F429893

General Info

Members Datasets Scaffolds Average Seq Length
384 177 379 303

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10004344|Ga0157371_100043449
Length 349
Sequence LFYYLSIQNEKPFIRISSLNLLQQIVLHFQKNHHNFSSQKSIDMELTRRKFLVNSSMALAGTMLLPDFIFAHKKASDHILGIQLYSVRDDMKKDPLGTLKQLSAMGYKNVEHANYIDRKFYGYSAKDFKKVLDDLGLNMPSGHTVMSGADWDSSKNDFTDKWKQTVEDAATVGEMYVISPWLDESLRQNYDELVKFLDVFNKSGELCKKSGLKFGYHNHDFEFKYSLNGKQIYDIILEKTDPDLVLQQIDIGNMYGAGGRALEIVKKHPGRFQSMHVKDEIKATKTGEMGDGYESTVLGKGILPVKEIVDVFQQKGGTTEFIIEQESYQGKSPLDCSKDDLQVMRKWGF

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 0.26
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 4.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000312 3300001979 Bacteria 20702
2 JGI24739J22299_10010107 3300001989 Bacteria 3507
3 JGI24739J22299_10041138 3300001989 Unclassified 1540
4 JGI25154J39366_1000016 3300002738 Bacteria 255057
5 JGI25157J39369_1002846 3300002741 Bacteria 3907
6 JGI25406J46586_10011756 3300003203 Bacteria 3823
7 rootH1_10125285 3300003316 Bacteria 3581
8 rootH2_10018538 3300003320 Bacteria 11760
9 rootL2_10018192 3300003322 Bacteria 10483
10 rootH1_10032098 3300003323 Bacteria 8504
11 JGI25160J50197_1001334 3300003354 Bacteria 12455
12 JGI25160J50197_1003921 3300003354 Bacteria 6511
13 JGI25160J50197_1004084 3300003354 Bacteria 6356
14 JGI25160J50197_1005112 3300003354 Bacteria 5523
15 Ga0065165_1021969 3300005262 Bacteria 2201
16 Ga0065714_10005259 3300005288 Bacteria 4031
17 Ga0065704_10128320 3300005289 Bacteria 1664
18 Ga0070658_10047699 3300005327 Bacteria 3466
19 Ga0070658_10047756 3300005327 Bacteria 3464
20 Ga0070658_10282697 3300005327 Bacteria 1412
21 Ga0070670_100054188 3300005331 Bacteria 3443
22 Ga0068869_100083795 3300005334 Bacteria 2385
23 Ga0068869_100122376 3300005334 Bacteria 1991
24 Ga0068869_100259347 3300005334 Bacteria 1391
25 Ga0068869_100285369 3300005334 Bacteria 1329
26 Ga0070666_10000152 3300005335 Bacteria 47539
27 Ga0070666_10011721 3300005335 Bacteria 5512
28 Ga0070666_10242180 3300005335 Bacteria 1276
29 Ga0070680_100015020 3300005336 Bacteria 6062
30 Ga0068868_100023561 3300005338 Unclassified 4660
31 Ga0068868_100027930 3300005338 Bacteria 4308
32 Ga0070660_100001201 3300005339 Bacteria 17564
33 Ga0070660_100002765 3300005339 Bacteria 12054
34 Ga0070660_100020641 3300005339 Bacteria 4846
35 Ga0070660_100153650 3300005339 Unclassified 1852
36 Ga0070692_10018053 3300005345 Bacteria 3385
37 Ga0070668_100037517 3300005347 Bacteria 3700
38 Ga0070668_100126829 3300005347 Unclassified 2045
39 Ga0070675_100270634 3300005354 Bacteria 1491
40 Ga0070671_100049503 3300005355 Bacteria 3495
41 Ga0070671_100157516 3300005355 Unclassified 1919
42 Ga0070674_100090577 3300005356 Bacteria 2206
43 Ga0070673_100016646 3300005364 Bacteria 5206
44 Ga0070673_100273782 3300005364 Bacteria 1478
45 Ga0070659_100079156 3300005366 Unclassified 2623
46 Ga0070667_100007255 3300005367 Bacteria 9210
47 Ga0070667_100012206 3300005367 Bacteria 7108
48 Ga0070667_100047439 3300005367 Bacteria 3614
49 Ga0070667_100051154 3300005367 Bacteria 3483
50 Ga0070667_100220423 3300005367 Bacteria 1688
51 Ga0070667_100290958 3300005367 Unclassified 1469
52 Ga0070663_100009188 3300005455 Bacteria 6112
53 Ga0070678_100025666 3300005456 Bacteria 3970
54 Ga0070678_100173863 3300005456 Bacteria 1757
55 Ga0070681_10008321 3300005458 Bacteria 10161
56 Ga0068867_100223440 3300005459 Bacteria 1519
57 Ga0070679_100023038 3300005530 Bacteria 6092
58 Ga0070679_100023837 3300005530 Bacteria 5996
59 Ga0070679_100266919 3300005530 Bacteria 1666
60 Ga0070684_100014079 3300005535 Bacteria 6469
61 Ga0068853_100047925 3300005539 Unclassified 3668
62 Ga0068853_100051932 3300005539 Bacteria 3530
63 Ga0070672_100057218 3300005543 Bacteria 3060
64 Ga0070672_100249178 3300005543 Unclassified 1496
65 Ga0070665_100000009 3300005548 Bacteria 562640
66 Ga0068855_100001370 3300005563 Bacteria 30171
67 Ga0068855_100006679 3300005563 Bacteria 14007
68 Ga0068855_100708612 3300005563 Bacteria 1076
69 Ga0070664_100257679 3300005564 Bacteria 1569
70 Ga0068857_100269273 3300005577 Bacteria 1565
71 Ga0068854_100088298 3300005578 Bacteria 2302
72 Ga0068854_100267469 3300005578 Bacteria 1371
73 Ga0068856_100005474 3300005614 Bacteria 12510
74 Ga0068852_100011190 3300005616 Bacteria 6741
75 Ga0068852_100012762 3300005616 Bacteria 6398
76 Ga0068852_100029207 3300005616 Unclassified 4526
77 Ga0068852_100118070 3300005616 Bacteria 2423
78 Ga0068852_100163884 3300005616 Bacteria 2078
79 Ga0068852_100170299 3300005616 Bacteria 2041
80 Ga0068852_100407560 3300005616 Unclassified 1338
81 Ga0068859_100000026 3300005617 Bacteria 188742
82 Ga0068859_100037401 3300005617 Unclassified 4871
83 Ga0068859_100055156 3300005617 Bacteria 3999
84 Ga0068859_100065816 3300005617 Bacteria 3658
85 Ga0068864_100003051 3300005618 Bacteria 13829
86 Ga0068864_100059456 3300005618 Bacteria 3307
87 Ga0068866_10032993 3300005718 Bacteria 2507
88 Ga0068861_100067355 3300005719 Bacteria 2763
89 Ga0068861_100404944 3300005719 Bacteria 1212
90 Ga0068851_10025961 3300005834 Bacteria 2876
91 Ga0068870_10254507 3300005840 Unclassified 1090
92 Ga0068863_100009621 3300005841 Bacteria 9428
93 Ga0068863_100015580 3300005841 Bacteria 7305
94 Ga0068863_100052396 3300005841 Bacteria 3868
95 Ga0068858_100004620 3300005842 Bacteria 13478
96 Ga0068860_100003506 3300005843 Bacteria 16150
97 Ga0068860_100003692 3300005843 Bacteria 15765
