F429975

General Info

Members Datasets Scaffolds Average Seq Length
384 180 768 147

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0415519|Ga0453684_0415519_251_775
Length 142
Sequence MAIYRLGERVPDIHETAYVFDSATVIGLVRLEAGANLWPYATVRGDNELIVIGKDSNVQEGCVLHTDPGFPLTIGPRVTVGHQAVLHGCTIGEGSLIGIQALGSPGKVVRMLDEAAIARNHANTDGYARRAREYRQSLTRIA

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
118 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
119 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
120 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 5.99
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0415519 3300044712 Bacteria 1504
2 MRS1b_contig_3079162 2162886011 Bacteria 1166
3 MBSR1b_contig_4008678 2162886012 Bacteria 1614
4 JGI24741J21665_1010384 3300001915 Bacteria 1669
5 JGI24752J21851_1001656 3300001976 Bacteria 2991
6 JGI24740J21852_10001913 3300001979 Bacteria 9554
7 JGI24737J22298_10002430 3300001990 Bacteria 6640
8 JGI24737J22298_10024885 3300001990 Bacteria 1894
9 JGI24749J21850_1015481 3300002076 Bacteria 1070
10 JGI24034J26672_10028577 3300002239 Bacteria 900
11 Ga0065712_10081964 3300005290 Bacteria 2960
12 Ga0065715_10174096 3300005293 Bacteria 1525
13 Ga0070658_10024787 3300005327 Bacteria 4811
14 Ga0070658_10061686 3300005327 Bacteria 3055
15 Ga0070658_10118652 3300005327 Bacteria 2197
16 Ga0070658_10142458 3300005327 Bacteria 2003
17 Ga0070676_10523021 3300005328 Bacteria 845
18 Ga0070683_100014722 3300005329 Bacteria 6850
19 Ga0070683_101282004 3300005329 Bacteria 704
20 Ga0070670_100001791 3300005331 Bacteria 17491
21 Ga0070670_100009666 3300005331 Bacteria 8231
22 Ga0070670_100019767 3300005331 Bacteria 5783
23 Ga0070677_10006799 3300005333 Bacteria 3804
24 Ga0070666_10007313 3300005335 Bacteria 6802
25 Ga0070680_100000483 3300005336 Bacteria 27370
26 Ga0070660_100000490 3300005339 Bacteria 26435
27 Ga0070661_100009559 3300005344 Bacteria 6717
28 Ga0070661_100011231 3300005344 Bacteria 6240
29 Ga0070661_100050948 3300005344 Bacteria 3030
30 Ga0070661_100119715 3300005344 Bacteria 1971
31 Ga0070661_101290188 3300005344 Bacteria 612
32 Ga0070692_10031508 3300005345 Bacteria 2658
33 Ga0070668_100022587 3300005347 Bacteria 4757
34 Ga0070668_100180045 3300005347 Bacteria 1726
35 Ga0070668_100473878 3300005347 Bacteria 1080
36 Ga0070669_100044387 3300005353 Bacteria 3239
37 Ga0070669_100157043 3300005353 Bacteria 1765
38 Ga0070669_101207118 3300005353 Bacteria 653
39 Ga0070675_100008582 3300005354 Bacteria 7933
40 Ga0070675_100016916 3300005354 Bacteria 5792
41 Ga0070671_100000987 3300005355 Bacteria 20885
42 Ga0070671_100009923 3300005355 Bacteria 7649
43 Ga0070674_100084745 3300005356 Bacteria 2273
44 Ga0070674_100428459 3300005356 Bacteria 1087
45 Ga0070673_100035302 3300005364 Bacteria 3790
46 Ga0070673_100213117 3300005364 Bacteria 1669
47 Ga0070673_100287332 3300005364 Bacteria 1444
48 Ga0070673_100384979 3300005364 Bacteria 1251
49 Ga0070659_100039975 3300005366 Bacteria 3664
50 Ga0070659_100089177 3300005366 Bacteria 2470
51 Ga0070659_100111916 3300005366 Bacteria 2204
52 Ga0070667_100019694 3300005367 Bacteria 5597
53 Ga0070667_100027480 3300005367 Bacteria 4734
54 Ga0070709_10281812 3300005434 Bacteria 1208
55 Ga0070714_100075954 3300005435 Bacteria 2916
56 Ga0070714_100385251 3300005435 Bacteria 1322
57 Ga0070713_100011839 3300005436 Bacteria 6373
58 Ga0070663_100001084 3300005455 Bacteria 14909
59 Ga0070678_100041247 3300005456 Bacteria 3271
60 Ga0070678_100209546 3300005456 Bacteria 1614
61 Ga0070662_100058714 3300005457 Bacteria 2801
62 Ga0070662_100171489 3300005457 Bacteria 1704
63 Ga0070662_100317425 3300005457 Bacteria 1270
64 Ga0070662_100675170 3300005457 Bacteria 873
