 3300049568 Bacteria 6395
236 Ga0501031_0025633 3300049568 Bacteria 3846
237 Ga0501032_0013085 3300049569 Bacteria 5909
238 Ga0501033_0022824 3300049570 Bacteria 4717
239 Ga0501034_0180484 3300049571 Bacteria 2076
240 Ga0501036_0005710 3300049572 Bacteria 10095
241 Ga0501036_0008942 3300049572 Bacteria 8233
242 Ga0501036_0103557 3300049572 Bacteria 2407
243 Ga0501036_0215224 3300049572 Bacteria 1614
244 Ga0501036_0748929 3300049572 Bacteria 806
245 Ga0501037_0066356 3300049573 Bacteria 2629
246 Ga0501038_0034751 3300049574 Bacteria 4430
247 Ga0501038_0176989 3300049574 Bacteria 1723
248 Ga0501039_0001822 3300049575 Bacteria 15763
249 Ga0501039_0008346 3300049575 Bacteria 7894
250 Ga0501039_0017960 3300049575 Bacteria 5425
251 Ga0501039_0075933 3300049575 Bacteria 2612
252 Ga0501039_0395325 3300049575 Bacteria 1086
253 Ga0501040_0004043 3300049576 Bacteria 9534
254 Ga0501040_0009379 3300049576 Bacteria 6376
255 Ga0501040_0010091 3300049576 Bacteria 6171
256 Ga0501041_0026995 3300049577 Bacteria 3458
257 Ga0501041_0056792 3300049577 Bacteria 2393
258 Ga0501041_0070699 3300049577 Bacteria 2142
259 Ga0501041_0087079 3300049577 Bacteria 1927
260 Ga0501041_0174456 3300049577 Bacteria 1345
261 Ga0501042_0015715 3300049578 Bacteria 5186
262 Ga0501042_0017668 3300049578 Bacteria 4924
263 Ga0501042_0022548 3300049578 Bacteria 4398
264 Ga0501042_0320402 3300049578 Bacteria 1120
265 Ga0501042_0411835 3300049578 Bacteria 979
266 Ga0501043_0027502 3300049579 Bacteria 4464
267 Ga0501046_0010123 3300049580 Bacteria 8115
268 Ga0501047_0147659 3300049581 Bacteria 2228
269 Ga0501048_0001415 3300049582 Bacteria 18144
270 Ga0501048_0036412 3300049582 Bacteria 3537
271 Ga0501048_0071920 3300049582 Bacteria 2441
272 Ga0501048_0539794 3300049582 Bacteria 837
273 Ga0501067_0001144 3300049583 Bacteria 14395
274 Ga0501067_0012389 3300049583 Bacteria 4730
275 Ga0501067_0030431 3300049583 Bacteria 2994
276 Ga0501068_0002286 3300049584 Bacteria 10203
277 Ga0501068_0012129 3300049584 Bacteria 4876
278 Ga0501068_0265260 3300049584 Bacteria 1096
279 Ga0501068_0513789 3300049584 Bacteria 777
280 Ga0501069_0004020 3300049585 Bacteria 7587
281 Ga0501069_0022899 3300049585 Bacteria 3402
282 Ga0501069_0040222 3300049585 Bacteria 2584
283 Ga0501069_0082716 3300049585 Bacteria 1809
284 Ga0501069_0259035 3300049585 Bacteria 1015
285 Ga0501070_0000733 3300049586 Bacteria 30009
286 Ga0501070_0088041 3300049586 Bacteria 2570
287 Ga0501070_0188281 3300049586 Bacteria 1697
288 Ga0501070_0722162 3300049586 Bacteria 787
289 Ga0501071_0040605 3300049587 Bacteria 3329
290 Ga0501071_0113232 3300049587 Bacteria 2006
291 Ga0501071_0164095 3300049587 Bacteria 1661
292 Ga0501071_0179745 3300049587 Bacteria 1585
293 Ga0501071_0319247 3300049587 Bacteria 1179
294 Ga0501072_0000784 3300049588 Bacteria 23294
295 Ga0501072_0033905 3300049588 Bacteria 4000
296 Ga0501072_0061714 3300049588 Bacteria 2956
297 Ga0501072_0183241 3300049588 Bacteria 1670