98 Ga0068860_100005422 3300005843 Bacteria 12937
99 Ga0068860_100010007 3300005843 Bacteria 9401
100 Ga0068860_100024010 3300005843 Bacteria 5894
101 Ga0068860_100110388 3300005843 Bacteria 2629
102 Ga0068860_100493940 3300005843 Bacteria 1221
103 Ga0068862_100038073 3300005844 Unclassified 4078
104 Ga0081539_10000935 3300005985 Bacteria 54736
105 Ga0097621_100000018 3300006237 Bacteria 88867
106 Ga0097621_100013966 3300006237 Bacteria 5999
107 Ga0097621_100020490 3300006237 Bacteria 5094
108 Ga0068871_100000275 3300006358 Bacteria 35449
109 Ga0068871_100006329 3300006358 Bacteria 8365
110 Ga0068871_100153505 3300006358 Unclassified 1965
111 Ga0068871_100421517 3300006358 Unclassified 1192
112 Ga0075431_100000866 3300006847 Bacteria 26579
113 Ga0075429_100009709 3300006880 Bacteria 8341
114 Ga0068865_100019239 3300006881 Bacteria 4418
115 Ga0068865_100244173 3300006881 Bacteria 1414
116 Ga0097620_100000026 3300006931 Bacteria 188742
117 Ga0097620_100037401 3300006931 Unclassified 4871
118 Ga0097620_100055155 3300006931 Bacteria 3999
119 Ga0097620_100065813 3300006931 Bacteria 3658
120 Ga0105240_10002649 3300009093 Bacteria 28486
121 Ga0105240_10010818 3300009093 Bacteria 12778
122 Ga0105240_10017519 3300009093 Bacteria 9651
123 Ga0105240_10192865 3300009093 Bacteria 2394
124 Ga0105240_10398377 3300009093 Bacteria 1551
125 Ga0111539_10049532 3300009094 Bacteria 5008
126 Ga0111539_10262126 3300009094 Bacteria 2012
127 Ga0111539_10525628 3300009094 Unclassified 1378
128 Ga0105245_10086825 3300009098 Bacteria 2870
129 Ga0114129_10001572 3300009147 Bacteria 31003
130 Ga0105241_10002882 3300009174 Bacteria 12852
131 Ga0105241_10021586 3300009174 Bacteria 4761
132 Ga0105241_10152041 3300009174 Bacteria 1894
133 Ga0105242_10040708 3300009176 Unclassified 3745
134 Ga0105242_10146483 3300009176 Bacteria 2055
135 Ga0105242_10441637 3300009176 Bacteria 1224
136 Ga0105248_10125639 3300009177 Bacteria 2894
137 Ga0105237_10007466 3300009545 Bacteria 11960
138 Ga0105237_10013943 3300009545 Bacteria 8410
139 Ga0105237_10019609 3300009545 Bacteria 6984
140 Ga0105237_10042630 3300009545 Bacteria 4575
141 Ga0105238_10006264 3300009551 Bacteria 11822
142 Ga0105238_10170528 3300009551 Bacteria 2152
143 Ga0105249_10000882 3300009553 Bacteria 26651
144 Ga0105239_10007420 3300010375 Bacteria 12578
145 Ga0105239_10058740 3300010375 Bacteria 4221
146 Ga0105239_10311360 3300010375 Unclassified 1775
147 Ga0105239_10701298 3300010375 Unclassified 1157
148 Ga0105246_10084761 3300011119 Bacteria 2268
149 Ga0157373_10009386 3300013100 Bacteria 7225
150 Ga0157373_10062724 3300013100 Unclassified 2632
151 Ga0157373_10163444 3300013100 Bacteria 1566
152 Ga0157371_10001463 3300013102 Bacteria 24493
153 Ga0157371_10002753 3300013102 Bacteria 16525
154 Ga0157371_10003752 3300013102 Bacteria 13602
155 Ga0157371_10004344 3300013102 Bacteria 12418
156 Ga0157371_10030737 3300013102 Bacteria 3872
157 Ga0157371_10049663 3300013102 Bacteria 2980
158 Ga0157371_10064314 3300013102 Bacteria 2599
159 Ga0157371_10151572 3300013102 Bacteria 1654
160 Ga0157371_10155066 3300013102 Bacteria 1634
161 Ga0157371_10292675 3300013102 Bacteria 1178
162 Ga0157370_10000716 3300013104 Bacteria 41551
163 Ga0157370_10002309 3300013104 Bacteria 23081
164 Ga0157370_10033932 3300013104 Unclassified 4972
165 Ga0157370_10051288 3300013104 Bacteria 3941
166 Ga0157370_10261607 3300013104 Bacteria 1599
167 Ga0157369_10007187 3300013105 Bacteria 12832
168 Ga0157369_10022689 3300013105 Bacteria 7000
169 Ga0157369_10031302 3300013105 Bacteria 5859
170 Ga0157369_10054343 3300013105 Bacteria 4325
171 Ga0157369_10218756 3300013105 Unclassified 1994
172 Ga0157374_10344929 3300013296 Bacteria 1479
173 Ga0157378_10012965 3300013297 Bacteria 7292
174 Ga0157378_10067440 3300013297 Bacteria 3206
175 Ga0157378_10185775 3300013297 Bacteria 1958
176 Ga0157378_10222906 3300013297 Bacteria 1793
177 Ga0157378_10478366 3300013297 Unclassified 1241
178 Ga0163162_10000728 3300013306 Bacteria 30520
179 Ga0163162_10003091 3300013306 Bacteria 15896
180 Ga0163162_10003695 3300013306 Bacteria 14672
181 Ga0163162_10026074 3300013306 Bacteria 5777
182 Ga0163162_10051073 3300013306 Bacteria 4147
183 Ga0163162_10095899 3300013306 Bacteria 3054
184 Ga0163162_10173620 3300013306 Bacteria 2280
185 Ga0163162_10351036 3300013306 Unclassified 1608
186 Ga0157372_10000573 3300013307 Bacteria 40317
187 Ga0157372_10007880 3300013307 Bacteria 11320
188 Ga0157372_10018412 3300013307 Bacteria 7507
189 Ga0157372_10023196 3300013307 Bacteria 6726
190 Ga0157372_10037120 3300013307 Bacteria 5371
191 Ga0157372_10054230 3300013307 Bacteria 4471
192 Ga0157372_10055114 3300013307 Unclassified 4438
193 Ga0157372_10102333 3300013307 Bacteria 3272
194 Ga0157372_10332838 3300013307 Bacteria 1768
195 Ga0157372_10388521 3300013307 Bacteria 1626
196 Ga0157375_10034613 3300013308 Bacteria 4813
197 Ga0157375_10139406 3300013308 Bacteria 2551
198 Ga0157375_10145028 3300013308 Bacteria 2504
199 Ga0157375_10210804 3300013308 Unclassified 2100
200 Ga0157375_10495804 3300013308 Bacteria 1386
201 Ga0163163_10395244 3300014325 Bacteria 1440
202 Ga0157380_10005484 3300014326 Bacteria 8863
203 Ga0157379_10019249 3300014968 Bacteria 6029
204 Ga0157376_10000076 3300014969 Bacteria 75313
205 Ga0157376_10156986 3300014969 Bacteria 2058
206 Ga0157376_10598266 3300014969 Bacteria 1097
207 Ga0163161_10004225 3300017792 Bacteria 10024