65 Ga0070662_100919292 3300005457 Bacteria 747
66 Ga0070681_10770344 3300005458 Bacteria 879
67 Ga0068867_100029541 3300005459 Bacteria 3950
68 Ga0070679_100012912 3300005530 Bacteria 7998
69 Ga0070679_100044065 3300005530 Bacteria 4444
70 Ga0068853_100060620 3300005539 Bacteria 3270
71 Ga0068853_100167982 3300005539 Bacteria 1984
72 Ga0068853_100382289 3300005539 Bacteria 1315
73 Ga0070672_100011841 3300005543 Bacteria 6094
74 Ga0070672_100248182 3300005543 Bacteria 1499
75 Ga0070672_100376098 3300005543 Bacteria 1214
76 Ga0070695_100222799 3300005545 Bacteria 1360
77 Ga0070693_100430145 3300005547 Bacteria 922
78 Ga0070665_100012566 3300005548 Bacteria 8526
79 Ga0070665_102024495 3300005548 Bacteria 581
80 Ga0068855_100023981 3300005563 Bacteria 7304
81 Ga0068855_100097250 3300005563 Bacteria 3391
82 Ga0068855_100486045 3300005563 Bacteria 1343
83 Ga0070664_100002681 3300005564 Bacteria 14366
84 Ga0070664_100020928 3300005564 Bacteria 5389
85 Ga0070664_100056512 3300005564 Bacteria 3335
86 Ga0068857_100013524 3300005577 Bacteria 7110
87 Ga0068856_100108044 3300005614 Bacteria 2778
88 Ga0068856_100131992 3300005614 Bacteria 2503
89 Ga0068852_100007809 3300005616 Bacteria 7833
90 Ga0068859_100640877 3300005617 Bacteria 1155
91 Ga0068851_10401746 3300005834 Bacteria 806
92 Ga0068870_10089793 3300005840 Bacteria 1716
93 Ga0068863_100029115 3300005841 Bacteria 5273
94 Ga0068858_100096993 3300005842 Bacteria 2748
95 Ga0068860_100068079 3300005843 Bacteria 3383
96 Ga0068862_100137327 3300005844 Bacteria 2168
97 Ga0068862_100295508 3300005844 Bacteria 1489
98 Ga0081539_10013126 3300005985 Bacteria 6277
99 Ga0081539_10019648 3300005985 Bacteria 4612
100 Ga0070717_10012793 3300006028 Bacteria 6407
101 Ga0068871_100039264 3300006358 Bacteria 3786
102 Ga0075431_100012663 3300006847 Bacteria 8519
103 Ga0075431_100672910 3300006847 Bacteria 1014
104 Ga0097620_100640914 3300006931 Bacteria 1155
105 Ga0105240_10159955 3300009093 Bacteria 2676
106 Ga0105248_10006248 3300009177 Bacteria 13062
107 Ga0105248_10094583 3300009177 Bacteria 3365
108 Ga0105248_11173083 3300009177 Bacteria 868
109 Ga0105238_10048574 3300009551 Bacteria 4276
110 Ga0105239_10120618 3300010375 Bacteria 2912
111 Ga0105246_10038964 3300011119 Bacteria 3199
112 Ga0105246_10474549 3300011119 Bacteria 1057
113 Ga0157373_10410788 3300013100 Bacteria 971
114 Ga0157370_10010748 3300013104 Bacteria 9625
115 Ga0157370_10049698 3300013104 Bacteria 4013
116 Ga0157369_10002175 3300013105 Bacteria 23611
117 Ga0157369_10110819 3300013105 Bacteria 2917
118 Ga0157372_11937088 3300013307 Bacteria 677
119 Ga0163163_10103981 3300014325 Bacteria 2865
120 Ga0163163_11129171 3300014325 Bacteria 847
121 Ga0157380_10165497 3300014326 Bacteria 1926
122 Ga0157380_10184200 3300014326 Bacteria 1838
123 Ga0157380_10242281 3300014326 Bacteria 1626
124 Ga0157380_11089992 3300014326 Bacteria 837
125 Ga0157377_10107386 3300014745 Bacteria 1673
126 Ga0157379_10004998 3300014968 Bacteria 11381
127 Ga0163161_10450511 3300017792 Bacteria 1040
128 Ga0207656_10207129 3300025321 Bacteria 949
129 Ga0207682_10000529 3300025893 Bacteria 17521
130 Ga0207688_10189013 3300025901 Bacteria 1231
131 Ga0207647_10003395 3300025904 Bacteria 11931
132 Ga0207647_10213107 3300025904 Bacteria 1115
133 Ga0207699_10757827 3300025906 Bacteria 712
134 Ga0207645_10110276 3300025907 Bacteria 1781
135 Ga0207645_10649455 3300025907 Bacteria 717
136 Ga0207705_10001584 3300025909 Bacteria 18067
137 Ga0207705_10282148 3300025909 Bacteria 1272
138 Ga0207705_10409466 3300025909 Bacteria 1049
139 Ga0207707_10508500 3300025912 Bacteria 1027
140 Ga0207660_10000415 3300025917 Bacteria 28231