298 Ga0501072_0242902 3300049588 Bacteria 1434
299 Ga0501072_0456738 3300049588 Bacteria 1011
300 Ga0501073_0073821 3300049589 Bacteria 2375
301 Ga0501073_0084506 3300049589 Bacteria 2208
302 Ga0501074_0149778 3300049590 Bacteria 1668
303 Ga0501074_0173876 3300049590 Bacteria 1537
304 Ga0501074_0604645 3300049590 Bacteria 775
305 Ga0501074_0705894 3300049590 Bacteria 712
306 Ga0501075_0046324 3300049591 Bacteria 3267
307 Ga0501075_0144289 3300049591 Bacteria 1814
308 Ga0501075_0283545 3300049591 Bacteria 1262
309 Ga0501075_0643555 3300049591 Bacteria 808
310 Ga0501076_0002090 3300049592 Bacteria 13694
311 Ga0501076_0015330 3300049592 Bacteria 5790
312 Ga0501076_0167311 3300049592 Bacteria 1792
313 Ga0501076_0338172 3300049592 Bacteria 1235
314 Ga0501076_0360038 3300049592 Bacteria 1195
315 Ga0501076_0624359 3300049592 Bacteria 889
316 Ga0501076_0646817 3300049592 Bacteria 872
317 Ga0501077_0059946 3300049593 Bacteria 2415
318 Ga0501077_0085998 3300049593 Bacteria 1993
319 Ga0501077_0088667 3300049593 Bacteria 1960
320 Ga0501077_0224893 3300049593 Bacteria 1193
321 Ga0501077_0375238 3300049593 Bacteria 908
322 Ga0501079_0001833 3300049741 Bacteria 15213
323 Ga0501079_0036046 3300049741 Bacteria 3809
324 Ga0501079_0168140 3300049741 Bacteria 1710
325 Ga0501079_0236421 3300049741 Bacteria 1427
326 Ga0501079_0807688 3300049741 Bacteria 738
327 Ga0501080_0016633 3300049742 Bacteria 6795
328 Ga0501080_0022880 3300049742 Bacteria 5794
329 Ga0501080_0063587 3300049742 Bacteria 3434
330 Ga0501080_0257795 3300049742 Bacteria 1589
331 Ga0501081_0082253 3300049743 Bacteria 2255
332 Ga0501081_0128384 3300049743 Bacteria 1810
333 Ga0501081_0395543 3300049743 Bacteria 1023
334 Ga0501083_0002757 3300049744 Bacteria 12138
335 Ga0501083_0056850 3300049744 Bacteria 2621
336 Ga0501035_0009927 3300049822 Bacteria 8841
337 Ga0501035_0081547 3300049822 Bacteria 2855
338 Ga0501035_0752214 3300049822 Bacteria 782
339 Ga0501044_0318824 3300049823 Bacteria 1479
340 Ga0501045_0005297 3300049824 Bacteria 8934
341 Ga0501045_0093234 3300049824 Bacteria 2227
342 Ga0501045_0149706 3300049824 Bacteria 1736
343 Ga0501045_0458303 3300049824 Bacteria 947
344 nmdc:mga0yw44_79525_c1 3300050492 Bacteria 1702
345 nmdc:mga05p37_103471_c1 3300050507 Bacteria 3505
346 nmdc:mga05p37_329528_c1 3300050507 Bacteria 1804
347 nmdc:mga05p37_493026_c1 3300050507 Bacteria 1408
348 nmdc:mga05p37_661095_c1 3300050507 Bacteria 1168
349 nmdc:mga09592_104379_c1 3300050508 Bacteria 2429
350 nmdc:mga09592_309419_c1 3300050508 Bacteria 1369
351 nmdc:mga09592_393856_c1 3300050508 Bacteria 1197
352 nmdc:mga0qj67_222897_c1 3300050509 Bacteria 1531
353 nmdc:mga06r32_59634_c1 3300050510 Bacteria 3671
354 nmdc:mga08y16_202246_c1 3300050511 Bacteria 2058
355 nmdc:mga08y16_46631_c1 3300050511 Bacteria 4537
356 nmdc:mga08y16_78547_c1 3300050511 Bacteria 3441
357 nmdc:mga08y16_887331_c1 3300050511 Bacteria 879
358 nmdc:mga0n895_289015_c1 3300050512 Bacteria 1662
