F429713

General Info

Members Datasets Scaffolds Average Seq Length
383 228 378 236

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0161103|Ga0496111_0161103_419_1216
Length 265
Sequence MSQLHYLPLHPVFFAILVGLFILLVVLIQIGILRYAYMRLGVSSRVALLLLLASLIGSYFNIPVAVLPEQHILSGQEIGYFGMLHMVPIVIDWPGTVIAVNVGGALIPTLVSLYLLAKNHLWALGILATACVAALCHWLAEPVPGLGIALPIFVPAIATAIVALILSRQYAAPLAYVGGSLGTLIGADLLNLDRIQGLGAPVASIGGAGTFDGIFVTAILAVLIASIRLVPLGTRAVQPMPXXXAAPLSAQGPYHAPQNDHSPLS

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
5 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
220 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
221 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
222 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
227 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
228 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.13
Nodule 1.04
Rhizoplane 9.4
Rhizosphere 82.25
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10218548 3300003323 Bacteria 1232
2 Ga0070658_10063643 3300005327 Bacteria 3008
3 Ga0070683_100173220 3300005329 Bacteria 2049
4 Ga0070683_100652044 3300005329 Unclassified 1008
5 Ga0070680_100118920 3300005336 Bacteria 2204
6 Ga0070660_100063689 3300005339 Bacteria 2866
7 Ga0070660_100068472 3300005339 Bacteria 2767
8 Ga0070691_10117663 3300005341 Bacteria 1335
9 Ga0070675_100195236 3300005354 Unclassified 1755
10 Ga0070673_100212960 3300005364 Bacteria 1670
11 Ga0070688_100188129 3300005365 Unclassified 1436
12 Ga0070667_100450692 3300005367 Unclassified 1176
13 Ga0070709_10000966 3300005434 Bacteria 15959
14 Ga0070709_10015827 3300005434 Bacteria 4294
15 Ga0070709_10247447 3300005434 Bacteria 1283
16 Ga0070714_100080973 3300005435 Bacteria 2826
17 Ga0070714_100088770 3300005435 Bacteria 2705
18 Ga0070714_100706478 3300005435 Bacteria 973
19 Ga0070713_100001630 3300005436 Bacteria 14401
20 Ga0070713_100074907 3300005436 Bacteria 2869
21 Ga0070713_100100412 3300005436 Bacteria 2505
22 Ga0070713_100228985 3300005436 Bacteria 1689
23 Ga0070713_100543084 3300005436 Bacteria 1100
24 Ga0070713_100956469 3300005436 Bacteria 825
25 Ga0070710_10001140 3300005437 Bacteria 12598
26 Ga0070710_10021639 3300005437 Bacteria 3355
27 Ga0070710_10040188 3300005437 Bacteria 2578
28 Ga0070711_100007241 3300005439 Bacteria 6741
29 Ga0070711_100096434 3300005439 Bacteria 2142
30 Ga0070708_100054352 3300005445 Bacteria 3556
31 Ga0070662_100088979 3300005457 Bacteria 2315
32 Ga0070685_10035384 3300005466 Unclassified 2817
33 Ga0070698_100109364 3300005471 Bacteria 2731
34 Ga0070679_100020373 3300005530 Bacteria 6465
35 Ga0070679_100366916 3300005530 Bacteria 1387
36 Ga0070684_100010374 3300005535 Bacteria 7376
37 Ga0070684_100105662 3300005535 Bacteria 2520
38 Ga0070697_100132511 3300005536 Bacteria 2091
39 Ga0068853_100086367 3300005539 Bacteria 2751
40 Ga0068853_100675475 3300005539 Bacteria 984
41 Ga0070665_100141863 3300005548 Bacteria 2405
42 Ga0068855_100099429 3300005563 Bacteria 3351
43 Ga0070664_100242014 3300005564 Bacteria 1620
44 Ga0068857_100012078 3300005577 Bacteria 7509
45 Ga0068856_100136692 3300005614 Bacteria 2456
46 Ga0068856_100481513 3300005614 Bacteria 1262
47 Ga0070702_100073299 3300005615 Unclassified 2028
48 Ga0068852_100129409 3300005616 Bacteria 2323
49 Ga0068859_100210314 3300005617 Bacteria 2031
50 Ga0068851_10003413 3300005834 Bacteria 7076
51 Ga0081455_10011516 3300005937 Bacteria 8882
52 Ga0081455_10310202 3300005937 Bacteria 1128
53 Ga0081540_1009372 3300005983 Bacteria 6751
54 Ga0081540_1013067 3300005983 Bacteria 5422
55 Ga0070717_10002647 3300006028 Bacteria 12607
56 Ga0070717_10008357 3300006028 Bacteria 7730
57 Ga0070717_10705112 3300006028 Bacteria 917
58 Ga0075365_10198218 3300006038 Unclassified 1406
59 Ga0070715_10001552 3300006163 Bacteria 6727
60 Ga0070715_10052471 3300006163 Bacteria 1759
61 Ga0070715_10063861 3300006163 Bacteria 1624
62 Ga0070716_100000901 3300006173 Bacteria 12845
63 Ga0070712_100052532 3300006175 Bacteria 2842
64 Ga0070712_100079075 3300006175 Bacteria 2376
65 Ga0070712_100495859 3300006175 Bacteria 1023
66 Ga0075367_10107680 3300006178 Bacteria 1708
67 Ga0068871_100184816 3300006358 Unclassified 1793
68 Ga0075433_10047963 3300006852 Bacteria 3715
69 Ga0075434_100008452 3300006871 Bacteria 9574
70 Ga0075434_100036432 3300006871 Bacteria 4866
71 Ga0075434_100053745 3300006871 Bacteria 4002
72 Ga0068865_100016323 3300006881 Bacteria 4750
73 Ga0097620_100210320 3300006931 Bacteria 2031
74 Ga0099794_10040902 3300007265 Bacteria 2206
75 Ga0099794_10243912 3300007265 Bacteria 926
76 Ga0099795_10011628 3300007788 Bacteria 2639
77 Ga0099795_10053064 3300007788 Bacteria 1483
78 Ga0105240_10056837 3300009093 Bacteria 4894
79 Ga0111539_10195842 3300009094 Bacteria 2357
80 Ga0105247_10039066 3300009101 Bacteria 2899
81 Ga0105241_10089316 3300009174 Unclassified 2427
82 Ga0105237_10018938 3300009545 Bacteria 7115
83 Ga0105237_10239654 3300009545 Bacteria 1815
84 Ga0105238_10353172 3300009551 Bacteria 1459
85 Ga0099796_10092359 3300010159 Unclassified 1127
86 Ga0105239_10123514 3300010375 Bacteria 2876
87 Ga0157369_10015454 3300013105 Bacteria 8601
88 Ga0157369_10477225 3300013105 Bacteria 1291
89 Ga0157369_10528933 3300013105 Bacteria 1219
90 Ga0157369_10562320 3300013105 Bacteria 1178
91 Ga0157369_10751308 3300013105 Bacteria 1003
92 Ga0157374_10019749 3300013296 Bacteria 5969
93 Ga0157375_10202569 3300013308 Bacteria 2141
94 Ga0163161_10050854 3300017792 Bacteria 3000
95 Ga0213871_10006382 3300021441 Bacteria 2491
96 Ga0207692_10008021 3300025898 Bacteria 4356