208 Ga0163161_10191938 3300017792 Bacteria 1571
209 Ga0209646_1000003 3300025246 Bacteria 1160860
210 Ga0209026_1000333 3300025250 Bacteria 45722
211 Ga0209129_1008402 3300025258 Bacteria 2877
212 Ga0207426_1000132 3300025302 Bacteria 209623
213 Ga0207426_1000277 3300025302 Bacteria 106036
214 Ga0207426_1000392 3300025302 Bacteria 74841
215 Ga0207656_10136885 3300025321 Bacteria 1152
216 Ga0207642_10114074 3300025899 Bacteria 1381
217 Ga0207688_10048560 3300025901 Bacteria 2371
218 Ga0207680_10002441 3300025903 Bacteria 8663
219 Ga0207680_10271765 3300025903 Unclassified 1176
220 Ga0207680_10356462 3300025903 Bacteria 1028
221 Ga0207647_10013261 3300025904 Bacteria 5720
222 Ga0207647_10143241 3300025904 Bacteria 1400
223 Ga0207645_10000693 3300025907 Bacteria 27991
224 Ga0207643_10013579 3300025908 Bacteria 4413
225 Ga0207705_10002684 3300025909 Bacteria 13616
226 Ga0207705_10056512 3300025909 Bacteria 2830
227 Ga0207654_10002690 3300025911 Bacteria 9027
228 Ga0207654_10013730 3300025911 Bacteria 4172
229 Ga0207654_10028496 3300025911 Bacteria 3044
230 Ga0207654_10264477 3300025911 Bacteria 1158
231 Ga0207707_10003340 3300025912 Bacteria 14244
232 Ga0207707_10038286 3300025912 Bacteria 4191
233 Ga0207707_10047856 3300025912 Bacteria 3724
234 Ga0207707_10326783 3300025912 Bacteria 1323
235 Ga0207695_10000128 3300025913 Bacteria 226098
236 Ga0207695_10001712 3300025913 Bacteria 35115
237 Ga0207695_10003683 3300025913 Bacteria 21346
238 Ga0207695_10348026 3300025913 Bacteria 1369
239 Ga0207695_10354230 3300025913 Bacteria 1354
240 Ga0207695_10369964 3300025913 Bacteria 1319
241 Ga0207671_10001027 3300025914 Bacteria 33973
242 Ga0207671_10005214 3300025914 Bacteria 12082
243 Ga0207671_10018101 3300025914 Bacteria 5413
244 Ga0207660_10004403 3300025917 Bacteria 9182
245 Ga0207660_10165806 3300025917 Bacteria 1707
246 Ga0207657_10006445 3300025919 Bacteria 12161
247 Ga0207657_10007951 3300025919 Bacteria 10815
248 Ga0207657_10070608 3300025919 Bacteria 2960
249 Ga0207657_10185754 3300025919 Bacteria 1679
250 Ga0207652_10000546 3300025921 Bacteria 38083
251 Ga0207652_10001149 3300025921 Bacteria 23813
252 Ga0207652_10012635 3300025921 Bacteria 6826
253 Ga0207652_10036266 3300025921 Bacteria 4169
254 Ga0207652_10049897 3300025921 Bacteria 3584
255 Ga0207681_10010297 3300025923 Bacteria 5719
256 Ga0207694_10013834 3300025924 Bacteria 6083
257 Ga0207694_10014121 3300025924 Bacteria 6021
258 Ga0207694_10083020 3300025924 Bacteria 2519
259 Ga0207650_10101911 3300025925 Bacteria 2211
260 Ga0207650_10221490 3300025925 Bacteria 1523
261 Ga0207659_10028420 3300025926 Bacteria 3801
262 Ga0207644_10012160 3300025931 Bacteria 5712
263 Ga0207644_10103486 3300025931 Unclassified 2143
264 Ga0207704_10192987 3300025938 Bacteria 1483
265 Ga0207704_10437549 3300025938 Bacteria 1041
266 Ga0207711_10095542 3300025941 Bacteria 2622
267 Ga0207689_10011065 3300025942 Bacteria 7754
268 Ga0207689_10031331 3300025942 Bacteria 4428
269 Ga0207689_10088520 3300025942 Bacteria 2543
270 Ga0207689_10374858 3300025942 Bacteria 1184
271 Ga0207661_10016451 3300025944 Bacteria 5457
272 Ga0207661_10362468 3300025944 Unclassified 1309
273 Ga0207679_10199141 3300025945 Bacteria 1672
274 Ga0207667_10000610 3300025949 Bacteria 46234
275 Ga0207667_10001143 3300025949 Bacteria 33339
276 Ga0207667_10001317 3300025949 Bacteria 31149
277 Ga0207667_10020059 3300025949 Bacteria 7443
278 Ga0207651_10211673 3300025960 Unclassified 1561
279 Ga0207712_10006001 3300025961 Bacteria 7665
280 Ga0207668_10389747 3300025972 Bacteria 1175
281 Ga0207668_10414880 3300025972 Bacteria 1141
282 Ga0207640_10119236 3300025981 Bacteria 1887
283 Ga0207640_10123583 3300025981 Bacteria 1859
284 Ga0207658_10040251 3300025986 Bacteria 3377
285 Ga0207658_10064057 3300025986 Bacteria 2756
286 Ga0207677_10007100 3300026023 Bacteria 6166
287 Ga0207677_10287461 3300026023 Bacteria 1353
288 Ga0207677_10343340 3300026023 Bacteria 1248
289 Ga0207703_10016603 3300026035 Bacteria 5742
290 Ga0207678_10012570 3300026067 Bacteria 7439
291 Ga0207702_10007728 3300026078 Bacteria 9130
292 Ga0207702_10317284 3300026078 Bacteria 1483
293 Ga0207641_10000215 3300026088 Bacteria 74812
294 Ga0207641_10051999 3300026088 Bacteria 3469
295 Ga0207641_10142545 3300026088 Bacteria 2164
296 Ga0207641_10207516 3300026088 Unclassified 1810
297 Ga0207648_10001098 3300026089 Bacteria 30333
298 Ga0207648_10101786 3300026089 Bacteria 2517
299 Ga0207676_10004945 3300026095 Bacteria 9447
300 Ga0207676_10185310 3300026095 Bacteria 1826
301 Ga0207674_10007729 3300026116 Bacteria 12515
302 Ga0207674_10046895 3300026116 Bacteria 4434
303 Ga0207675_100069989 3300026118 Bacteria 3279
304 Ga0207683_10000597 3300026121 Bacteria 33268
305 Ga0207683_10038549 3300026121 Bacteria 4166
306 Ga0207683_10247935 3300026121 Unclassified 1625
307 Ga0207698_10006881 3300026142 Bacteria 7115
308 Ga0207698_10009482 3300026142 Bacteria 6211
309 Ga0207698_10026849 3300026142 Unclassified 4079
310 Ga0207698_10107235 3300026142 Bacteria 2332
311 Ga0207698_10166775 3300026142 Bacteria 1934
312 Ga0207698_10330011 3300026142 Unclassified 1433
313 Ga0268266_10000014 3300028379 Bacteria 644033
314 Ga0268266_10101154 3300028379 Bacteria 2540
315 Ga0268265_10039508 3300028380 Unclassified 3479
316 Ga0268265_10043616 3300028380 Bacteria 3336
317 Ga0268264_10000013 3300028381 Bacteria 513859
318 Ga0268264_10000801 3300028381 Bacteria 33940
319 Ga0268264_10020399 3300028381 Bacteria 5417