141 Ga0207657_10001223 3300025919 Bacteria 27391
142 Ga0207657_10176689 3300025919 Bacteria 1728
143 Ga0207657_10324650 3300025919 Unclassified 1216
144 Ga0207649_10004021 3300025920 Bacteria 8009
145 Ga0207649_10006693 3300025920 Bacteria 6263
146 Ga0207649_10043364 3300025920 Bacteria 2750
147 Ga0207649_10088722 3300025920 Bacteria 2020
148 Ga0207652_10000594 3300025921 Bacteria 36239
149 Ga0207652_10629725 3300025921 Bacteria 960
150 Ga0207681_10036607 3300025923 Bacteria 3239
151 Ga0207681_10138224 3300025923 Bacteria 1811
152 Ga0207681_10163208 3300025923 Bacteria 1682
153 Ga0207681_11155518 3300025923 Bacteria 650
154 Ga0207650_10018851 3300025925 Bacteria 4848
155 Ga0207650_10122891 3300025925 Bacteria 2023
156 Ga0207659_10001607 3300025926 Bacteria 13404
157 Ga0207659_10052889 3300025926 Bacteria 2895
158 Ga0207700_10063371 3300025928 Bacteria 2811
159 Ga0207664_10305338 3300025929 Bacteria 1401
160 Ga0207644_10003573 3300025931 Bacteria 10058
161 Ga0207644_10043394 3300025931 Bacteria 3190
162 Ga0207690_10047855 3300025932 Bacteria 2840
163 Ga0207690_10282426 3300025932 Bacteria 1293
164 Ga0207690_10363796 3300025932 Bacteria 1146
165 Ga0207690_10372474 3300025932 Bacteria 1133
166 Ga0207706_10188495 3300025933 Bacteria 1811
167 Ga0207706_10553043 3300025933 Bacteria 991
168 Ga0207669_10343373 3300025937 Bacteria 1150
169 Ga0207669_10643467 3300025937 Bacteria 866
170 Ga0207691_10109459 3300025940 Bacteria 2458
171 Ga0207711_10039470 3300025941 Bacteria 4016
172 Ga0207661_10016243 3300025944 Bacteria 5491
173 Ga0207679_10049416 3300025945 Bacteria 3068
174 Ga0207667_10044068 3300025949 Bacteria 4730
175 Ga0207667_10136827 3300025949 Bacteria 2522
176 Ga0207667_10149039 3300025949 Bacteria 2408
177 Ga0207667_10200001 3300025949 Bacteria 2050
178 Ga0207667_10429968 3300025949 Unclassified 1343
179 Ga0207668_10118035 3300025972 Bacteria 2003
180 Ga0207668_10144737 3300025972 Bacteria 1832
181 Ga0207668_10352369 3300025972 Bacteria 1231
182 Ga0207668_11310284 3300025972 Bacteria 652
183 Ga0207658_10047290 3300025986 Bacteria 3148
184 Ga0207703_10100137 3300026035 Bacteria 2455
185 Ga0207639_10037485 3300026041 Bacteria 3601
186 Ga0207639_10071502 3300026041 Bacteria 2714
187 Ga0207678_10010694 3300026067 Bacteria 8061
188 Ga0207678_10017396 3300026067 Bacteria 6312
189 Ga0207702_10036171 3300026078 Bacteria 4129
190 Ga0207702_10062488 3300026078 Bacteria 3180
191 Ga0207702_10080900 3300026078 Bacteria 2820
192 Ga0207702_10394337 3300026078 Bacteria 1334
193 Ga0207702_11068123 3300026078 Bacteria 801
194 Ga0207641_10113568 3300026088 Bacteria 2405
195 Ga0207648_10433163 3300026089 Bacteria 1195
196 Ga0207676_10241867 3300026095 Bacteria 1619
197 Ga0207674_10000065 3300026116 Bacteria 109485
198 Ga0207674_10000583 3300026116 Bacteria 48003
199 Ga0207683_10052876 3300026121 Bacteria 3560
200 Ga0207683_10224251 3300026121 Bacteria 1713
201 Ga0207698_10009277 3300026142 Bacteria 6262
202 Ga0207698_10350947 3300026142 Bacteria 1393
203 Ga0207698_10503242 3300026142 Bacteria 1179
204 Ga0207698_10643096 3300026142 Bacteria 1050
205 Ga0209974_10054924 3300027876 Bacteria 1343
206 Ga0268266_10041442 3300028379 Bacteria 3929
207 Ga0268266_11477612 3300028379 Bacteria 655
208 Ga0268265_10113168 3300028380 Bacteria 2220
209 Ga0268264_10022508 3300028381 Bacteria 5144
210 Ga0316177_1144326 3300030731 Bacteria 1668
211 Ga0316176_1098915 3300030732 Bacteria 1492
212 Ga0314311_1221661 3300030733 Bacteria 871
213 Ga0316180_1134196 3300030736 Bacteria 1457
214 Ga0316183_1054598 3300030742 Bacteria 1574
215 Ga0316182_1016445 3300030745 Bacteria 2363
216 Ga0316182_1108548 3300030745 Bacteria 691
217 Ga0307408_100009801 3300031548 Bacteria 6315