97 Ga0207692_10010904 3300025898 Bacteria 3846
98 Ga0207692_10017974 3300025898 Bacteria 3165
99 Ga0207692_10080297 3300025898 Bacteria 1742
100 Ga0207685_10001293 3300025905 Bacteria 5130
101 Ga0207685_10117171 3300025905 Bacteria 1163
102 Ga0207699_10005032 3300025906 Bacteria 6320
103 Ga0207699_10006017 3300025906 Bacteria 5839
104 Ga0207699_10040636 3300025906 Bacteria 2681
105 Ga0207699_10224782 3300025906 Bacteria 1283
106 Ga0207699_10571213 3300025906 Bacteria 822
107 Ga0207643_10000985 3300025908 Bacteria 17067
108 Ga0207707_10120811 3300025912 Bacteria 2291
109 Ga0207671_10290274 3300025914 Bacteria 1291
110 Ga0207693_10000633 3300025915 Bacteria 31452
111 Ga0207693_10007738 3300025915 Bacteria 8819
112 Ga0207693_10060954 3300025915 Bacteria 2955
113 Ga0207693_10138332 3300025915 Bacteria 1915
114 Ga0207693_10447148 3300025915 Bacteria 1010
115 Ga0207663_10000269 3300025916 Bacteria 22512
116 Ga0207663_10014017 3300025916 Bacteria 4376
117 Ga0207663_10290727 3300025916 Bacteria 1217
118 Ga0207660_10125214 3300025917 Bacteria 1950
119 Ga0207657_10002081 3300025919 Bacteria 21643
120 Ga0207657_10055819 3300025919 Bacteria 3410
121 Ga0207652_10002442 3300025921 Bacteria 15688
122 Ga0207652_10043300 3300025921 Bacteria 3834
123 Ga0207646_10203290 3300025922 Bacteria 1789
124 Ga0207694_10010525 3300025924 Bacteria 6978
125 Ga0207659_10348915 3300025926 Unclassified 1227
126 Ga0207700_10004784 3300025928 Bacteria 8032
127 Ga0207700_10072070 3300025928 Bacteria 2663
128 Ga0207700_10077164 3300025928 Bacteria 2587
129 Ga0207700_10160418 3300025928 Bacteria 1867
130 Ga0207700_10499409 3300025928 Bacteria 1076
131 Ga0207664_10173861 3300025929 Bacteria 1845
132 Ga0207664_10413754 3300025929 Bacteria 1200
133 Ga0207706_10007127 3300025933 Bacteria 10350
134 Ga0207665_10001353 3300025939 Bacteria 16516
135 Ga0207665_10011107 3300025939 Bacteria 5907
136 Ga0207665_10017696 3300025939 Bacteria 4684
137 Ga0207665_10234959 3300025939 Bacteria 1349
138 Ga0207691_10011142 3300025940 Bacteria 8629
139 Ga0207689_10016241 3300025942 Bacteria 6306
140 Ga0207661_10060090 3300025944 Bacteria 3065
141 Ga0207679_10218678 3300025945 Bacteria 1602
142 Ga0207668_10093789 3300025972 Bacteria 2212
143 Ga0207640_10265865 3300025981 Unclassified 1339
144 Ga0207639_10270481 3300026041 Bacteria 1490
145 Ga0207678_10022397 3300026067 Bacteria 5533
146 Ga0207678_10039727 3300026067 Bacteria 4082
147 Ga0207708_10025111 3300026075 Bacteria 4506
148 Ga0207702_10199986 3300026078 Bacteria 1851
149 Ga0207641_10183481 3300026088 Bacteria 1918
150 Ga0207676_10083805 3300026095 Bacteria 2597
151 Ga0207674_10012739 3300026116 Bacteria 9394
152 Ga0207674_10070512 3300026116 Bacteria 3514
153 Ga0207674_10098446 3300026116 Bacteria 2908
154 Ga0207683_10184891 3300026121 Bacteria 1890
155 Ga0207698_10283637 3300026142 Unclassified 1533
156 Ga0207698_10333758 3300026142 Bacteria 1425
157 Ga0207428_10316901 3300027907 Bacteria 1152
158 Ga0268266_10143014 3300028379 Unclassified 2148
159 Ga0268264_10042740 3300028381 Bacteria 3752
160 Ga0265330_10026842 3300031235 Bacteria 2603
161 Ga0265340_10022620 3300031247 Bacteria 3213
162 Ga0265339_10000755 3300031249 Bacteria 24978
163 Ga0265331_10025422 3300031250 Bacteria 2989
164 Ga0265316_10115409 3300031344 Bacteria 2030
165 Ga0265316_10152902 3300031344 Bacteria 1728
166 Ga0316579_10096532 3300031691 Bacteria 1413
167 Ga0265314_10003561 3300031711 Bacteria 15025
168 Ga0265314_10126632 3300031711 Bacteria 1599
169 Ga0316578_10214107 3300031728 Bacteria 1159
170 Ga0316578_10217456 3300031728 Bacteria 1149
171 Ga0373926_0127274 3300035083 Unclassified 963
172 Ga0373934_0149738 3300035086 Bacteria 955
173 Ga0373923_0011237 3300035111 Bacteria 3278
174 Ga0373936_0006481 3300035113 Bacteria 4414
175 Ga0373953_0001632 3300035117 Bacteria 6572
176 Ga0373954_0137433 3300035118 Bacteria 1191
177 Ga0373954_0198879 3300035118 Bacteria 984
178 Ga0373956_0014586 3300035119 Bacteria 3285
179 Ga0373943_0015156 3300035170 Bacteria 3499
180 Ga0373946_0167135 3300035171 Unclassified 1036
181 Ga0373955_0000905 3300035172 Bacteria 12753
182 Ga0373955_0161884 3300035172 Bacteria 1321
183 Ga0373924_0165332 3300035410 Bacteria 971
184 Ga0373931_0073380 3300035691 Bacteria 1873
185 Ga0373935_0000658 3300035692 Bacteria 18225
186 Ga0373935_0043252 3300035692 Bacteria 2834
187 Ga0373927_0000560 3300035695 Bacteria 28343
188 Ga0373927_0301998 3300035695 Bacteria 1053
189 Ga0373933_0000306 3300035724 Bacteria 31653
190 Ga0373947_0000914 3300035725 Bacteria 17909
191 Ga0373937_0017861 3300036401 Bacteria 6329
192 Ga0373937_0149744 3300036401 Bacteria 2185
193 Ga0373937_1410137 3300036401 Bacteria 644
194 Ga0316582_0120939 3300036647 Bacteria 1752
195 Ga0316584_0041639 3300036712 Bacteria 3424
196 Ga0316584_0168688 3300036712 Bacteria 1625
197 Ga0373925_0023747 3300037068 Bacteria 4473
198 Ga0373925_0055273 3300037068 Bacteria 2971
199 Ga0373925_0084221 3300037068 Bacteria 2423
200 Ga0395899_0315352 3300037312 Bacteria 1055
201 Ga0395898_0004788 3300037466 Bacteria 14726
202 Ga0395898_0068695 3300037466 Bacteria 3429
203 Ga0395898_0396327 3300037466 Bacteria 1316
204 Ga0395905_0102903 3300037471 Bacteria 2681
205 Ga0395905_0157588 3300037471 Bacteria 2135
206 Ga0436364_0368839 3300037853 Bacteria 1770
207 Ga0395901_0088180 3300038443 Bacteria 3245
208 Ga0395901_0259719 3300038443 Bacteria 1808
209 Ga0395901_0851365 3300038443 Bacteria 897
210 Ga0436365_0489864 3300039437 Bacteria 1601
211 Ga0436360_0059027 3300039438 Bacteria 1999