320 Ga0268264_10070289 3300028381 Bacteria 2963
321 Ga0268264_10078086 3300028381 Bacteria 2822
322 Ga0268264_10188616 3300028381 Bacteria 1878
323 Ga0307517_10153904 3300028786 Bacteria 1568
324 Ga0307511_10001218 3300030521 Bacteria 27286
325 Ga0307513_10267190 3300031456 Unclassified 1496
326 Ga0307509_10025440 3300031507 Bacteria 6610
327 Ga0307508_10004344 3300031616 Bacteria 13864
328 Ga0265342_10136497 3300031712 Bacteria 1371
329 Ga0307414_10058611 3300032004 Bacteria 2714
330 Ga0373927_0004569 3300035695 Bacteria 9668
331 Ga0395899_0005291 3300037312 Bacteria 10018
332 Ga0395899_0005294 3300037312 Bacteria 10015
333 Ga0395899_0125660 3300037312 Unclassified 1834
334 Ga0395900_0046358 3300037418 Bacteria 4476
335 Ga0395900_0050107 3300037418 Bacteria 4301
336 Ga0395900_0194005 3300037418 Unclassified 2058
337 Ga0395900_0272595 3300037418 Unclassified 1686
338 Ga0395900_0306176 3300037418 Bacteria 1573
339 Ga0395898_0001279 3300037466 Bacteria 37056
340 Ga0395898_0009578 3300037466 Bacteria 10172
341 Ga0395898_0056750 3300037466 Bacteria 3816
342 Ga0395898_0294098 3300037466 Unclassified 1549
343 Ga0395901_0015212 3300038443 Bacteria 7828
344 Ga0395901_0049204 3300038443 Bacteria 4379
345 Ga0395901_0120556 3300038443 Bacteria 2756
346 Ga0395901_0726346 3300038443 Unclassified 988
347 Ga0436365_1577799 3300039437 Bacteria 1598
348 Ga0451577_0007737 3300042876 Bacteria 10534
349 Ga0466972_0000661 3300044658 Bacteria 16620
350 Ga0466972_0031297 3300044658 Bacteria 2618
351 Ga0453684_0000337 3300044712 Bacteria 195296
352 Ga0453684_0018518 3300044712 Bacteria 10683
353 Ga0453684_0025954 3300044712 Bacteria 8485
354 Ga0453684_0548752 3300044712 Bacteria 1273
355 Ga0466960_0006836 3300044901 Bacteria 4598
356 Ga0466959_0020306 3300045049 Bacteria 4893
357 Ga0451576_0004036 3300045051 Bacteria 19504
358 Ga0451576_0141040 3300045051 Bacteria 2513
359 Ga0495638_0033322 3300046460 Unclassified 3295
360 Ga0495644_0006633 3300046523 Bacteria 4486
361 Ga0495645_0239635 3300046543 Bacteria 1211
362 Ga0495661_0011980 3300046665 Bacteria 5868
363 Ga0495687_000106 3300047443 Bacteria 128130
364 Ga0495686_0000016 3300047472 Bacteria 443701
365 Ga0496100_0070252 3300048903 Bacteria 2335
366 Ga0501046_0144740 3300049580 Unclassified 1796
367 Ga0501047_0429615 3300049581 Bacteria 1152
368 Ga0501070_0048805 3300049586 Unclassified 3516
369 Ga0501035_0451840 3300049822 Bacteria 1063
370 Ga0501044_0358795 3300049823 Unclassified 1376
371 Ga0501044_0374107 3300049823 Bacteria 1341
372 nmdc:mga09592_38049_c1 3300050508 Unclassified 4037
373 nmdc:mga06r32_9671_c1 3300050510 Bacteria 8709
374 nmdc:mga08y16_310493_c1 3300050511 Unclassified 1624
375 nmdc:mga08y16_517069_c1 3300050511 Unclassified 1211
376 nmdc:mga08y16_644640_c1 3300050511 Unclassified 1064
377 Ga0500583_0003587 3300053092 Bacteria 4911
378 Ga0500568_0039153 3300053139 Bacteria 1916
379 Ga0500622_0003372 3300053156 Bacteria 10750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0031297 Ga0466972_0031297_1216_2121 280
2 3300045049 Ga0466959_0020306 Ga0466959_0020306_185_1090 280
3 3300049580 Ga0501046_0144740 Ga0501046_0144740_908_1750 280
4 3300003320 rootH2_10018538 rootH2_100185388 282
5 3300003323 rootH1_10032098 rootH1_100320982 282
6 3300049822 Ga0501035_0451840 Ga0501035_0451840_183_1031 282
7 3300005563 Ga0068855_100708612 Ga0068855_1007086121 286
8 3300013308 Ga0157375_10495804 Ga0157375_104958043 286
9 3300038443 Ga0395901_0726346 Ga0395901_0726346_18_881 286
10 3300031507 Ga0307509_10025440 Ga0307509_100254402 287
11 3300031616 Ga0307508_10004344 Ga0307508_100043443 287
12 3300005338 Ga0068868_100023561 Ga0068868_1000235614 289
13 3300005355 Ga0070671_100049503 Ga0070671_1000495032 289
14 3300005834 Ga0068851_10025961 Ga0068851_100259613 289
15 3300005841 Ga0068863_100015580 Ga0068863_1000155809 289
16 3300025321 Ga0207656_10136885 Ga0207656_101368852 289
17 3300025972 Ga0207668_10389747 Ga0207668_103897471 289
18 3300026023 Ga0207677_10007100 Ga0207677_100071002 289
19 3300026088 Ga0207641_10207516 Ga0207641_102075162 289
20 3300026121 Ga0207683_10247935 Ga0207683_102479351 289
21 3300003354 JGI25160J50197_1005112 JGI25160J50197_10051122 290
22 3300005367 Ga0070667_100007255 Ga0070667_1000072558 290
23 3300005456 Ga0070678_100025666 Ga0070678_1000256664 290
24 3300005616 Ga0068852_100163884 Ga0068852_1001638843 290
25 3300005841 Ga0068863_100052396 Ga0068863_1000523963 290
26 3300006237 Ga0097621_100000018 Ga0097621_10000001870 290
27 3300006358 Ga0068871_100000275 Ga0068871_1000002753 290
28 3300013102 Ga0157371_10002753 Ga0157371_1000275311 290
29 3300013102 Ga0157371_10064314 Ga0157371_100643142 290
30 3300013102 Ga0157371_10155066 Ga0157371_101550662 290
31 3300013102 Ga0157371_10292675 Ga0157371_102926751 290
32 3300013104 Ga0157370_10261607 Ga0157370_102616072 290
33 3300013105 Ga0157369_10031302 Ga0157369_100313026 290
34 3300017792 Ga0163161_10004225 Ga0163161_100042254 290
35 3300025302 Ga0207426_1000392 Ga0207426_100039220 290
36 3300025911 Ga0207654_10264477 Ga0207654_102644771 290
37 3300025931 Ga0207644_10012160 Ga0207644_100121602 290
38 3300025938 Ga0207704_10437549 Ga0207704_104375491 290
39 3300025941 Ga0207711_10095542 Ga0207711_100955422 290
40 3300025986 Ga0207658_10040251 Ga0207658_100402513 290
41 3300026088 Ga0207641_10051999 Ga0207641_100519994 290
42 3300026121 Ga0207683_10038549 Ga0207683_100385494 290