359 nmdc:mga0n895_381989_c1 3300050512 Bacteria 1425
360 nmdc:mga0n895_751476_c1 3300050512 Bacteria 968
361 nmdc:mga0n895_779154_c1 3300050512 Bacteria 948
362 nmdc:mga0rr50_207144_c1 3300050513 Bacteria 1614
363 nmdc:mga0rr50_602081_c1 3300050513 Bacteria 937
364 nmdc:mga08x19_76241_c1 3300050514 Bacteria 2194
365 nmdc:mga0a205_177869_c1 3300050515 Bacteria 2022
366 nmdc:mga0a205_232436_c1 3300050515 Bacteria 1727
367 Ga0495619_0098540 3300053085 Bacteria 1987
368 Ga0500656_020087 3300053732 Bacteria 821
369 Ga0501084_0057631 3300054114 Bacteria 3250
370 Ga0501084_0058245 3300054114 Bacteria 3232
371 Ga0501084_0147693 3300054114 Bacteria 1980
372 Ga0501084_0566786 3300054114 Bacteria 959
373 Ga0501082_0002964 3300060353 Bacteria 14816
374 Ga0501082_0009425 3300060353 Bacteria 8403
375 Ga0501082_0033937 3300060353 Bacteria 4401
376 Ga0501082_0403655 3300060353 Bacteria 1193
377 Ga0501082_0577990 3300060353 Bacteria 983
378 Ga0466962_0014330 3300061719 Bacteria 3820
379 Ga0530510_0001107 3300061734 Bacteria 17889
380 Ga0530510_0003484 3300061734 Bacteria 10819
381 Ga0530510_0009094 3300061734 Bacteria 6962
382 Ga0530510_0011762 3300061734 Bacteria 6141
383 Ga0530510_0109544 3300061734 Bacteria 2022
384 Ga0530510_0512664 3300061734 Bacteria 909
385 Ga0501074_0456359
386 JGI25407J50210_10002885
387 JGI25407J50210_10037120
388 JGI25407J50210_10039985
389 Ga0065707_10156974
390 Ga0070658_10142447
391 Ga0070683_100055430
392 Ga0070683_100119161
393 Ga0070670_100174016
394 Ga0068868_100001603
395 Ga0068868_100045957
396 Ga0070687_100166925
397 Ga0070661_100138942
398 Ga0070661_100391976
399 Ga0070668_100084608
400 Ga0070688_100000506
401 Ga0070714_100069994
402 Ga0070713_100682398
403 Ga0070713_100765963
404 Ga0070708_100173959
405 Ga0070663_100016833
406 Ga0070678_100759728
407 Ga0070685_10002367
408 Ga0070685_10032379
409 Ga0070685_10254258
410 Ga0070706_100020344
411 Ga0070707_100717160
412 Ga0070698_100016241
413 Ga0070699_100007608
414 Ga0070699_100092841
415 Ga0070684_100010429
416 Ga0068855_100023014
417 Ga0070664_100038959
418 Ga0070664_100331796
419 Ga0068857_100016885
420 Ga0068856_100020372
421 Ga0070702_100003588
422 Ga0068852_100014346
423 Ga0068852_100174064
424 Ga0068864_100023924
425 Ga0068866_10201182
426 Ga0068870_10063379
427 Ga0068863_100354262
428 Ga0068862_101237750
429 Ga0081455_10043677
430 Ga0081455_10044269
431 Ga0081455_10096024
432 Ga0081455_10188459
433 Ga0081538_10000134
434 Ga0081538_10000150
435 Ga0081538_10001151
436 Ga0081538_10002658
437 Ga0081538_10002802
438 Ga0070717_10026686
439 Ga0070717_10429547
440 Ga0070717_10869068
441 Ga0075365_10128548
442 Ga0075428_100028739
443 Ga0075428_100031025
444 Ga0075428_100116559
445 Ga0075428_100376582
446 Ga0075428_101007436
447 Ga0075430_100007562
448 Ga0075430_100082185
449 Ga0075430_100182458
450 Ga0075431_100003203
451 Ga0075433_10243491
452 Ga0075434_100094778
453 Ga0075434_100317138