212 Ga0436360_0593177 3300039438 Bacteria 8673
213 Ga0436360_0787642 3300039438 Unclassified 2866
214 Ga0436360_0906461 3300039438 Bacteria 1561
215 Ga0436361_0173880 3300039447 Bacteria 931
216 Ga0436361_0365689 3300039447 Bacteria 1773
217 Ga0436361_0543762 3300039447 Bacteria 1835
218 Ga0436361_0904891 3300039447 Unclassified 2696
219 Ga0436361_0942550 3300039447 Bacteria 1155
220 Ga0436361_1118557 3300039447 Bacteria 2355
221 Ga0436363_0146568 3300039450 Bacteria 12955
222 Ga0436363_0241028 3300039450 Bacteria 7901
223 Ga0436363_0327968 3300039450 Bacteria 10773
224 Ga0436362_0431217 3300039453 Bacteria 2352
225 Ga0436362_0854034 3300039453 Bacteria 1522
226 Ga0436362_1181921 3300039453 Bacteria 801
227 Ga0451849_0568822 3300041505 Bacteria 664
228 Ga0451853_2679962 3300041512 Bacteria 1735
229 Ga0466966_0016226 3300044684 Bacteria 4924
230 Ga0466966_0148845 3300044684 Bacteria 1429
231 Ga0466963_0046665 3300044694 Bacteria 2857
232 Ga0466959_0054797 3300045049 Bacteria 2912
233 Ga0466959_0111174 3300045049 Bacteria 1955
234 Ga0466967_0024990 3300045976 Bacteria 4919
235 Ga0495592_0048892 3300046454 Bacteria 3144
236 Ga0495603_0000351 3300046455 Bacteria 24737
237 Ga0495629_0000114 3300046459 Bacteria 72778
238 Ga0495629_0000250 3300046459 Bacteria 46648
239 Ga0495641_0002106 3300046461 Bacteria 16067
240 Ga0495651_0044089 3300046462 Bacteria 3457
241 Ga0495653_0003601 3300046463 Bacteria 12491
242 Ga0495653_0052650 3300046463 Bacteria 3119
243 Ga0495653_0060035 3300046463 Bacteria 2882
244 Ga0495653_0402054 3300046463 Unclassified 870
245 Ga0495580_0000536 3300046472 Bacteria 32045
246 Ga0495582_0000021 3300046473 Bacteria 88264
247 Ga0495639_0000030 3300046475 Bacteria 65832
248 Ga0495662_0000399 3300046476 Bacteria 19430
249 Ga0495662_0011408 3300046476 Bacteria 4342
250 Ga0495664_0000327 3300046477 Bacteria 22936
251 Ga0495664_0012945 3300046477 Bacteria 4729
252 Ga0495664_0070551 3300046477 Bacteria 2086
253 Ga0495594_0000153 3300046499 Bacteria 32752
254 Ga0495608_0001813 3300046511 Bacteria 15258
255 Ga0495618_0004177 3300046514 Bacteria 8913
256 Ga0495618_0012615 3300046514 Bacteria 5134
257 Ga0495618_0249646 3300046514 Bacteria 1113
258 Ga0495628_0005957 3300046516 Bacteria 10669
259 Ga0495630_0020430 3300046517 Bacteria 4883
260 Ga0495648_0000325 3300046524 Bacteria 52966
261 Ga0495666_0006341 3300046526 Bacteria 5954
262 Ga0495652_0004675 3300046529 Bacteria 13061
263 Ga0495652_0046089 3300046529 Bacteria 3744
264 Ga0495665_0000066 3300046531 Bacteria 43565
265 Ga0495640_0002049 3300046533 Bacteria 16077
266 Ga0495640_0010141 3300046533 Bacteria 7302
267 Ga0495640_0158158 3300046533 Bacteria 1453
268 Ga0495586_0016818 3300046535 Bacteria 3893
269 Ga0495645_0001032 3300046543 Bacteria 18963
270 Ga0495645_0015055 3300046543 Bacteria 5495
271 Ga0495645_0049510 3300046543 Bacteria 3060
272 Ga0495622_0008290 3300046557 Bacteria 4813
273 Ga0495656_0120708 3300046615 Bacteria 1237
274 Ga0495634_0000336 3300046642 Bacteria 45375
275 Ga0495634_0012496 3300046642 Bacteria 6143
276 Ga0495634_0153170 3300046642 Bacteria 1457
277 Ga0495635_0000318 3300046663 Bacteria 31064
278 Ga0495635_0002051 3300046663 Bacteria 13650
279 Ga0495635_0011993 3300046663 Bacteria 6073
280 Ga0495588_0015477 3300046674 Bacteria 3672
281 Ga0495657_0002559 3300046675 Bacteria 15255
282 Ga0495599_0135870 3300046678 Bacteria 1526
283 Ga0495599_0152311 3300046678 Bacteria 1431
284 Ga0495623_0069561 3300046679 Bacteria 2193
285 Ga0495646_0003963 3300046680 Bacteria 9260
286 Ga0495646_0121534 3300046680 Bacteria 1477
287 Ga0495647_0000764 3300046681 Bacteria 9573
288 Ga0495658_0000400 3300046683 Bacteria 24322
289 Ga0495613_0001286 3300046689 Bacteria 19153
290 Ga0495613_0046616 3300046689 Bacteria 3205
291 Ga0495624_0000736 3300046690 Bacteria 25747
292 Ga0495624_0105481 3300046690 Bacteria 1734
293 Ga0495671_0197119 3300046692 Unclassified 977
294 Ga0495600_0000883 3300046809 Bacteria 16030
295 Ga0495600_0033028 3300046809 Bacteria 3359
296 Ga0495581_0000047 3300047315 Bacteria 45397
297 Ga0495581_0266863 3300047315 Bacteria 1001
298 Ga0495674_0000101 3300047319 Bacteria 62646
299 Ga0495674_0010178 3300047319 Bacteria 8910
300 Ga0495674_0046999 3300047319 Bacteria 3829
301 Ga0495674_0072385 3300047319 Bacteria 2973
302 Ga0495672_0091099 3300047320 Bacteria 1674
303 Ga0495676_0031309 3300047321 Bacteria 4501
304 Ga0495680_0000944 3300047322 Bacteria 32310
305 Ga0495680_0059732 3300047322 Bacteria 2942
306 Ga0495684_0000841 3300047471 Bacteria 24812
307 Ga0495684_0030481 3300047471 Bacteria 4141
308 Ga0495593_0000466 3300047673 Bacteria 22750
309 Ga0495593_0010587 3300047673 Bacteria 5320
310 Ga0495593_0235826 3300047673 Unclassified 917
311 Ga0495602_0068707 3300048088 Bacteria 3041
312 Ga0495602_0297927 3300048088 Bacteria 1181
313 Ga0495614_0010575 3300048089 Bacteria 4069
314 Ga0496100_0102072 3300048903 Bacteria 1978
315 Ga0496102_0059298 3300048905 Bacteria 3500
316 Ga0496102_0506459 3300048905 Unclassified 1129
317 Ga0496102_0554167 3300048905 Bacteria 1072
318 Ga0496103_0003792 3300048906 Bacteria 9196
319 Ga0496104_0493011 3300048907 Bacteria 1136
320 Ga0496105_0015599 3300048908 Bacteria 6058
321 Ga0496105_0203616 3300048908 Bacteria 1615
322 Ga0496105_0415770 3300048908 Bacteria 1065
323 Ga0496106_0004787 3300048909 Bacteria 10010
324 Ga0496106_0224745 3300048909 Bacteria 1497
325 Ga0496107_0000229 3300048910 Bacteria 29677
326 Ga0496107_0131784 3300048910 Bacteria 1845
327 Ga0496108_0000419 3300048911 Bacteria 34761
328 Ga0496108_0215448 3300048911 Bacteria 1667