43 3300013307 Ga0157372_10055114 Ga0157372_100551144 292
44 3300026023 Ga0207677_10343340 Ga0207677_103433401 292
45 3300046665 Ga0495661_0011980 Ga0495661_0011980_1205_2089 293
46 3300005288 Ga0065714_10005259 Ga0065714_100052594 294
47 3300025909 Ga0207705_10056512 Ga0207705_100565122 296
48 3300037418 Ga0395900_0050107 Ga0395900_0050107_2088_2981 296
49 3300044712 Ga0453684_0018518 Ga0453684_0018518_8424_9332 299
50 iso_pu_bacteria 2852623160 2852623202 299
51 3300003322 rootL2_10018192 rootL2_100181925 300
52 3300005535 Ga0070684_100014079 Ga0070684_1000140793 300
53 3300005563 Ga0068855_100001370 Ga0068855_10000137022 300
54 3300005616 Ga0068852_100170299 Ga0068852_1001702992 300
55 3300013307 Ga0157372_10037120 Ga0157372_100371202 300
56 3300025913 Ga0207695_10000128 Ga0207695_10000128119 300
57 3300025949 Ga0207667_10001317 Ga0207667_1000131716 300
58 3300026088 Ga0207641_10142545 Ga0207641_101425452 300
59 3300026095 Ga0207676_10185310 Ga0207676_101853102 300
60 3300026142 Ga0207698_10166775 Ga0207698_101667752 300
61 3300035695 Ga0373927_0004569 Ga0373927_0004569_6175_7080 300
62 3300039437 Ga0436365_1577799 Ga0436365_1577799_266_1171 300
63 3300045051 Ga0451576_0004036 Ga0451576_0004036_2074_2982 300
64 3300046543 Ga0495645_0239635 Ga0495645_0239635_186_1091 300
65 iso_pu_bacteria 2818991460 2819679127 300
66 3300005364 Ga0070673_100273782 Ga0070673_1002737822 301
67 3300005843 Ga0068860_100010007 Ga0068860_1000100077 301
68 3300009094 Ga0111539_10049532 Ga0111539_100495322 301
69 3300013102 Ga0157371_10151572 Ga0157371_101515722 301
70 3300013306 Ga0163162_10000728 Ga0163162_1000072812 301
71 3300013307 Ga0157372_10054230 Ga0157372_100542305 301
72 3300013307 Ga0157372_10388521 Ga0157372_103885212 301
73 3300028381 Ga0268264_10020399 Ga0268264_100203994 301
74 3300050511 nmdc:mga08y16_310493_c1 nmdc:mga08y16_310493_c1_606_1514 301
75 iso_pu_bacteria 2884791551 2884795152 301
76 iso_pu_bacteria 2929921140 2929926377 301
77 iso_pu_bacteria 8003151029 8003151741 301
78 3300003316 rootH1_10125285 rootH1_101252852 302
79 3300005289 Ga0065704_10128320 Ga0065704_101283202 302
80 3300005331 Ga0070670_100054188 Ga0070670_1000541882 302
81 3300005334 Ga0068869_100083795 Ga0068869_1000837952 302
82 3300005334 Ga0068869_100122376 Ga0068869_1001223761 302
83 3300005335 Ga0070666_10000152 Ga0070666_1000015254 302
84 3300005335 Ga0070666_10011721 Ga0070666_100117212 302
85 3300005339 Ga0070660_100001201 Ga0070660_10000120110 302
86 3300005347 Ga0070668_100126829 Ga0070668_1001268292 302
87 3300005364 Ga0070673_100016646 Ga0070673_1000166463 302
88 3300005367 Ga0070667_100012206 Ga0070667_1000122063 302
89 3300005367 Ga0070667_100051154 Ga0070667_1000511541 302
90 3300005539 Ga0068853_100047925 Ga0068853_1000479252 302
91 3300005543 Ga0070672_100249178 Ga0070672_1002491781 302
92 3300005548 Ga0070665_100000009 Ga0070665_100000009300 302
93 3300005578 Ga0068854_100267469 Ga0068854_1002674692 302
94 3300005616 Ga0068852_100011190 Ga0068852_1000111902 302
95 3300005616 Ga0068852_100012762 Ga0068852_1000127623 302
96 3300005616 Ga0068852_100029207 Ga0068852_1000292072 302
97 3300005617 Ga0068859_100000026 Ga0068859_10000002642 302
98 3300005617 Ga0068859_100037401 Ga0068859_1000374012 302
99 3300005618 Ga0068864_100003051 Ga0068864_1000030516 302
100 3300005841 Ga0068863_100009621 Ga0068863_1000096214 302
101 3300005842 Ga0068858_100004620 Ga0068858_1000046209 302
102 3300005843 Ga0068860_100003692 Ga0068860_1000036922 302
103 3300005843 Ga0068860_100005422 Ga0068860_1000054229 302
104 3300005843 Ga0068860_100024010 Ga0068860_1000240105 302
105 3300006237 Ga0097621_100013966 Ga0097621_1000139662 302
106 3300006358 Ga0068871_100006329 Ga0068871_1000063292 302
107 3300006358 Ga0068871_100421517 Ga0068871_1004215171 302
108 3300006931 Ga0097620_100000026 Ga0097620_10000002642 302
109 3300006931 Ga0097620_100037401 Ga0097620_1000374012 302
110 3300009093 Ga0105240_10002649 Ga0105240_1000264916 302
111 3300009093 Ga0105240_10010818 Ga0105240_1001081811 302
112 3300009093 Ga0105240_10017519 Ga0105240_100175192 302
113 3300009093 Ga0105240_10192865 Ga0105240_101928652 302
114 3300009094 Ga0111539_10525628 Ga0111539_105256281 302
115 3300009174 Ga0105241_10002882 Ga0105241_1000288212 302
116 3300009174 Ga0105241_10021586 Ga0105241_100215864 302
117 3300009176 Ga0105242_10146483 Ga0105242_101464832 302
118 3300009545 Ga0105237_10007466 Ga0105237_100074663 302
119 3300009545 Ga0105237_10019609 Ga0105237_100196096 302
120 3300009545 Ga0105237_10042630 Ga0105237_100426303 302
121 3300009551 Ga0105238_10006264 Ga0105238_1000626410 302
122 3300009551 Ga0105238_10170528 Ga0105238_101705282 302
123 3300009553 Ga0105249_10000882 Ga0105249_100008821 302
124 3300010375 Ga0105239_10007420 Ga0105239_1000742011 302
125 3300010375 Ga0105239_10058740 Ga0105239_100587403 302
126 3300010375 Ga0105239_10701298 Ga0105239_107012981 302
127 3300011119 Ga0105246_10084761 Ga0105246_100847612 302
128 3300013104 Ga0157370_10033932 Ga0157370_100339324 302
129 3300013105 Ga0157369_10022689 Ga0157369_100226894 302
130 3300013297 Ga0157378_10012965 Ga0157378_100129653 302
131 3300013297 Ga0157378_10067440 Ga0157378_100674403 302
132 3300013297 Ga0157378_10478366 Ga0157378_104783661 302
133 3300013306 Ga0163162_10003091 Ga0163162_1000309114 302
134 3300013306 Ga0163162_10003695 Ga0163162_1000369510 302
135 3300013307 Ga0157372_10000573 Ga0157372_1000057331 302