454 Ga0075434_100825883
455 Ga0075434_100837038
456 Ga0075429_100052141
457 Ga0075429_100209826
458 Ga0075429_100315662
459 Ga0068865_100007726
460 Ga0075436_100085638
461 Ga0075435_100224209
462 Ga0105250_10000022
463 Ga0105240_11446828
464 Ga0111539_10021366
465 Ga0111539_10105516
466 Ga0111539_10341061
467 Ga0111539_10522846
468 Ga0111539_10544481
469 Ga0111539_11288892
470 Ga0105245_10318962
471 Ga0114129_10067369
472 Ga0114129_10151105
473 Ga0114129_10265523
474 Ga0114129_10323885
475 Ga0105248_10191667
476 Ga0105249_10041065
477 Ga0105239_10033243
478 Ga0105246_10049642
479 Ga0157370_10027409
480 Ga0157370_10043649
481 Ga0157370_10098746
482 Ga0157369_10015605
483 Ga0157369_10043302
484 Ga0157374_10009892
485 Ga0157374_10658424
486 Ga0157372_10102442
487 Ga0163163_10016004
488 Ga0163163_10140549
489 Ga0157380_10895872
490 Ga0157377_10001893
491 Ga0157376_10541350
492 Ga0182007_10042552
493 Ga0163161_10000140
494 Ga0213874_10000874
495 Ga0213876_10063670
496 Ga0213876_10207950
497 Ga0207656_10058622
498 Ga0207696_1000568
499 Ga0207688_10001525
500 Ga0207643_10023281
501 Ga0207705_10468354
502 Ga0207684_10024864
503 Ga0207663_10239679
504 Ga0207662_10195863
505 Ga0207649_10119290
506 Ga0207646_10013663
507 Ga0207650_10030676
508 Ga0207659_10000082
509 Ga0207687_10206975
510 Ga0207700_10194449
511 Ga0207700_10543236
512 Ga0207709_10348607
513 Ga0207709_10402331
514 Ga0207704_10240169
515 Ga0207661_10022395
516 Ga0207661_10056532
517 Ga0207679_10000801
518 Ga0207679_10449502
519 Ga0207667_10385278
520 Ga0207712_10211664
521 Ga0207677_10004205
522 Ga0207677_10130172
523 Ga0207678_10011982
524 Ga0207708_10040497
525 Ga0207702_11507459
526 Ga0207676_10363246
527 Ga0207674_10011005
528 Ga0207683_10297327
529 Ga0207698_10306473
530 Ga0207428_10012174
531 Ga0207428_10025590
532 Ga0207428_10036080
533 Ga0373936_0002192
534 Ga0373945_0004179
535 Ga0373943_0011298
536 Ga0373946_0013584
537 Ga0373935_0007897
538 Ga0373947_0010964
539 Ga0395899_0002136
540 Ga0395899_0009951
541 Ga0395899_0011463
542 Ga0395900_0003702
543 Ga0395900_0013360
544 Ga0395900_0507173
545 Ga0395900_0701682
546 Ga0395898_0032621
547 Ga0395898_0043103
548 Ga0395898_0055282
549 Ga0395898_0347673
550 Ga0395905_0011983
551 Ga0395905_0257770
552 Ga0395905_0444706
553 Ga0395905_0839465
554 Ga0436364_0419860
555 Ga0395901_0008506
556 Ga0395901_0038015
557 Ga0395901_0085986
558 Ga0395901_0138655
559 Ga0395901_0718919
560 Ga0436365_1328530
561 Ga0436360_1289881
562 Ga0436363_1377217
563 Ga0450918_008055
564 Ga0466965_0021816
565 Ga0466966_0079573
566 Ga0466961_0043087
567 Ga0466963_0015455
568 Ga0466963_0071460
569 Ga0466971_0015991
570 Ga0466968_0050863
571 Ga0466968_0053613
572 Ga0466970_0142200
573 Ga0466957_0027369
574 Ga0466957_0106574
575 Ga0466959_0050325
576 Ga0466959_0206958
577 Ga0466958_0022860
578 Ga0466958_0024121
579 Ga0466958_0240674
580 Ga0466967_0003922
581 Ga0466967_0021004
582 Ga0466967_0035563
583 Ga0466967_0076828