218 Ga0307408_100130623 3300031548 Bacteria 1959
219 Ga0307408_100872925 3300031548 Bacteria 821
220 Ga0307408_100919805 3300031548 Bacteria 802
221 Ga0307408_101085685 3300031548 Bacteria 742
222 Ga0307405_10012793 3300031731 Bacteria 4457
223 Ga0307405_10029911 3300031731 Bacteria 3188
224 Ga0307405_10090139 3300031731 Bacteria 2028
225 Ga0307405_10129712 3300031731 Bacteria 1740
226 Ga0307405_10400237 3300031731 Bacteria 1074
227 Ga0307413_10003667 3300031824 Bacteria 6521
228 Ga0307413_10073746 3300031824 Bacteria 2158
229 Ga0307413_10094573 3300031824 Bacteria 1957
230 Ga0307413_10177551 3300031824 Bacteria 1514
231 Ga0307410_10001129 3300031852 Bacteria 11698
232 Ga0307410_10014887 3300031852 Bacteria 4594
233 Ga0307410_10030642 3300031852 Bacteria 3440
234 Ga0307410_10037511 3300031852 Bacteria 3166
235 Ga0307410_10073232 3300031852 Bacteria 2381
236 Ga0307410_10184968 3300031852 Bacteria 1580
237 Ga0307410_10491282 3300031852 Bacteria 1008
238 Ga0307410_10656815 3300031852 Bacteria 880
239 Ga0307406_10003268 3300031901 Bacteria 8833
240 Ga0307407_10010253 3300031903 Bacteria 4411
241 Ga0307407_10017460 3300031903 Bacteria 3601
242 Ga0307407_10022782 3300031903 Bacteria 3257
243 Ga0307407_10187778 3300031903 Bacteria 1375
244 Ga0307407_10235684 3300031903 Bacteria 1245
245 Ga0307407_10876504 3300031903 Bacteria 687
246 Ga0307412_10025971 3300031911 Bacteria 3635
247 Ga0307412_10041689 3300031911 Bacteria 2977
248 Ga0307412_10160081 3300031911 Bacteria 1671
249 Ga0307412_10170501 3300031911 Bacteria 1627
250 Ga0307412_10383284 3300031911 Bacteria 1139
251 Ga0307412_11344785 3300031911 Bacteria 645
252 Ga0307409_100056556 3300031995 Bacteria 3034
253 Ga0307409_100086287 3300031995 Bacteria 2554
254 Ga0307409_100100899 3300031995 Bacteria 2393
255 Ga0307409_100332183 3300031995 Bacteria 1427
256 Ga0307409_100709301 3300031995 Bacteria 1006
257 Ga0307409_100736860 3300031995 Bacteria 988
258 Ga0307409_100790757 3300031995 Bacteria 955
259 Ga0307416_100030360 3300032002 Bacteria 4054
260 Ga0307416_100042934 3300032002 Bacteria 3535
261 Ga0307416_100152921 3300032002 Bacteria 2119
262 Ga0307416_102223798 3300032002 Bacteria 649
263 Ga0307414_10009870 3300032004 Bacteria 5504
264 Ga0307414_10019810 3300032004 Bacteria 4178
265 Ga0307414_10023325 3300032004 Bacteria 3923
266 Ga0307414_10062638 3300032004 Bacteria 2641
267 Ga0307414_10121248 3300032004 Bacteria 2010
268 Ga0307414_10139501 3300032004 Bacteria 1896
269 Ga0307414_10396638 3300032004 Bacteria 1197
270 Ga0307414_10917682 3300032004 Bacteria 803
271 Ga0307411_10004892 3300032005 Bacteria 6509
272 Ga0307411_10008516 3300032005 Bacteria 5322
273 Ga0307411_10016845 3300032005 Bacteria 4146
274 Ga0307411_10025886 3300032005 Bacteria 3522
275 Ga0307411_10036624 3300032005 Bacteria 3076
276 Ga0307411_10104962 3300032005 Bacteria 2008
277 Ga0307411_10123998 3300032005 Bacteria 1875
278 Ga0307411_10467117 3300032005 Bacteria 1059
279 Ga0307411_11050960 3300032005 Bacteria 731
280 Ga0307415_100014553 3300032126 Bacteria 4630
281 Ga0307415_100016672 3300032126 Bacteria 4385
282 Ga0307415_100143985 3300032126 Bacteria 1824
283 Ga0307415_100347921 3300032126 Bacteria 1246
284 Ga0307415_100827312 3300032126 Bacteria 848
285 Ga0307415_101038355 3300032126 Bacteria 764
286 Ga0307415_101968078 3300032126 Bacteria 568
287 Ga0395899_0002094 3300037312 Bacteria 16381
288 Ga0395899_0063826 3300037312 Bacteria 2708
289 Ga0395900_0023243 3300037418 Bacteria 6344
290 Ga0395900_0055651 3300037418 Bacteria 4073
291 Ga0395900_0117616 3300037418 Bacteria 2727
292 Ga0395900_0260182 3300037418 Bacteria 1733
293 Ga0395900_0316939 3300037418 Bacteria 1541