136 3300013307 Ga0157372_10023196 Ga0157372_100231962 302
137 3300013308 Ga0157375_10145028 Ga0157375_101450282 302
138 3300013308 Ga0157375_10210804 Ga0157375_102108042 302
139 3300014968 Ga0157379_10019249 Ga0157379_100192492 302
140 3300025903 Ga0207680_10002441 Ga0207680_100024414 302
141 3300025903 Ga0207680_10271765 Ga0207680_102717651 302
142 3300025904 Ga0207647_10013261 Ga0207647_100132611 302
143 3300025904 Ga0207647_10143241 Ga0207647_101432412 302
144 3300025911 Ga0207654_10002690 Ga0207654_100026902 302
145 3300025911 Ga0207654_10013730 Ga0207654_100137303 302
146 3300025911 Ga0207654_10028496 Ga0207654_100284962 302
147 3300025912 Ga0207707_10038286 Ga0207707_100382862 302
148 3300025913 Ga0207695_10001712 Ga0207695_1000171230 302
149 3300025913 Ga0207695_10003683 Ga0207695_100036833 302
150 3300025913 Ga0207695_10348026 Ga0207695_103480262 302
151 3300025913 Ga0207695_10369964 Ga0207695_103699641 302
152 3300025914 Ga0207671_10001027 Ga0207671_100010273 302
153 3300025914 Ga0207671_10005214 Ga0207671_100052143 302
154 3300025914 Ga0207671_10018101 Ga0207671_100181012 302
155 3300025919 Ga0207657_10007951 Ga0207657_1000795111 302
156 3300025924 Ga0207694_10013834 Ga0207694_100138342 302
157 3300025924 Ga0207694_10014121 Ga0207694_100141212 302
158 3300025924 Ga0207694_10083020 Ga0207694_100830202 302
159 3300025925 Ga0207650_10101911 Ga0207650_101019112 302
160 3300025938 Ga0207704_10192987 Ga0207704_101929872 302
161 3300025942 Ga0207689_10011065 Ga0207689_100110657 302
162 3300025942 Ga0207689_10374858 Ga0207689_103748582 302
163 3300025949 Ga0207667_10000610 Ga0207667_1000061022 302
164 3300025961 Ga0207712_10006001 Ga0207712_100060012 302
165 3300025986 Ga0207658_10064057 Ga0207658_100640572 302
166 3300026035 Ga0207703_10016603 Ga0207703_100166032 302
167 3300026078 Ga0207702_10317284 Ga0207702_103172841 302
168 3300026088 Ga0207641_10000215 Ga0207641_1000021576 302
169 3300026095 Ga0207676_10004945 Ga0207676_100049458 302
170 3300026116 Ga0207674_10007729 Ga0207674_100077294 302
171 3300026142 Ga0207698_10006881 Ga0207698_100068815 302
172 3300026142 Ga0207698_10009482 Ga0207698_100094823 302
173 3300026142 Ga0207698_10026849 Ga0207698_100268492 302
174 3300028379 Ga0268266_10000014 Ga0268266_10000014372 302
175 3300028381 Ga0268264_10000013 Ga0268264_1000001325 302
176 3300028381 Ga0268264_10000801 Ga0268264_1000080134 302
177 3300028381 Ga0268264_10078086 Ga0268264_100780862 302
178 3300028786 Ga0307517_10153904 Ga0307517_101539042 302
179 3300030521 Ga0307511_10001218 Ga0307511_100012185 302
180 3300042876 Ga0451577_0007737 Ga0451577_0007737_3292_4203 302
181 3300044658 Ga0466972_0000661 Ga0466972_0000661_10487_11395 302
182 3300044712 Ga0453684_0000337 Ga0453684_0000337_146378_147289 302
183 3300044712 Ga0453684_0025954 Ga0453684_0025954_5089_5997 302
184 3300044712 Ga0453684_0548752 Ga0453684_0548752_343_1251 302
185 3300044901 Ga0466960_0006836 Ga0466960_0006836_154_1062 302
186 3300045051 Ga0451576_0141040 Ga0451576_0141040_507_1418 302
187 3300046460 Ga0495638_0033322 Ga0495638_0033322_2325_3245 302
188 3300046523 Ga0495644_0006633 Ga0495644_0006633_1873_2784 302
189 3300047443 Ga0495687_000106 Ga0495687_000106_24007_24915 302
190 3300047472 Ga0495686_0000016 Ga0495686_0000016_182862_183770 302
191 3300049581 Ga0501047_0429615 Ga0501047_0429615_149_1057 302
192 3300049823 Ga0501044_0358795 Ga0501044_0358795_229_1137 302
193 3300050511 nmdc:mga08y16_517069_c1 nmdc:mga08y16_517069_c1_75_983 302
194 3300053092 Ga0500583_0003587 Ga0500583_0003587_3875_4783 302
195 3300053139 Ga0500568_0039153 Ga0500568_0039153_389_1297 302
196 3300053156 Ga0500622_0003372 Ga0500622_0003372_7427_8335 302
197 3300003203 JGI25406J46586_10011756 JGI25406J46586_100117563 303
198 3300003354 JGI25160J50197_1004084 JGI25160J50197_10040844 303
199 3300005334 Ga0068869_100285369 Ga0068869_1002853691 303
200 3300005335 Ga0070666_10242180 Ga0070666_102421801 303
201 3300005338 Ga0068868_100027930 Ga0068868_1000279306 303
202 3300005347 Ga0070668_100037517 Ga0070668_1000375171 303
203 3300005354 Ga0070675_100270634 Ga0070675_1002706342 303
204 3300005356 Ga0070674_100090577 Ga0070674_1000905771 303
205 3300005367 Ga0070667_100220423 Ga0070667_1002204232 303
206 3300005456 Ga0070678_100173863 Ga0070678_1001738632 303
207 3300005543 Ga0070672_100057218 Ga0070672_1000572182 303
208 3300005564 Ga0070664_100257679 Ga0070664_1002576792 303
209 3300005617 Ga0068859_100065816 Ga0068859_1000658162 303
210 3300005718 Ga0068866_10032993 Ga0068866_100329931 303
211 3300005719 Ga0068861_100067355 Ga0068861_1000673554 303
212 3300005719 Ga0068861_100404944 Ga0068861_1004049442 303
213 3300005843 Ga0068860_100110388 Ga0068860_1001103881 303
214 3300005843 Ga0068860_100493940 Ga0068860_1004939401 303
215 3300005985 Ga0081539_10000935 Ga0081539_100009359 303
216 3300006237 Ga0097621_100020490 Ga0097621_1000204902 303
217 3300006358 Ga0068871_100153505 Ga0068871_1001535054 303
218 3300006847 Ga0075431_100000866 Ga0075431_1000008666 303
219 3300006880 Ga0075429_100009709 Ga0075429_1000097096 303
220 3300006881 Ga0068865_100019239 Ga0068865_1000192392 303
221 3300006931 Ga0097620_100065813 Ga0097620_1000658135 303
222 3300009094 Ga0111539_10262126 Ga0111539_102621261 303
223 3300009098 Ga0105245_10086825 Ga0105245_100868254 303
224 3300009147 Ga0114129_10001572 Ga0114129_100015728 303
225 3300009174 Ga0105241_10152041 Ga0105241_101520412 303