584 Ga0466967_0268997
585 Ga0495603_0085898
586 Ga0495629_0003232
587 Ga0495641_0051075
588 Ga0495582_0044657
589 Ga0495582_0142640
590 Ga0495662_0032074
591 Ga0495594_0039276
592 Ga0495586_0143388
593 Ga0495634_0153717
594 Ga0495635_0031635
595 Ga0495588_0155957
596 Ga0495647_0049348
597 Ga0495658_0012327
598 Ga0495658_0023279
599 Ga0495613_0007668
600 Ga0495600_0111702
601 Ga0495581_0001036
602 Ga0495676_0058981
603 Ga0495680_0004183
604 Ga0495686_0017655
605 Ga0495614_0024728
606 Ga0496100_0272920
607 Ga0496100_0306603
608 Ga0496102_0069486
609 Ga0496102_0226961
610 Ga0496102_0314199
611 Ga0496102_0724552
612 Ga0496102_0762718
613 Ga0496104_0131104
614 Ga0496105_0083889
615 Ga0496110_0312797
616 Ga0496111_0040504
617 Ga0496113_0033986
618 Ga0496114_0178310
619 Ga0501031_0009266
620 Ga0501031_0025633
621 Ga0501032_0013085
622 Ga0501033_0022824
623 Ga0501034_0180484
624 Ga0501036_0005710
625 Ga0501036_0008942
626 Ga0501036_0103557
627 Ga0501036_0215224
628 Ga0501036_0748929
629 Ga0501037_0066356
630 Ga0501038_0034751
631 Ga0501038_0176989
632 Ga0501039_0001822
633 Ga0501039_0008346
634 Ga0501039_0017960
635 Ga0501039_0075933
636 Ga0501039_0395325
637 Ga0501040_0004043
638 Ga0501040_0009379
639 Ga0501040_0010091
640 Ga0501041_0026995
641 Ga0501041_0056792
642 Ga0501041_0070699
643 Ga0501041_0087079
644 Ga0501041_0174456
645 Ga0501042_0015715
646 Ga0501042_0017668
647 Ga0501042_0022548
648 Ga0501042_0320402
649 Ga0501042_0411835
650 Ga0501043_0027502
651 Ga0501046_0010123
652 Ga0501047_0147659
653 Ga0501048_0001415
654 Ga0501048_0036412
655 Ga0501048_0071920
656 Ga0501048_0539794
657 Ga0501067_0001144
658 Ga0501067_0012389
659 Ga0501067_0030431
660 Ga0501068_0002286
661 Ga0501068_0012129
662 Ga0501068_0265260
663 Ga0501068_0513789
664 Ga0501069_0004020
665 Ga0501069_0022899
666 Ga0501069_0040222
667 Ga0501069_0082716
668 Ga0501069_0259035
669 Ga0501070_0000733
670 Ga0501070_0088041
671 Ga0501070_0188281
672 Ga0501070_0722162
673 Ga0501071_0040605
674 Ga0501071_0113232
675 Ga0501071_0164095
676 Ga0501071_0179745
677 Ga0501071_0319247
678 Ga0501072_0000784
679 Ga0501072_0033905
680 Ga0501072_0061714
681 Ga0501072_0183241
682 Ga0501072_0242902
683 Ga0501072_0456738
684 Ga0501073_0073821
685 Ga0501073_0084506
686 Ga0501074_0149778
687 Ga0501074_0173876
688 Ga0501074_0604645
689 Ga0501074_0705894
690 Ga0501075_0046324
691 Ga0501075_0144289
692 Ga0501075_0283545
693 Ga0501075_0643555
694 Ga0501076_0002090
695 Ga0501076_0015330
696 Ga0501076_0167311
697 Ga0501076_0338172
698 Ga0501076_0360038
699 Ga0501076_0624359
700 Ga0501076_0646817
701 Ga0501077_0059946
702 Ga0501077_0085998
703 Ga0501077_0088667
704 Ga0501077_0224893
705 Ga0501077_0375238
706 Ga0501079_0001833
707 Ga0501079_0036046
708 Ga0501079_0168140
709 Ga0501079_0236421
710 Ga0501079_0807688
711 Ga0501080_0016633
712 Ga0501080_0022880
713 Ga0501080_0063587
714 Ga0501080_0257795
715 Ga0501081_0082253
716 Ga0501081_0128384