329 Ga0496108_0359455 3300048911 Bacteria 1271
330 Ga0496109_0000901 3300048912 Bacteria 24745
331 Ga0496109_0300515 3300048912 Bacteria 1513
332 Ga0496110_0008671 3300048913 Bacteria 8189
333 Ga0496110_0072766 3300048913 Bacteria 3050
334 Ga0496110_0077628 3300048913 Bacteria 2955
335 Ga0496110_0216404 3300048913 Bacteria 1742
336 Ga0496111_0145226 3300048914 Bacteria 1758
337 Ga0496111_0161103 3300048914 Bacteria 1666
338 Ga0496112_0001990 3300048915 Bacteria 16161
339 Ga0496112_0022764 3300048915 Bacteria 5978
340 Ga0496112_0126966 3300048915 Bacteria 2521
341 Ga0496112_0212678 3300048915 Bacteria 1890
342 Ga0496112_0277110 3300048915 Bacteria 1625
343 Ga0496112_0290283 3300048915 Bacteria 1581
344 Ga0496112_1366683 3300048915 Bacteria 623
345 Ga0496113_0115110 3300048916 Bacteria 2097
346 Ga0496113_0566652 3300048916 Bacteria 910
347 Ga0496115_0186623 3300048918 Bacteria 1713
348 Ga0496115_0268709 3300048918 Unclassified 1401
349 Ga0496115_0333341 3300048918 Bacteria 1239
350 Ga0496117_0030360 3300048920 Bacteria 4150
351 Ga0496119_0217982 3300048922 Bacteria 978
352 Ga0496121_0000194 3300048924 Bacteria 136324
353 Ga0496124_0327288 3300048927 Bacteria 1094
354 Ga0496126_0008263 3300048929 Bacteria 11239
355 Ga0496126_0069352 3300048929 Bacteria 3145
356 Ga0496126_0499674 3300048929 Bacteria 972
357 nmdc:mga08y16_157686_c1 3300050511 Bacteria 2359
358 nmdc:mga0n895_368425_c1 3300050512 Bacteria 1454
359 nmdc:mga0n895_6061_c1 3300050512 Bacteria 10193
360 nmdc:mga0n895_89788_c1 3300050512 Bacteria 3074
361 nmdc:mga0a205_26131_c1 3300050515 Bacteria 5562
362 Ga0495601_0012792 3300053077 Bacteria 5037
363 Ga0495601_0015454 3300053077 Bacteria 4613
364 Ga0495612_0003038 3300053078 Bacteria 6964
365 Ga0495595_0005532 3300053084 Bacteria 5116
366 Ga0495619_0003688 3300053085 Bacteria 9870
367 Ga0495619_0013993 3300053085 Bacteria 5062
368 Ga0495619_0091301 3300053085 Bacteria 2062
369 Ga0500647_0054130 3300053091 Bacteria 1931
370 Ga0500566_0030961 3300053094 Bacteria 3119
371 Ga0500640_060141 3300053095 Bacteria 1648
372 Ga0500572_012899 3300053111 Bacteria 2057
373 Ga0500595_009063 3300053119 Bacteria 4038
374 Ga0500614_010359 3300053123 Bacteria 2001
375 Ga0500559_0068311 3300053136 Bacteria 1596
376 Ga0500638_067141 3300053162 Bacteria 1718
377 Ga0500596_005690 3300053735 Bacteria 2168
378 Ga0500601_003361 3300053737 Bacteria 1735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0203616 Ga0496105_0203616_857_1462 177
2 3300041505 Ga0451849_0568822 Ga0451849_0568822_77_640 179
3 3300005439 Ga0070711_100096434 Ga0070711_1000964342 182
4 3300005436 Ga0070713_100074907 Ga0070713_1000749073 183
5 3300006175 Ga0070712_100079075 Ga0070712_1000790752 183
6 3300025928 Ga0207700_10499409 Ga0207700_104994091 183
7 3300036401 Ga0373937_1410137 Ga0373937_1410137_24_620 183
8 3300048915 Ga0496112_1366683 Ga0496112_1366683_35_613 184
9 3300039447 Ga0436361_0942550 Ga0436361_0942550_20_736 186
10 3300039438 Ga0436360_0906461 Ga0436360_0906461_242_982 190
11 3300048920 Ga0496117_0030360 Ga0496117_0030360_789_1505 191
12 3300025939 Ga0207665_10017696 Ga0207665_100176963 192
13 3300035691 Ga0373931_0073380 Ga0373931_0073380_937_1656 195
14 3300039437 Ga0436365_0489864 Ga0436365_0489864_257_973 195
15 3300039438 Ga0436360_0787642 Ga0436360_0787642_1565_2332 196
16 3300045049 Ga0466959_0111174 Ga0466959_0111174_980_1756 196
17 3300025905 Ga0207685_10117171 Ga0207685_101171712 198
18 3300046692 Ga0495671_0197119 Ga0495671_0197119_167_913 198
19 3300048918 Ga0496115_0186623 Ga0496115_0186623_73_891 198
20 3300017792 Ga0163161_10050854 Ga0163161_100508542 199
21 3300039447 Ga0436361_0365689 Ga0436361_0365689_990_1685 200
22 3300006028 Ga0070717_10705112 Ga0070717_107051121 201
23 3300048922 Ga0496119_0217982 Ga0496119_0217982_125_874 201
24 3300025929 Ga0207664_10413754 Ga0207664_104137541 202
25 3300005535 Ga0070684_100105662 Ga0070684_1001056622 204
26 3300026075 Ga0207708_10025111 Ga0207708_100251114 204
27 3300005539 Ga0068853_100675475 Ga0068853_1006754751 206
28 3300021441 Ga0213871_10006382 Ga0213871_100063823 206
29 3300039438 Ga0436360_0593177 Ga0436360_0593177_4335_5051 206
30 3300039453 Ga0436362_0854034 Ga0436362_0854034_358_1074 206
31 3300005437 Ga0070710_10040188 Ga0070710_100401881 207
32 3300031728 Ga0316578_10217456 Ga0316578_102174561 207
33 3300036712 Ga0316584_0041639 Ga0316584_0041639_1937_2650 207
34 3300005937 Ga0081455_10011516 Ga0081455_100115165 208
35 3300039438 Ga0436360_0059027 Ga0436360_0059027_257_955 208
36 3300005530 Ga0070679_100020373 Ga0070679_1000203734 209
37 3300005614 Ga0068856_100481513 Ga0068856_1004815131 209
38 3300013105 Ga0157369_10477225 Ga0157369_104772252 209
39 3300013105 Ga0157369_10528933 Ga0157369_105289331 209
40 3300025921 Ga0207652_10043300 Ga0207652_100433003 209
41 3300037466 Ga0395898_0004788 Ga0395898_0004788_4481_5245 209
42 3300038443 Ga0395901_0259719 Ga0395901_0259719_985_1749 209
43 3300039447 Ga0436361_0173880 Ga0436361_0173880_174_914 209
44 3300039453 Ga0436362_1181921 Ga0436362_1181921_16_756 209
45 3300005983 Ga0081540_1013067 Ga0081540_10130674 210
46 3300048905 Ga0496102_0554167 Ga0496102_0554167_84_800 211
47 3300048909 Ga0496106_0004787 Ga0496106_0004787_8466_9182 211
48 3300048910 Ga0496107_0000229 Ga0496107_0000229_556_1272 211
49 3300048911 Ga0496108_0000419 Ga0496108_0000419_3838_4554 211
50 3300048912 Ga0496109_0000901 Ga0496109_0000901_12357_13073 211
51 3300048913 Ga0496110_0008671 Ga0496110_0008671_3025_3741 211
52 3300048914 Ga0496111_0145226 Ga0496111_0145226_954_1670 211