226 3300009176 Ga0105242_10040708 Ga0105242_100407085 303
227 3300009176 Ga0105242_10441637 Ga0105242_104416371 303
228 3300013296 Ga0157374_10344929 Ga0157374_103449292 303
229 3300013297 Ga0157378_10222906 Ga0157378_102229062 303
230 3300013306 Ga0163162_10351036 Ga0163162_103510362 303
231 3300013308 Ga0157375_10139406 Ga0157375_101394061 303
232 3300017792 Ga0163161_10191938 Ga0163161_101919382 303
233 3300025302 Ga0207426_1000132 Ga0207426_100013228 303
234 3300025899 Ga0207642_10114074 Ga0207642_101140742 303
235 3300025901 Ga0207688_10048560 Ga0207688_100485602 303
236 3300025903 Ga0207680_10356462 Ga0207680_103564621 303
237 3300025907 Ga0207645_10000693 Ga0207645_100006932 303
238 3300025908 Ga0207643_10013579 Ga0207643_100135794 303
239 3300025923 Ga0207681_10010297 Ga0207681_100102972 303
240 3300025925 Ga0207650_10221490 Ga0207650_102214902 303
241 3300025926 Ga0207659_10028420 Ga0207659_100284205 303
242 3300025942 Ga0207689_10031331 Ga0207689_100313314 303
243 3300025942 Ga0207689_10088520 Ga0207689_100885203 303
244 3300025945 Ga0207679_10199141 Ga0207679_101991412 303
245 3300025960 Ga0207651_10211673 Ga0207651_102116732 303
246 3300025972 Ga0207668_10414880 Ga0207668_104148801 303
247 3300026089 Ga0207648_10001098 Ga0207648_1000109820 303
248 3300026118 Ga0207675_100069989 Ga0207675_1000699893 303
249 3300026121 Ga0207683_10000597 Ga0207683_100005976 303
250 3300028379 Ga0268266_10101154 Ga0268266_101011543 303
251 3300028380 Ga0268265_10043616 Ga0268265_100436163 303
252 3300028381 Ga0268264_10188616 Ga0268264_101886163 303
253 3300031456 Ga0307513_10267190 Ga0307513_102671902 303
254 3300031712 Ga0265342_10136497 Ga0265342_101364971 303
255 3300050508 nmdc:mga09592_38049_c1 nmdc:mga09592_38049_c1_1255_2172 303
256 3300050510 nmdc:mga06r32_9671_c1 nmdc:mga06r32_9671_c1_3704_4621 303
257 3300050511 nmdc:mga08y16_644640_c1 nmdc:mga08y16_644640_c1_68_982 303
258 3300001989 JGI24739J22299_10010107 JGI24739J22299_100101074 304
259 3300003354 JGI25160J50197_1001334 JGI25160J50197_10013343 304
260 3300005355 Ga0070671_100157516 Ga0070671_1001575161 304
261 3300005616 Ga0068852_100118070 Ga0068852_1001180702 304
262 3300009093 Ga0105240_10398377 Ga0105240_103983772 304
263 3300013306 Ga0163162_10051073 Ga0163162_100510732 304
264 3300014325 Ga0163163_10395244 Ga0163163_103952442 304
265 3300025913 Ga0207695_10354230 Ga0207695_103542301 304
266 3300025931 Ga0207644_10103486 Ga0207644_101034861 304
267 3300026142 Ga0207698_10107235 Ga0207698_101072352 304
268 3300026142 Ga0207698_10330011 Ga0207698_103300112 304
269 3300001979 JGI24740J21852_10000312 JGI24740J21852_100003123 305
270 3300001989 JGI24739J22299_10041138 JGI24739J22299_100411382 305
271 3300002738 JGI25154J39366_1000016 JGI25154J39366_1000016180 305
272 3300002741 JGI25157J39369_1002846 JGI25157J39369_10028462 305
273 3300003354 JGI25160J50197_1003921 JGI25160J50197_10039215 305
274 3300005262 Ga0065165_1021969 Ga0065165_10219692 305
275 3300005327 Ga0070658_10047699 Ga0070658_100476992 305
276 3300005327 Ga0070658_10047756 Ga0070658_100477562 305
277 3300005327 Ga0070658_10282697 Ga0070658_102826972 305
278 3300005334 Ga0068869_100259347 Ga0068869_1002593472 305
279 3300005336 Ga0070680_100015020 Ga0070680_1000150208 305
280 3300005339 Ga0070660_100002765 Ga0070660_10000276510 305
281 3300005339 Ga0070660_100020641 Ga0070660_1000206415 305
282 3300005339 Ga0070660_100153650 Ga0070660_1001536502 305
283 3300005345 Ga0070692_10018053 Ga0070692_100180535 305
284 3300005366 Ga0070659_100079156 Ga0070659_1000791562 305
285 3300005367 Ga0070667_100047439 Ga0070667_1000474392 305
286 3300005367 Ga0070667_100290958 Ga0070667_1002909582 305
287 3300005455 Ga0070663_100009188 Ga0070663_1000091882 305
288 3300005458 Ga0070681_10008321 Ga0070681_100083216 305
289 3300005459 Ga0068867_100223440 Ga0068867_1002234401 305
290 3300005530 Ga0070679_100023038 Ga0070679_1000230383 305
291 3300005530 Ga0070679_100023837 Ga0070679_1000238376 305
292 3300005530 Ga0070679_100266919 Ga0070679_1002669192 305
293 3300005539 Ga0068853_100051932 Ga0068853_1000519324 305
294 3300005563 Ga0068855_100006679 Ga0068855_10000667911 305
295 3300005577 Ga0068857_100269273 Ga0068857_1002692732 305
296 3300005578 Ga0068854_100088298 Ga0068854_1000882981 305
297 3300005614 Ga0068856_100005474 Ga0068856_10000547415 305
298 3300005616 Ga0068852_100407560 Ga0068852_1004075601 305
299 3300005617 Ga0068859_100055156 Ga0068859_1000551562 305
300 3300005618 Ga0068864_100059456 Ga0068864_1000594563 305
301 3300005840 Ga0068870_10254507 Ga0068870_102545071 305
302 3300005843 Ga0068860_100003506 Ga0068860_1000035062 305
303 3300005844 Ga0068862_100038073 Ga0068862_1000380732 305
304 3300006881 Ga0068865_100244173 Ga0068865_1002441731 305
305 3300006931 Ga0097620_100055155 Ga0097620_1000551552 305
306 3300009177 Ga0105248_10125639 Ga0105248_101256392 305
307 3300009545 Ga0105237_10013943 Ga0105237_100139435 305
308 3300010375 Ga0105239_10311360 Ga0105239_103113603 305
309 3300013100 Ga0157373_10009386 Ga0157373_100093865 305
310 3300013100 Ga0157373_10062724 Ga0157373_100627241 305
311 3300013100 Ga0157373_10163444 Ga0157373_101634442 305
312 3300013102 Ga0157371_10001463 Ga0157371_1000146322 305
313 3300013102 Ga0157371_10003752 Ga0157371_1000375213 305
314 3300013102 Ga0157371_10004344 Ga0157371_100043449 305
315 3300013102 Ga0157371_10030737 Ga0157371_100307372 305