294 Ga0395900_0438789 3300037418 Bacteria 1263
295 Ga0395900_0550275 3300037418 Bacteria 1098
296 Ga0395898_0002498 3300037466 Bacteria 21628
297 Ga0395898_0045309 3300037466 Bacteria 4323
298 Ga0395898_0121672 3300037466 Bacteria 2500
299 Ga0395898_0372633 3300037466 Bacteria 1361
300 Ga0395898_0644801 3300037466 Bacteria 1001
301 Ga0395898_0909263 3300037466 Bacteria 818
302 Ga0395905_0002093 3300037471 Bacteria 22679
303 Ga0395905_0002761 3300037471 Bacteria 19234
304 Ga0395905_0003180 3300037471 Bacteria 17680
305 Ga0395905_0010544 3300037471 Bacteria 8975
306 Ga0395905_0027479 3300037471 Bacteria 5366
307 Ga0395905_0035810 3300037471 Bacteria 4661
308 Ga0395905_0060590 3300037471 Bacteria 3539
309 Ga0395905_0169585 3300037471 Bacteria 2050
310 Ga0395905_0204109 3300037471 Bacteria 1853
311 Ga0395905_0250776 3300037471 Bacteria 1653
312 Ga0395905_0266989 3300037471 Bacteria 1597
313 Ga0395905_0301276 3300037471 Bacteria 1490
314 Ga0395905_0302999 3300037471 Bacteria 1485
315 Ga0395905_0597655 3300037471 Bacteria 1005
316 Ga0395901_0011606 3300038443 Bacteria 8926
317 Ga0395901_0029537 3300038443 Bacteria 5645
318 Ga0395901_0097889 3300038443 Bacteria 3075
319 Ga0395901_0129188 3300038443 Bacteria 2655
320 Ga0395901_0147516 3300038443 Bacteria 2472
321 Ga0395901_0435664 3300038443 Bacteria 1342
322 Ga0395901_0446910 3300038443 Bacteria 1322
323 Ga0395901_0456335 3300038443 Bacteria 1306
324 Ga0395901_0610710 3300038443 Bacteria 1098
325 Ga0395901_0619734 3300038443 Bacteria 1089
326 Ga0436365_1789276 3300039437 Bacteria 982
327 Ga0436363_0256830 3300039450 Bacteria 1265
328 Ga0451807_1537398 3300041486 Bacteria 647
329 Ga0439448_0001631 3300042005 Bacteria 5878
330 Ga0439455_0048117 3300042012 Bacteria 1108
331 Ga0439458_0000036 3300042157 Bacteria 21009
332 Ga0439464_0157648 3300042439 Bacteria 712
333 Ga0439460_0045739 3300042461 Bacteria 1299
334 Ga0466966_0037224 3300044684 Bacteria 3139
335 Ga0466963_0746347 3300044694 Bacteria 690
336 Ga0466970_0029725 3300044765 Bacteria 2879
337 Ga0466970_0250109 3300044765 Bacteria 993
338 Ga0466959_0713334 3300045049 Bacteria 672
339 Ga0466958_0287789 3300045836 Unclassified 1054
340 Ga0466967_0043631 3300045976 Bacteria 3884
341 Ga0466967_0099304 3300045976 Bacteria 2658
342 Ga0466967_0107902 3300045976 Bacteria 2554
343 Ga0466967_0231511 3300045976 Bacteria 1759
344 Ga0466967_0414280 3300045976 Bacteria 1312
345 Ga0495585_0154646 3300046492 Bacteria 1194
346 Ga0495643_0070525 3300046522 Bacteria 1835
347 Ga0495663_0036355 3300046525 Bacteria 1482
348 Ga0495642_0090308 3300046528 Bacteria 1296
349 Ga0495621_0013926 3300046539 Bacteria 2537
350 Ga0495621_0072136 3300046539 Bacteria 1274
351 Ga0495622_0081882 3300046557 Bacteria 1485
352 Ga0495633_0002038 3300046558 Bacteria 14582
353 Ga0495669_0001035 3300046684 Bacteria 11591
354 Ga0495669_0001045 3300046684 Bacteria 11523
355 Ga0495669_0072420 3300046684 Bacteria 1572
356 Ga0495670_0182560 3300046691 Bacteria 1108
357 Ga0495670_0346301 3300046691 Unclassified 799
358 Ga0495670_0360152 3300046691 Bacteria 783
359 Ga0495677_0072596 3300047445 Bacteria 1284
360 Ga0496101_0037523 3300048904 Bacteria 3438
361 Ga0496102_0039604 3300048905 Bacteria 4259
362 Ga0496103_0037191 3300048906 Bacteria 2982
363 Ga0496104_0379858 3300048907 Bacteria 1325
364 Ga0496105_0136734 3300048908 Bacteria 2019
365 Ga0496106_0013503 3300048909 Bacteria 6031
366 Ga0496106_0182144 3300048909 Bacteria 1668
367 Ga0496107_0053904 3300048910 Bacteria 2901
368 Ga0496107_0218829 3300048910 Bacteria 1416
369 Ga0496107_0324502 3300048910 Bacteria 1146
370 Ga0496108_0018570 3300048911 Bacteria 5695
371 Ga0496108_0177105 3300048911 Bacteria 1846