53 3300048915 Ga0496112_0001990 Ga0496112_0001990_5776_6492 211
54 3300009545 Ga0105237_10239654 Ga0105237_102396542 212
55 3300025914 Ga0207671_10290274 Ga0207671_102902742 212
56 3300037466 Ga0395898_0396327 Ga0395898_0396327_253_984 212
57 3300038443 Ga0395901_0088180 Ga0395901_0088180_138_869 212
58 3300053119 Ga0500595_009063 Ga0500595_009063_1001_1720 213
59 3300048924 Ga0496121_0000194 Ga0496121_0000194_43987_44706 214
60 3300046463 Ga0495653_0052650 Ga0495653_0052650_1803_2519 216
61 3300005339 Ga0070660_100063689 Ga0070660_1000636892 217
62 3300005535 Ga0070684_100010374 Ga0070684_1000103743 217
63 3300006038 Ga0075365_10198218 Ga0075365_101982182 217
64 3300013105 Ga0157369_10015454 Ga0157369_100154548 217
65 3300025919 Ga0207657_10002081 Ga0207657_100020812 217
66 3300025924 Ga0207694_10010525 Ga0207694_100105256 217
67 3300048907 Ga0496104_0493011 Ga0496104_0493011_70_789 217
68 3300048908 Ga0496105_0415770 Ga0496105_0415770_210_929 217
69 3300048912 Ga0496109_0300515 Ga0496109_0300515_300_1019 217
70 3300048913 Ga0496110_0216404 Ga0496110_0216404_519_1238 217
71 3300048915 Ga0496112_0212678 Ga0496112_0212678_1047_1763 217
72 3300048916 Ga0496113_0566652 Ga0496113_0566652_101_820 217
73 3300031728 Ga0316578_10214107 Ga0316578_102141071 218
74 3300036712 Ga0316584_0168688 Ga0316584_0168688_184_903 218
75 3300039447 Ga0436361_1118557 Ga0436361_1118557_380_1075 218
76 3300044684 Ga0466966_0016226 Ga0466966_0016226_3878_4594 218
77 3300045049 Ga0466959_0054797 Ga0466959_0054797_1852_2568 218
78 3300005530 Ga0070679_100366916 Ga0070679_1003669162 219
79 3300006852 Ga0075433_10047963 Ga0075433_100479637 219
80 3300006871 Ga0075434_100036432 Ga0075434_1000364328 219
81 3300009094 Ga0111539_10195842 Ga0111539_101958424 219
82 3300013105 Ga0157369_10562320 Ga0157369_105623202 219
83 3300025912 Ga0207707_10120811 Ga0207707_101208112 219
84 3300027907 Ga0207428_10316901 Ga0207428_103169012 219
85 3300050511 nmdc:mga08y16_157686_c1 nmdc:mga08y16_157686_c1_1579_2310 219
86 3300050512 nmdc:mga0n895_89788_c1 nmdc:mga0n895_89788_c1_2177_2908 219
87 3300050515 nmdc:mga0a205_26131_c1 nmdc:mga0a205_26131_c1_333_1064 219
88 3300005365 Ga0070688_100188129 Ga0070688_1001881292 220
89 3300025933 Ga0207706_10007127 Ga0207706_100071275 220
90 3300025942 Ga0207689_10016241 Ga0207689_100162416 220
91 3300028381 Ga0268264_10042740 Ga0268264_100427401 220
92 3300039447 Ga0436361_0543762 Ga0436361_0543762_284_997 220
93 3300047320 Ga0495672_0091099 Ga0495672_0091099_324_1043 220
94 3300048910 Ga0496107_0131784 Ga0496107_0131784_751_1497 220
95 3300048915 Ga0496112_0290283 Ga0496112_0290283_588_1334 220
96 3300048916 Ga0496113_0115110 Ga0496113_0115110_559_1302 220
97 3300006175 Ga0070712_100495859 Ga0070712_1004958592 221
98 3300025915 Ga0207693_10447148 Ga0207693_104471481 221
99 3300046463 Ga0495653_0402054 Ga0495653_0402054_71_781 221
100 3300047315 Ga0495581_0266863 Ga0495581_0266863_167_877 221
101 3300047673 Ga0495593_0235826 Ga0495593_0235826_24_734 221
102 3300048088 Ga0495602_0297927 Ga0495602_0297927_421_1131 221
103 3300006175 Ga0070712_100052532 Ga0070712_1000525323 222
104 3300025915 Ga0207693_10138332 Ga0207693_101383322 222
105 3300035083 Ga0373926_0127274 Ga0373926_0127274_209_931 222
106 3300035171 Ga0373946_0167135 Ga0373946_0167135_73_795 222
107 3300035692 Ga0373935_0043252 Ga0373935_0043252_2013_2735 222
108 3300035695 Ga0373927_0301998 Ga0373927_0301998_28_750 222
109 3300037068 Ga0373925_0023747 Ga0373925_0023747_3311_4033 222
110 3300046463 Ga0495653_0060035 Ga0495653_0060035_572_1294 222
111 3300046476 Ga0495662_0011408 Ga0495662_0011408_2707_3429 222
112 3300046477 Ga0495664_0000327 Ga0495664_0000327_15734_16456 222
113 3300046514 Ga0495618_0004177 Ga0495618_0004177_4901_5623 222
114 3300046529 Ga0495652_0046089 Ga0495652_0046089_767_1489 222
115 3300046533 Ga0495640_0010141 Ga0495640_0010141_1456_2178 222
116 3300046535 Ga0495586_0016818 Ga0495586_0016818_1208_1930 222
117 3300046543 Ga0495645_0001032 Ga0495645_0001032_16278_17000 222
118 3300046642 Ga0495634_0012496 Ga0495634_0012496_3283_4005 222
119 3300046663 Ga0495635_0011993 Ga0495635_0011993_5007_5729 222
120 3300046690 Ga0495624_0105481 Ga0495624_0105481_493_1215 222
121 3300047319 Ga0495674_0010178 Ga0495674_0010178_1907_2629 222
122 3300047319 Ga0495674_0046999 Ga0495674_0046999_1964_2686 222
123 3300047471 Ga0495684_0030481 Ga0495684_0030481_1964_2686 222
124 3300053077 Ga0495601_0015454 Ga0495601_0015454_1920_2642 222
125 3300053078 Ga0495612_0003038 Ga0495612_0003038_4025_4747 222
126 3300053085 Ga0495619_0013993 Ga0495619_0013993_1018_1740 222
127 3300005937 Ga0081455_10310202 Ga0081455_103102021 224
128 3300013296 Ga0157374_10019749 Ga0157374_100197492 224
129 3300025906 Ga0207699_10040636 Ga0207699_100406362 224
130 3300005329 Ga0070683_100652044 Ga0070683_1006520441 225
131 3300005354 Ga0070675_100195236 Ga0070675_1001952362 225
132 3300005364 Ga0070673_100212960 Ga0070673_1002129602 225
133 3300005367 Ga0070667_100450692 Ga0070667_1004506921 225
134 3300005436 Ga0070713_100228985 Ga0070713_1002289851 225
135 3300005457 Ga0070662_100088979 Ga0070662_1000889792 225
136 3300005466 Ga0070685_10035384 Ga0070685_100353842 225
137 3300005548 Ga0070665_100141863 Ga0070665_1001418632 225
138 3300005615 Ga0070702_100073299 Ga0070702_1000732991 225
139 3300005617 Ga0068859_100210314 Ga0068859_1002103142 225
140 3300005983 Ga0081540_1009372 Ga0081540_10093721 225
141 3300006163 Ga0070715_10063861 Ga0070715_100638612 225