316 3300013102 Ga0157371_10049663 Ga0157371_100496632 305
317 3300013104 Ga0157370_10000716 Ga0157370_1000071619 305
318 3300013104 Ga0157370_10002309 Ga0157370_1000230919 305
319 3300013104 Ga0157370_10051288 Ga0157370_100512882 305
320 3300013105 Ga0157369_10007187 Ga0157369_1000718712 305
321 3300013105 Ga0157369_10054343 Ga0157369_100543432 305
322 3300013105 Ga0157369_10218756 Ga0157369_102187561 305
323 3300013297 Ga0157378_10185775 Ga0157378_101857752 305
324 3300013306 Ga0163162_10026074 Ga0163162_100260744 305
325 3300013306 Ga0163162_10095899 Ga0163162_100958993 305
326 3300013306 Ga0163162_10173620 Ga0163162_101736202 305
327 3300013307 Ga0157372_10007880 Ga0157372_100078805 305
328 3300013307 Ga0157372_10018412 Ga0157372_100184127 305
329 3300013307 Ga0157372_10102333 Ga0157372_101023331 305
330 3300013307 Ga0157372_10332838 Ga0157372_103328382 305
331 3300013308 Ga0157375_10034613 Ga0157375_100346133 305
332 3300014326 Ga0157380_10005484 Ga0157380_100054843 305
333 3300014969 Ga0157376_10000076 Ga0157376_1000007643 305
334 3300014969 Ga0157376_10156986 Ga0157376_101569862 305
335 3300014969 Ga0157376_10598266 Ga0157376_105982661 305
336 3300025246 Ga0209646_1000003 Ga0209646_1000003181 305
337 3300025250 Ga0209026_1000333 Ga0209026_100033320 305
338 3300025258 Ga0209129_1008402 Ga0209129_10084022 305
339 3300025302 Ga0207426_1000277 Ga0207426_100027727 305
340 3300025909 Ga0207705_10002684 Ga0207705_1000268413 305
341 3300025912 Ga0207707_10003340 Ga0207707_100033404 305
342 3300025912 Ga0207707_10047856 Ga0207707_100478562 305
343 3300025912 Ga0207707_10326783 Ga0207707_103267831 305
344 3300025917 Ga0207660_10004403 Ga0207660_100044033 305
345 3300025917 Ga0207660_10165806 Ga0207660_101658061 305
346 3300025919 Ga0207657_10006445 Ga0207657_1000644510 305
347 3300025919 Ga0207657_10070608 Ga0207657_100706083 305
348 3300025919 Ga0207657_10185754 Ga0207657_101857542 305
349 3300025921 Ga0207652_10000546 Ga0207652_1000054626 305
350 3300025921 Ga0207652_10001149 Ga0207652_1000114915 305
351 3300025921 Ga0207652_10012635 Ga0207652_100126357 305
352 3300025921 Ga0207652_10036266 Ga0207652_100362664 305
353 3300025921 Ga0207652_10049897 Ga0207652_100498973 305
354 3300025944 Ga0207661_10016451 Ga0207661_100164513 305
355 3300025944 Ga0207661_10362468 Ga0207661_103624682 305
356 3300025949 Ga0207667_10001143 Ga0207667_1000114325 305
357 3300025949 Ga0207667_10020059 Ga0207667_100200598 305
358 3300025981 Ga0207640_10119236 Ga0207640_101192362 305
359 3300025981 Ga0207640_10123583 Ga0207640_101235831 305
360 3300026023 Ga0207677_10287461 Ga0207677_102874612 305
361 3300026067 Ga0207678_10012570 Ga0207678_100125708 305
362 3300026078 Ga0207702_10007728 Ga0207702_100077285 305
363 3300026089 Ga0207648_10101786 Ga0207648_101017862 305
364 3300026116 Ga0207674_10046895 Ga0207674_100468952 305
365 3300028380 Ga0268265_10039508 Ga0268265_100395082 305
366 3300028381 Ga0268264_10070289 Ga0268264_100702892 305
367 3300032004 Ga0307414_10058611 Ga0307414_100586112 305
368 3300037312 Ga0395899_0005291 Ga0395899_0005291_6309_7229 305
369 3300037312 Ga0395899_0005294 Ga0395899_0005294_2917_3837 305
370 3300037312 Ga0395899_0125660 Ga0395899_0125660_252_1172 305
371 3300037418 Ga0395900_0046358 Ga0395900_0046358_1393_2313 305
372 3300037418 Ga0395900_0194005 Ga0395900_0194005_146_1066 305
373 3300037418 Ga0395900_0272595 Ga0395900_0272595_228_1148 305
374 3300037418 Ga0395900_0306176 Ga0395900_0306176_632_1552 305
375 3300037466 Ga0395898_0001279 Ga0395898_0001279_3986_4906 305
376 3300037466 Ga0395898_0009578 Ga0395898_0009578_7518_8438 305
377 3300037466 Ga0395898_0056750 Ga0395898_0056750_274_1194 305
378 3300037466 Ga0395898_0294098 Ga0395898_0294098_23_943 305
379 3300038443 Ga0395901_0015212 Ga0395901_0015212_4143_5063 305
380 3300038443 Ga0395901_0049204 Ga0395901_0049204_2698_3618 305
381 3300038443 Ga0395901_0120556 Ga0395901_0120556_1120_2040 305
382 3300048903 Ga0496100_0070252 Ga0496100_0070252_1309_2226 305
383 3300049586 Ga0501070_0048805 Ga0501070_0048805_15_938 305
384 3300049823 Ga0501044_0374107 Ga0501044_0374107_276_1193 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

99

347

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8352 34 282
3l23-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8326 34 302
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8277 30 301
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8173 34 282
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8162 30 301
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8017 30 301 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.797 34 302 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7775 34 302 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7769 36 303 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7658 29 303 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4V3GL00-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9873 33 305 GO:0016853
AF-A0A4Q5ZF10-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9641 116 305 GO:0016853
AF-A0A7T5EXH1-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9484 35 304 GO:0016853
AF-A0A1F3PAY2-F1-model_v4 Xylose isomerase 0.9468 8 305 GO:0016853
AF-A0A4V3GL00-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9457 33 305 GO:0016853

Feature Viewer

pLDDT pTM Quality
88.49 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map