372 Ga0496108_0371915 3300048911 Bacteria 1248
373 Ga0496109_0012910 3300048912 Bacteria 7222
374 Ga0496109_0028293 3300048912 Bacteria 5011
375 Ga0496110_0000806 3300048913 Bacteria 21970
376 Ga0496110_0103600 3300048913 Bacteria 2552
377 Ga0496111_0003369 3300048914 Bacteria 9880
378 Ga0496111_0011205 3300048914 Bacteria 6035
379 Ga0496112_0018938 3300048915 Bacteria 6487
380 Ga0496113_0004483 3300048916 Bacteria 8593
381 Ga0496114_0332429 3300048917 Bacteria 1343
382 nmdc:mga07m45_108531_c1 3300050496 Bacteria 1597
383 nmdc:mga06r32_5150_c1 3300050510 Bacteria 11753
384 Ga0590071_032949 3300059421 Bacteria 1238
385 Ga0453684_0415519
386 MRS1b_contig_3079162
387 MBSR1b_contig_4008678
388 JGI24741J21665_1010384
389 JGI24752J21851_1001656
390 JGI24740J21852_10001913
391 JGI24737J22298_10002430
392 JGI24737J22298_10024885
393 JGI24749J21850_1015481
394 JGI24034J26672_10028577
395 Ga0065712_10081964
396 Ga0065715_10174096
397 Ga0070658_10024787
398 Ga0070658_10061686
399 Ga0070658_10118652
400 Ga0070658_10142458
401 Ga0070676_10523021
402 Ga0070683_100014722
403 Ga0070683_101282004
404 Ga0070670_100001791
405 Ga0070670_100009666
406 Ga0070670_100019767
407 Ga0070677_10006799
408 Ga0070666_10007313
409 Ga0070680_100000483
410 Ga0070660_100000490
411 Ga0070661_100009559
412 Ga0070661_100011231
413 Ga0070661_100050948
414 Ga0070661_100119715
415 Ga0070661_101290188
416 Ga0070692_10031508
417 Ga0070668_100022587
418 Ga0070668_100180045
419 Ga0070668_100473878
420 Ga0070669_100044387
421 Ga0070669_100157043
422 Ga0070669_101207118
423 Ga0070675_100008582
424 Ga0070675_100016916
425 Ga0070671_100000987
426 Ga0070671_100009923
427 Ga0070674_100084745
428 Ga0070674_100428459
429 Ga0070673_100035302
430 Ga0070673_100213117
431 Ga0070673_100287332
432 Ga0070673_100384979
433 Ga0070659_100039975
434 Ga0070659_100089177
435 Ga0070659_100111916
436 Ga0070667_100019694
437 Ga0070667_100027480
438 Ga0070709_10281812
439 Ga0070714_100075954
440 Ga0070714_100385251
441 Ga0070713_100011839
442 Ga0070663_100001084
443 Ga0070678_100041247
444 Ga0070678_100209546
445 Ga0070662_100058714
446 Ga0070662_100171489
447 Ga0070662_100317425
448 Ga0070662_100675170
449 Ga0070662_100919292
450 Ga0070681_10770344
451 Ga0068867_100029541
452 Ga0070679_100012912
453 Ga0070679_100044065
454 Ga0068853_100060620
455 Ga0068853_100167982
456 Ga0068853_100382289
457 Ga0070672_100011841
458 Ga0070672_100248182
459 Ga0070672_100376098
460 Ga0070695_100222799
461 Ga0070693_100430145
462 Ga0070665_100012566
463 Ga0070665_102024495
464 Ga0068855_100023981
465 Ga0068855_100097250
466 Ga0068855_100486045
467 Ga0070664_100002681
468 Ga0070664_100020928
469 Ga0070664_100056512
470 Ga0068857_100013524
471 Ga0068856_100108044
472 Ga0068856_100131992
473 Ga0068852_100007809
474 Ga0068859_100640877
475 Ga0068851_10401746
476 Ga0068870_10089793
477 Ga0068863_100029115
478 Ga0068858_100096993
479 Ga0068860_100068079
480 Ga0068862_100137327
481 Ga0068862_100295508
482 Ga0081539_10013126
483 Ga0081539_10019648
484 Ga0070717_10012793
485 Ga0068871_100039264
486 Ga0075431_100012663
487 Ga0075431_100672910
488 Ga0097620_100640914
489 Ga0105240_10159955
490 Ga0105248_10006248
491 Ga0105248_10094583
492 Ga0105248_11173083
493 Ga0105238_10048574
494 Ga0105239_10120618
495 Ga0105246_10038964
496 Ga0105246_10474549
497 Ga0157373_10410788
498 Ga0157370_10010748
499 Ga0157370_10049698
500 Ga0157369_10002175
501 Ga0157369_10110819
502 Ga0157372_11937088
503 Ga0163163_10103981
504 Ga0163163_11129171
505 Ga0157380_10165497
506 Ga0157380_10184200
507 Ga0157380_10242281
508 Ga0157380_11089992
509 Ga0157377_10107386
510 Ga0157379_10004998
511 Ga0163161_10450511
512 Ga0207656_10207129