142 3300006178 Ga0075367_10107680 Ga0075367_101076802 225
143 3300006358 Ga0068871_100184816 Ga0068871_1001848161 225
144 3300006871 Ga0075434_100053745 Ga0075434_1000537452 225
145 3300006881 Ga0068865_100016323 Ga0068865_1000163235 225
146 3300006931 Ga0097620_100210320 Ga0097620_1002103202 225
147 3300009101 Ga0105247_10039066 Ga0105247_100390662 225
148 3300009174 Ga0105241_10089316 Ga0105241_100893161 225
149 3300013308 Ga0157375_10202569 Ga0157375_102025692 225
150 3300025898 Ga0207692_10010904 Ga0207692_100109043 225
151 3300025908 Ga0207643_10000985 Ga0207643_100009853 225
152 3300025915 Ga0207693_10007738 Ga0207693_100077383 225
153 3300025916 Ga0207663_10014017 Ga0207663_100140173 225
154 3300025926 Ga0207659_10348915 Ga0207659_103489151 225
155 3300025928 Ga0207700_10004784 Ga0207700_100047844 225
156 3300025928 Ga0207700_10072070 Ga0207700_100720703 225
157 3300025939 Ga0207665_10011107 Ga0207665_100111073 225
158 3300025940 Ga0207691_10011142 Ga0207691_1001114210 225
159 3300025972 Ga0207668_10093789 Ga0207668_100937892 225
160 3300025981 Ga0207640_10265865 Ga0207640_102658652 225
161 3300026067 Ga0207678_10022397 Ga0207678_100223973 225
162 3300026088 Ga0207641_10183481 Ga0207641_101834812 225
163 3300026095 Ga0207676_10083805 Ga0207676_100838052 225
164 3300026116 Ga0207674_10070512 Ga0207674_100705125 225
165 3300026121 Ga0207683_10184891 Ga0207683_101848913 225
166 3300026142 Ga0207698_10283637 Ga0207698_102836371 225
167 3300028379 Ga0268266_10143014 Ga0268266_101430143 225
168 3300035724 Ga0373933_0000306 Ga0373933_0000306_5735_6448 225
169 3300045976 Ga0466967_0024990 Ga0466967_0024990_3405_4121 225
170 3300046615 Ga0495656_0120708 Ga0495656_0120708_474_1220 225
171 3300048903 Ga0496100_0102072 Ga0496100_0102072_88_834 225
172 3300048905 Ga0496102_0059298 Ga0496102_0059298_583_1332 225
173 3300048905 Ga0496102_0506459 Ga0496102_0506459_139_882 225
174 3300048906 Ga0496103_0003792 Ga0496103_0003792_1997_2743 225
175 3300048908 Ga0496105_0015599 Ga0496105_0015599_3347_4093 225
176 3300048909 Ga0496106_0224745 Ga0496106_0224745_728_1471 225
177 3300048911 Ga0496108_0215448 Ga0496108_0215448_674_1420 225
178 3300048913 Ga0496110_0072766 Ga0496110_0072766_1405_2151 225
179 3300048918 Ga0496115_0268709 Ga0496115_0268709_517_1263 225
180 3300003323 rootH1_10218548 rootH1_102185482 226
181 3300005327 Ga0070658_10063643 Ga0070658_100636432 226
182 3300005329 Ga0070683_100173220 Ga0070683_1001732202 226
183 3300005336 Ga0070680_100118920 Ga0070680_1001189202 226
184 3300005339 Ga0070660_100068472 Ga0070660_1000684722 226
185 3300005341 Ga0070691_10117663 Ga0070691_101176632 226
186 3300005434 Ga0070709_10000966 Ga0070709_100009668 226
187 3300005434 Ga0070709_10015827 Ga0070709_100158273 226
188 3300005434 Ga0070709_10247447 Ga0070709_102474472 226
189 3300005435 Ga0070714_100080973 Ga0070714_1000809734 226
190 3300005435 Ga0070714_100088770 Ga0070714_1000887702 226
191 3300005435 Ga0070714_100706478 Ga0070714_1007064781 226
192 3300005436 Ga0070713_100001630 Ga0070713_1000016305 226
193 3300005436 Ga0070713_100100412 Ga0070713_1001004121 226
194 3300005436 Ga0070713_100543084 Ga0070713_1005430842 226
195 3300005436 Ga0070713_100956469 Ga0070713_1009564691 226
196 3300005437 Ga0070710_10001140 Ga0070710_100011409 226
197 3300005437 Ga0070710_10021639 Ga0070710_100216392 226
198 3300005439 Ga0070711_100007241 Ga0070711_1000072413 226
199 3300005445 Ga0070708_100054352 Ga0070708_1000543522 226
200 3300005471 Ga0070698_100109364 Ga0070698_1001093642 226
201 3300005536 Ga0070697_100132511 Ga0070697_1001325112 226
202 3300005539 Ga0068853_100086367 Ga0068853_1000863673 226
203 3300005563 Ga0068855_100099429 Ga0068855_1000994292 226
204 3300005564 Ga0070664_100242014 Ga0070664_1002420142 226
205 3300005577 Ga0068857_100012078 Ga0068857_1000120782 226
206 3300005614 Ga0068856_100136692 Ga0068856_1001366922 226
207 3300005616 Ga0068852_100129409 Ga0068852_1001294092 226
208 3300005834 Ga0068851_10003413 Ga0068851_100034138 226
209 3300006028 Ga0070717_10002647 Ga0070717_100026477 226
210 3300006028 Ga0070717_10008357 Ga0070717_100083575 226
211 3300006163 Ga0070715_10001552 Ga0070715_100015526 226
212 3300006163 Ga0070715_10052471 Ga0070715_100524712 226
213 3300006173 Ga0070716_100000901 Ga0070716_1000009019 226
214 3300006871 Ga0075434_100008452 Ga0075434_1000084527 226
215 3300007265 Ga0099794_10040902 Ga0099794_100409022 226
216 3300007265 Ga0099794_10243912 Ga0099794_102439121 226
217 3300007788 Ga0099795_10011628 Ga0099795_100116281 226
218 3300007788 Ga0099795_10053064 Ga0099795_100530642 226
219 3300009093 Ga0105240_10056837 Ga0105240_100568372 226
220 3300009545 Ga0105237_10018938 Ga0105237_100189382 226
221 3300009551 Ga0105238_10353172 Ga0105238_103531721 226
222 3300010159 Ga0099796_10092359 Ga0099796_100923592 226
223 3300010375 Ga0105239_10123514 Ga0105239_101235142 226
224 3300013105 Ga0157369_10751308 Ga0157369_107513081 226
225 3300025898 Ga0207692_10008021 Ga0207692_100080215 226
226 3300025898 Ga0207692_10017974 Ga0207692_100179742 226
227 3300025898 Ga0207692_10080297 Ga0207692_100802972 226
228 3300025905 Ga0207685_10001293 Ga0207685_100012933 226
229 3300025906 Ga0207699_10005032 Ga0207699_100050325 226
230 3300025906 Ga0207699_10006017 Ga0207699_100060173 226
231 3300025906 Ga0207699_10224782 Ga0207699_102247822 226
232 3300025906 Ga0207699_10571213 Ga0207699_105712131 226
233 3300025915 Ga0207693_10000633 Ga0207693_100006336 226
234 3300025915 Ga0207693_10060954 Ga0207693_100609542 226