717 Ga0501081_0395543
718 Ga0501083_0002757
719 Ga0501083_0056850
720 Ga0501035_0009927
721 Ga0501035_0081547
722 Ga0501035_0752214
723 Ga0501044_0318824
724 Ga0501045_0005297
725 Ga0501045_0093234
726 Ga0501045_0149706
727 Ga0501045_0458303
728 nmdc:mga0yw44_79525_c1
729 nmdc:mga05p37_103471_c1
730 nmdc:mga05p37_329528_c1
731 nmdc:mga05p37_493026_c1
732 nmdc:mga05p37_661095_c1
733 nmdc:mga09592_104379_c1
734 nmdc:mga09592_309419_c1
735 nmdc:mga09592_393856_c1
736 nmdc:mga0qj67_222897_c1
737 nmdc:mga06r32_59634_c1
738 nmdc:mga08y16_202246_c1
739 nmdc:mga08y16_46631_c1
740 nmdc:mga08y16_78547_c1
741 nmdc:mga08y16_887331_c1
742 nmdc:mga0n895_289015_c1
743 nmdc:mga0n895_381989_c1
744 nmdc:mga0n895_751476_c1
745 nmdc:mga0n895_779154_c1
746 nmdc:mga0rr50_207144_c1
747 nmdc:mga0rr50_602081_c1
748 nmdc:mga08x19_76241_c1
749 nmdc:mga0a205_177869_c1
750 nmdc:mga0a205_232436_c1
751 Ga0495619_0098540
752 Ga0500656_020087
753 Ga0501084_0057631
754 Ga0501084_0058245
755 Ga0501084_0147693
756 Ga0501084_0566786
757 Ga0501082_0002964
758 Ga0501082_0009425
759 Ga0501082_0033937
760 Ga0501082_0403655
761 Ga0501082_0577990
762 Ga0466962_0014330
763 Ga0530510_0001107
764 Ga0530510_0003484
765 Ga0530510_0009094
766 Ga0530510_0011762
767 Ga0530510_0109544
768 Ga0530510_0512664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

31

105

0.93

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

152

217

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

33

108

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

143

224

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

131

222

0.88

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

38

105

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9713 2 198
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9617 2 198
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.939 2 198
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9365 2 198
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9289 2 198
ID Description Score Start End Superfamily
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9588 81 195 1.20.1050.10
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9507 81 195 1.20.1050.10
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9506 81 195 1.20.1050.10
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9349 81 195 1.20.1050.10
3m8nC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9311 83 195 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7W0TDB3-F1-model_v4 Glutathione S-transferase N-terminal domain-containing protein 0.9988 1 70 GO:0016740
AF-A0A7V9S0C6-F1-model_v4 Glutathione S-transferase family protein 0.9913 2 196 GO:0016740
AF-A0A7W0TRF7-F1-model_v4 Glutathione S-transferase family protein 0.9904 2 198 GO:0016740
AF-A0A538H0F7-F1-model_v4 Glutathione S-transferase family protein 0.9861 2 198 GO:0016740
AF-A0A656Z531-F1-model_v4 Glutathione S-transferase 0.9847 47 195 GO:0016740

Map