513 Ga0207682_10000529
514 Ga0207688_10189013
515 Ga0207647_10003395
516 Ga0207647_10213107
517 Ga0207699_10757827
518 Ga0207645_10110276
519 Ga0207645_10649455
520 Ga0207705_10001584
521 Ga0207705_10282148
522 Ga0207705_10409466
523 Ga0207707_10508500
524 Ga0207660_10000415
525 Ga0207657_10001223
526 Ga0207657_10176689
527 Ga0207657_10324650
528 Ga0207649_10004021
529 Ga0207649_10006693
530 Ga0207649_10043364
531 Ga0207649_10088722
532 Ga0207652_10000594
533 Ga0207652_10629725
534 Ga0207681_10036607
535 Ga0207681_10138224
536 Ga0207681_10163208
537 Ga0207681_11155518
538 Ga0207650_10018851
539 Ga0207650_10122891
540 Ga0207659_10001607
541 Ga0207659_10052889
542 Ga0207700_10063371
543 Ga0207664_10305338
544 Ga0207644_10003573
545 Ga0207644_10043394
546 Ga0207690_10047855
547 Ga0207690_10282426
548 Ga0207690_10363796
549 Ga0207690_10372474
550 Ga0207706_10188495
551 Ga0207706_10553043
552 Ga0207669_10343373
553 Ga0207669_10643467
554 Ga0207691_10109459
555 Ga0207711_10039470
556 Ga0207661_10016243
557 Ga0207679_10049416
558 Ga0207667_10044068
559 Ga0207667_10136827
560 Ga0207667_10149039
561 Ga0207667_10200001
562 Ga0207667_10429968
563 Ga0207668_10118035
564 Ga0207668_10144737
565 Ga0207668_10352369
566 Ga0207668_11310284
567 Ga0207658_10047290
568 Ga0207703_10100137
569 Ga0207639_10037485
570 Ga0207639_10071502
571 Ga0207678_10010694
572 Ga0207678_10017396
573 Ga0207702_10036171
574 Ga0207702_10062488
575 Ga0207702_10080900
576 Ga0207702_10394337
577 Ga0207702_11068123
578 Ga0207641_10113568
579 Ga0207648_10433163
580 Ga0207676_10241867
581 Ga0207674_10000065
582 Ga0207674_10000583
583 Ga0207683_10052876
584 Ga0207683_10224251
585 Ga0207698_10009277
586 Ga0207698_10350947
587 Ga0207698_10503242
588 Ga0207698_10643096
589 Ga0209974_10054924
590 Ga0268266_10041442
591 Ga0268266_11477612
592 Ga0268265_10113168
593 Ga0268264_10022508
594 Ga0316177_1144326
595 Ga0316176_1098915
596 Ga0314311_1221661
597 Ga0316180_1134196
598 Ga0316183_1054598
599 Ga0316182_1016445
600 Ga0316182_1108548
601 Ga0307408_100009801
602 Ga0307408_100130623
603 Ga0307408_100872925
604 Ga0307408_100919805
605 Ga0307408_101085685
606 Ga0307405_10012793
607 Ga0307405_10029911
608 Ga0307405_10090139
609 Ga0307405_10129712
610 Ga0307405_10400237
611 Ga0307413_10003667
612 Ga0307413_10073746
613 Ga0307413_10094573
614 Ga0307413_10177551
615 Ga0307410_10001129
616 Ga0307410_10014887
617 Ga0307410_10030642
618 Ga0307410_10037511
619 Ga0307410_10073232
620 Ga0307410_10184968
621 Ga0307410_10491282
622 Ga0307410_10656815
623 Ga0307406_10003268
624 Ga0307407_10010253
625 Ga0307407_10017460
626 Ga0307407_10022782
627 Ga0307407_10187778
628 Ga0307407_10235684
629 Ga0307407_10876504
630 Ga0307412_10025971
631 Ga0307412_10041689
632 Ga0307412_10160081
633 Ga0307412_10170501
634 Ga0307412_10383284
635 Ga0307412_11344785
636 Ga0307409_100056556
637 Ga0307409_100086287
638 Ga0307409_100100899
639 Ga0307409_100332183
640 Ga0307409_100709301
641 Ga0307409_100736860
642 Ga0307409_100790757
643 Ga0307416_100030360
644 Ga0307416_100042934
645 Ga0307416_100152921
646 Ga0307416_102223798
647 Ga0307414_10009870
648 Ga0307414_10019810
649 Ga0307414_10023325
650 Ga0307414_10062638
651 Ga0307414_10121248
652 Ga0307414_10139501
653 Ga0307414_10396638
654 Ga0307414_10917682
655 Ga0307411_10004892
656 Ga0307411_10008516
657 Ga0307411_10016845
658 Ga0307411_10025886
659 Ga0307411_10036624
660 Ga0307411_10104962
661 Ga0307411_10123998
662 Ga0307411_10467117
663 Ga0307411_11050960
664 Ga0307415_100014553
665 Ga0307415_100016672
666 Ga0307415_100143985
667 Ga0307415_100347921
668 Ga0307415_100827312
669 Ga0307415_101038355
670 Ga0307415_101968078
671 Ga0395899_0002094