235 3300025916 Ga0207663_10000269 Ga0207663_100002697 226
236 3300025916 Ga0207663_10290727 Ga0207663_102907272 226
237 3300025917 Ga0207660_10125214 Ga0207660_101252142 226
238 3300025919 Ga0207657_10055819 Ga0207657_100558192 226
239 3300025921 Ga0207652_10002442 Ga0207652_100024427 226
240 3300025922 Ga0207646_10203290 Ga0207646_102032901 226
241 3300025928 Ga0207700_10077164 Ga0207700_100771641 226
242 3300025928 Ga0207700_10160418 Ga0207700_101604183 226
243 3300025929 Ga0207664_10173861 Ga0207664_101738612 226
244 3300025939 Ga0207665_10001353 Ga0207665_100013537 226
245 3300025939 Ga0207665_10234959 Ga0207665_102349592 226
246 3300025944 Ga0207661_10060090 Ga0207661_100600902 226
247 3300025945 Ga0207679_10218678 Ga0207679_102186782 226
248 3300026041 Ga0207639_10270481 Ga0207639_102704812 226
249 3300026067 Ga0207678_10039727 Ga0207678_100397273 226
250 3300026078 Ga0207702_10199986 Ga0207702_101999862 226
251 3300026116 Ga0207674_10012739 Ga0207674_100127392 226
252 3300026116 Ga0207674_10098446 Ga0207674_100984462 226
253 3300026142 Ga0207698_10333758 Ga0207698_103337582 226
254 3300031235 Ga0265330_10026842 Ga0265330_100268423 226
255 3300031247 Ga0265340_10022620 Ga0265340_100226202 226
256 3300031249 Ga0265339_10000755 Ga0265339_1000075520 226
257 3300031250 Ga0265331_10025422 Ga0265331_100254222 226
258 3300031344 Ga0265316_10115409 Ga0265316_101154091 226
259 3300031344 Ga0265316_10152902 Ga0265316_101529021 226
260 3300031691 Ga0316579_10096532 Ga0316579_100965322 226
261 3300031711 Ga0265314_10003561 Ga0265314_100035617 226
262 3300031711 Ga0265314_10126632 Ga0265314_101266322 226
263 3300035086 Ga0373934_0149738 Ga0373934_0149738_137_841 226
264 3300035111 Ga0373923_0011237 Ga0373923_0011237_2200_2904 226
265 3300035113 Ga0373936_0006481 Ga0373936_0006481_2781_3497 226
266 3300035117 Ga0373953_0001632 Ga0373953_0001632_1018_1722 226
267 3300035118 Ga0373954_0137433 Ga0373954_0137433_110_826 226
268 3300035118 Ga0373954_0198879 Ga0373954_0198879_222_926 226
269 3300035119 Ga0373956_0014586 Ga0373956_0014586_1041_1745 226
270 3300035170 Ga0373943_0015156 Ga0373943_0015156_698_1414 226
271 3300035172 Ga0373955_0000905 Ga0373955_0000905_11335_12039 226
272 3300035172 Ga0373955_0161884 Ga0373955_0161884_373_1089 226
273 3300035410 Ga0373924_0165332 Ga0373924_0165332_180_896 226
274 3300035692 Ga0373935_0000658 Ga0373935_0000658_14864_15580 226
275 3300035695 Ga0373927_0000560 Ga0373927_0000560_227_943 226
276 3300035725 Ga0373947_0000914 Ga0373947_0000914_7437_8153 226
277 3300036401 Ga0373937_0017861 Ga0373937_0017861_2644_3360 226
278 3300036401 Ga0373937_0149744 Ga0373937_0149744_10_714 226
279 3300036647 Ga0316582_0120939 Ga0316582_0120939_684_1427 226
280 3300037068 Ga0373925_0055273 Ga0373925_0055273_961_1677 226
281 3300037068 Ga0373925_0084221 Ga0373925_0084221_832_1548 226
282 3300037312 Ga0395899_0315352 Ga0395899_0315352_183_899 226
283 3300037466 Ga0395898_0068695 Ga0395898_0068695_2603_3319 226
284 3300037471 Ga0395905_0102903 Ga0395905_0102903_1171_1887 226
285 3300037471 Ga0395905_0157588 Ga0395905_0157588_602_1318 226
286 3300037853 Ga0436364_0368839 Ga0436364_0368839_360_1076 226
287 3300038443 Ga0395901_0851365 Ga0395901_0851365_90_806 226
288 3300039447 Ga0436361_0904891 Ga0436361_0904891_970_1704 226
289 3300039450 Ga0436363_0146568 Ga0436363_0146568_11910_12641 226
290 3300039450 Ga0436363_0241028 Ga0436363_0241028_5452_6171 226
291 3300039450 Ga0436363_0327968 Ga0436363_0327968_1009_1767 226
292 3300039453 Ga0436362_0431217 Ga0436362_0431217_604_1338 226
293 3300041512 Ga0451853_2679962 Ga0451853_2679962_90_806 226
294 3300044684 Ga0466966_0148845 Ga0466966_0148845_250_966 226
295 3300044694 Ga0466963_0046665 Ga0466963_0046665_993_1697 226
296 3300046454 Ga0495592_0048892 Ga0495592_0048892_2341_3057 226
297 3300046455 Ga0495603_0000351 Ga0495603_0000351_21608_22324 226
298 3300046459 Ga0495629_0000114 Ga0495629_0000114_4560_5264 226
299 3300046459 Ga0495629_0000250 Ga0495629_0000250_14190_14906 226
300 3300046461 Ga0495641_0002106 Ga0495641_0002106_4901_5617 226
301 3300046462 Ga0495651_0044089 Ga0495651_0044089_1282_1986 226
302 3300046463 Ga0495653_0003601 Ga0495653_0003601_7365_8069 226
303 3300046472 Ga0495580_0000536 Ga0495580_0000536_17245_17961 226
304 3300046473 Ga0495582_0000021 Ga0495582_0000021_68439_69155 226
305 3300046475 Ga0495639_0000030 Ga0495639_0000030_13581_14297 226
306 3300046476 Ga0495662_0000399 Ga0495662_0000399_17834_18550 226
307 3300046477 Ga0495664_0012945 Ga0495664_0012945_3253_3957 226
308 3300046477 Ga0495664_0070551 Ga0495664_0070551_931_1647 226
309 3300046499 Ga0495594_0000153 Ga0495594_0000153_23855_24571 226
310 3300046511 Ga0495608_0001813 Ga0495608_0001813_13083_13787 226
311 3300046514 Ga0495618_0012615 Ga0495618_0012615_2087_2803 226
312 3300046514 Ga0495618_0249646 Ga0495618_0249646_372_1076 226
313 3300046516 Ga0495628_0005957 Ga0495628_0005957_9713_10417 226
314 3300046517 Ga0495630_0020430 Ga0495630_0020430_3320_4036 226
315 3300046524 Ga0495648_0000325 Ga0495648_0000325_41966_42682 226
316 3300046526 Ga0495666_0006341 Ga0495666_0006341_986_1702 226
317 3300046529 Ga0495652_0004675 Ga0495652_0004675_3680_4384 226
318 3300046531 Ga0495665_0000066 Ga0495665_0000066_42751_43467 226
319 3300046533 Ga0495640_0002049 Ga0495640_0002049_988_1704 226
320 3300046533 Ga0495640_0158158 Ga0495640_0158158_237_941 226
321 3300046543 Ga0495645_0015055 Ga0495645_0015055_3422_4126 226
322 3300046543 Ga0495645_0049510 Ga0495645_0049510_1119_1823 226
323 3300046557 Ga0495622_0008290 Ga0495622_0008290_231_947 226
324 3300046642 Ga0495634_0000336 Ga0495634_0000336_7528_8244 226
325 3300046642 Ga0495634_0153170 Ga0495634_0153170_724_1428 226
326 3300046663 Ga0495635_0000318 Ga0495635_0000318_4596_5300 226
327 3300046663 Ga0495635_0002051 Ga0495635_0002051_2505_3221 226
328 3300046674 Ga0495588_0015477 Ga0495588_0015477_2085_2801 226
329 3300046675 Ga0495657_0002559 Ga0495657_0002559_4587_5291 226
330 3300046678 Ga0495599_0135870 Ga0495599_0135870_180_884 226
331 3300046678 Ga0495599_0152311 Ga0495599_0152311_620_1324 226
332 3300046679 Ga0495623_0069561 Ga0495623_0069561_1426_2130 226
333 3300046680 Ga0495646_0003963 Ga0495646_0003963_1425_2141 226
334 3300046680 Ga0495646_0121534 Ga0495646_0121534_747_1451 226
335 3300046681 Ga0495647_0000764 Ga0495647_0000764_122_838 226
336 3300046683 Ga0495658_0000400 Ga0495658_0000400_2245_2961 226
337 3300046689 Ga0495613_0001286 Ga0495613_0001286_6843_7559 226
338 3300046689 Ga0495613_0046616 Ga0495613_0046616_696_1400 226
339 3300046690 Ga0495624_0000736 Ga0495624_0000736_13581_14297 226
340 3300046809 Ga0495600_0000883 Ga0495600_0000883_4587_5291 226
341 3300046809 Ga0495600_0033028 Ga0495600_0033028_673_1389 226
342 3300047315 Ga0495581_0000047 Ga0495581_0000047_24450_25166 226
343 3300047319 Ga0495674_0000101 Ga0495674_0000101_45369_46085 226
344 3300047319 Ga0495674_0072385 Ga0495674_0072385_302_1006 226
345 3300047321 Ga0495676_0031309 Ga0495676_0031309_2283_2999 226
346 3300047322 Ga0495680_0000944 Ga0495680_0000944_22302_23006 226
347 3300047322 Ga0495680_0059732 Ga0495680_0059732_1788_2504 226
348 3300047471 Ga0495684_0000841 Ga0495684_0000841_14767_15471 226
349 3300047673 Ga0495593_0000466 Ga0495593_0000466_14143_14859 226
350 3300047673 Ga0495593_0010587 Ga0495593_0010587_4586_5290 226
351 3300048088 Ga0495602_0068707 Ga0495602_0068707_10_714 226
352 3300048089 Ga0495614_0010575 Ga0495614_0010575_621_1337 226
353 3300048911 Ga0496108_0359455 Ga0496108_0359455_255_971 226
354 3300048913 Ga0496110_0077628 Ga0496110_0077628_1530_2246 226
355 3300048914 Ga0496111_0161103 Ga0496111_0161103_419_1216 226
356 3300048915 Ga0496112_0022764 Ga0496112_0022764_2520_3236 226
357 3300048915 Ga0496112_0126966 Ga0496112_0126966_138_854 226
358 3300048915 Ga0496112_0277110 Ga0496112_0277110_356_1153 226
359 3300048918 Ga0496115_0333341 Ga0496115_0333341_318_1022 226
360 3300048927 Ga0496124_0327288 Ga0496124_0327288_322_1038 226
361 3300048929 Ga0496126_0008263 Ga0496126_0008263_4974_5690 226
362 3300048929 Ga0496126_0069352 Ga0496126_0069352_538_1254 226
363 3300048929 Ga0496126_0499674 Ga0496126_0499674_53_769 226
364 3300050512 nmdc:mga0n895_368425_c1 nmdc:mga0n895_368425_c1_452_1249 226
365 3300050512 nmdc:mga0n895_6061_c1 nmdc:mga0n895_6061_c1_6749_7465 226
366 3300053077 Ga0495601_0012792 Ga0495601_0012792_3524_4243 226
367 3300053084 Ga0495595_0005532 Ga0495595_0005532_2076_2780 226
368 3300053085 Ga0495619_0003688 Ga0495619_0003688_1239_1943 226
369 3300053085 Ga0495619_0091301 Ga0495619_0091301_184_900 226
370 3300053091 Ga0500647_0054130 Ga0500647_0054130_804_1523 226
371 3300053094 Ga0500566_0030961 Ga0500566_0030961_785_1504 226
372 3300053095 Ga0500640_060141 Ga0500640_060141_781_1500 226
373 3300053111 Ga0500572_012899 Ga0500572_012899_447_1166 226
374 3300053123 Ga0500614_010359 Ga0500614_010359_767_1486 226
375 3300053136 Ga0500559_0068311 Ga0500559_0068311_356_1075 226
376 3300053162 Ga0500638_067141 Ga0500638_067141_138_857 226
377 3300053735 Ga0500596_005690 Ga0500596_005690_32_751 226
378 3300053737 Ga0500601_003361 Ga0500601_003361_888_1607 226
379 iso_pu_bacteria 2508501128 2509149828 226
380 iso_pu_bacteria 2513237104 2513715746 226
381 iso_pu_bacteria 2513237141 2513889819 226
382 iso_pu_bacteria 2744054633 2745079078 226
383 iso_pu_bacteria 2876761206 2876769008 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07758

DUF1614

Protein of unknown function (DUF1614)

55

224

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a11-assembly1.cif.gz_D crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 0.3672 121 212
3n1b-assembly2.cif.gz_B c-terminal domain of vps54 subunit of the garp complex 0.3651 104 214
8w6i-assembly1.cif.gz_C cryo-em structure of escherichia coli str k12 ftsex complex with atp-gamma-s in peptidisc 0.3384 104 217
7aci-assembly1.cif.gz_A in meso structure of apolipoprotein n-acyltransferase, lnt, from escherichia coli in 9.8 monoacylglycerol 0.3229 117 216
3n1b-assembly2.cif.gz_B c-terminal domain of vps54 subunit of the garp complex 0.3046 104 214
ID Description Score Start End Superfamily
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.6081 57 89 2.30.130.110
af_F1M6D0_1_124_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.349 42 83 3.30.70.60
af_Q9UT82_1_110_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.3317 39 83 3.30.70.60
af_P0AGA2_15_429_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.2928 43 217 1.10.3370.10
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.288 104 217 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A7J3U5U2-F1-model_v4 DUF1614 domain-containing protein 0.9001 94 216 GO:0016020
AF-A0A497H1A2-F1-model_v4 deleted 0.8683 94 216
AF-A0A5C7VSA0-F1-model_v4 DUF1614 domain-containing protein 0.8528 95 213 GO:0016020
AF-A0A849ILI0-F1-model_v4 DUF1614 domain-containing protein 0.8364 21 213 GO:0016020
AF-A0A7V6DQT1-F1-model_v4 DUF1614 domain-containing protein 0.8322 88 226 GO:0016020

Feature Viewer

pLDDT pTM Quality
75.44 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map