672 Ga0395899_0063826
673 Ga0395900_0023243
674 Ga0395900_0055651
675 Ga0395900_0117616
676 Ga0395900_0260182
677 Ga0395900_0316939
678 Ga0395900_0438789
679 Ga0395900_0550275
680 Ga0395898_0002498
681 Ga0395898_0045309
682 Ga0395898_0121672
683 Ga0395898_0372633
684 Ga0395898_0644801
685 Ga0395898_0909263
686 Ga0395905_0002093
687 Ga0395905_0002761
688 Ga0395905_0003180
689 Ga0395905_0010544
690 Ga0395905_0027479
691 Ga0395905_0035810
692 Ga0395905_0060590
693 Ga0395905_0169585
694 Ga0395905_0204109
695 Ga0395905_0250776
696 Ga0395905_0266989
697 Ga0395905_0301276
698 Ga0395905_0302999
699 Ga0395905_0597655
700 Ga0395901_0011606
701 Ga0395901_0029537
702 Ga0395901_0097889
703 Ga0395901_0129188
704 Ga0395901_0147516
705 Ga0395901_0435664
706 Ga0395901_0446910
707 Ga0395901_0456335
708 Ga0395901_0610710
709 Ga0395901_0619734
710 Ga0436365_1789276
711 Ga0436363_0256830
712 Ga0451807_1537398
713 Ga0439448_0001631
714 Ga0439455_0048117
715 Ga0439458_0000036
716 Ga0439464_0157648
717 Ga0439460_0045739
718 Ga0466966_0037224
719 Ga0466963_0746347
720 Ga0466970_0029725
721 Ga0466970_0250109
722 Ga0466959_0713334
723 Ga0466958_0287789
724 Ga0466967_0043631
725 Ga0466967_0099304
726 Ga0466967_0107902
727 Ga0466967_0231511
728 Ga0466967_0414280
729 Ga0495585_0154646
730 Ga0495643_0070525
731 Ga0495663_0036355
732 Ga0495642_0090308
733 Ga0495621_0013926
734 Ga0495621_0072136
735 Ga0495622_0081882
736 Ga0495633_0002038
737 Ga0495669_0001035
738 Ga0495669_0001045
739 Ga0495669_0072420
740 Ga0495670_0182560
741 Ga0495670_0346301
742 Ga0495670_0360152
743 Ga0495677_0072596
744 Ga0496101_0037523
745 Ga0496102_0039604
746 Ga0496103_0037191
747 Ga0496104_0379858
748 Ga0496105_0136734
749 Ga0496106_0013503
750 Ga0496106_0182144
751 Ga0496107_0053904
752 Ga0496107_0218829
753 Ga0496107_0324502
754 Ga0496108_0018570
755 Ga0496108_0177105
756 Ga0496108_0371915
757 Ga0496109_0012910
758 Ga0496109_0028293
759 Ga0496110_0000806
760 Ga0496110_0103600
761 Ga0496111_0003369
762 Ga0496111_0011205
763 Ga0496112_0018938
764 Ga0496113_0004483
765 Ga0496114_0332429
766 nmdc:mga07m45_108531_c1
767 nmdc:mga06r32_5150_c1
768 Ga0590071_032949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ive-assembly1.cif.gz_B molecular structure of a thermostable and a zinc ion binding gamma-class carbonic anhydrase 0.9779 5 99
8e73-assembly1.cif.gz_G2 vigna radiata supercomplex i+iii2 (full bridge) 0.9615 2 100
4mfg-assembly2.cif.gz_D 2.0 angstrom resolution crystal structure of putative carbonic anhydrase from clostridium difficile. 0.9577 11 100
7aqq-assembly1.cif.gz_x cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.9257 1 98
8bqs-assembly1.cif.gz_AK cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.9063 5 100
ID Description Score Start End Superfamily
6iveA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9734 2 99 2.160.10.10
af_Q54JC2_42_221_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9598 1 100 2.160.10.10
af_A4HTG9_46_218_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9034 1 96 2.160.10.10
af_I6YCB9_1_165_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8886 1 98 2.160.10.10
af_Q4D1S1_471_572_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8838 23 101 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A259CZT3-F1-model_v4 Gamma carbonic anhydrase family protein 0.9995 3 74
AF-A0A522AW78-F1-model_v4 Gamma carbonic anhydrase family protein 0.9968 7 91
AF-A0A352UWP2-F1-model_v4 Gamma carbonic anhydrase family protein 0.9961 3 90
AF-W1V4V6-F1-model_v4 Bacterial transferase hexapeptide repeat protein 0.9945 5 94 GO:0016740
AF-A0A522CXF5-F1-model_v4 Gamma carbonic anhydrase family protein 0.9939 17 99

Map