F429702

General Info

Members Datasets Scaffolds Average Seq Length
383 184 766 101

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0088415|Ga0495659_0088415_808_1155
Length 115
Sequence MGVIPPSRYGPQRSGLMRGRSSEEWIAQYATSHQHPVNRFCHTLGIPLIVISIGWFAIAWFTSGPLLLPVMLFLIGWALQFIGHAFEGKRPEFFHDWRFLFVGLRWWVAKVRGRA

Samples

Sample ID Description Type Environment
1 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 1.04
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 19.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495659_0088415 3300046664 Bacteria 1186
2 SwRhRL2b_contig_2405541 2162886007 Bacteria 2296
3 JGI25406J46586_10018994 3300003203 Bacteria 2811
4 Ga0065704_10098118 3300005289 Bacteria 2365
5 Ga0065715_10377662 3300005293 Bacteria 912
6 Ga0065707_10143698 3300005295 Bacteria 1740
7 Ga0065707_10423096 3300005295 Bacteria 828
8 Ga0070690_100037542 3300005330 Bacteria 3054
9 Ga0070690_100262818 3300005330 Bacteria 1225
10 Ga0070670_100071746 3300005331 Bacteria 2973
11 Ga0070670_101445281 3300005331 Bacteria 631
12 Ga0070677_10815237 3300005333 Unclassified 534
13 Ga0068869_100048793 3300005334 Bacteria 3063
14 Ga0068869_100547459 3300005334 Bacteria 972
15 Ga0070666_10140993 3300005335 Bacteria 1679
16 Ga0070680_100305951 3300005336 Bacteria 1348
17 Ga0068868_101553758 3300005338 Unclassified 621
18 Ga0070660_100726968 3300005339 Unclassified 833
19 Ga0070689_100104063 3300005340 Bacteria 2250
20 Ga0070689_100399067 3300005340 Bacteria 1162
21 Ga0070689_101058832 3300005340 Unclassified 724
22 Ga0070687_100025619 3300005343 Bacteria 2832
23 Ga0070687_100027666 3300005343 Bacteria 2742
24 Ga0070687_101335725 3300005343 Bacteria 534
25 Ga0070661_100105886 3300005344 Bacteria 2097
26 Ga0070661_100354790 3300005344 Bacteria 1151
27 Ga0070661_101383556 3300005344 Bacteria 592
28 Ga0070692_10160443 3300005345 Bacteria 1288
29 Ga0070692_10192298 3300005345 Unclassified 1190
30 Ga0070668_100130556 3300005347 Bacteria 2016
31 Ga0070669_100002851 3300005353 Bacteria 12493
32 Ga0070669_100743473 3300005353 Unclassified 831
33 Ga0070675_100000326 3300005354 Bacteria 32204
34 Ga0070675_100193602 3300005354 Bacteria 1763
35 Ga0070675_100427719 3300005354 Bacteria 1185
36 Ga0070674_100207057 3300005356 Bacteria 1518
37 Ga0070674_100646383 3300005356 Bacteria 899
38 Ga0070673_100084735 3300005364 Bacteria 2578
39 Ga0070673_100095205 3300005364 Bacteria 2442
40 Ga0070673_101225082 3300005364 Bacteria 704
41 Ga0070688_100057595 3300005365 Bacteria 2443
42 Ga0070688_100176190 3300005365 Bacteria 1480
43 Ga0070688_100544224 3300005365 Unclassified 882
44 Ga0070659_101731631 3300005366 Unclassified 559
45 Ga0070703_10099863 3300005406 Bacteria 1021
46 Ga0070701_10001183 3300005438 Bacteria 9557
47 Ga0070701_10044076 3300005438 Bacteria 2285
48 Ga0070701_10268135 3300005438 Unclassified 1037
49 Ga0070701_10401274 3300005438 Bacteria 869
50 Ga0070701_11294869 3300005438 Unclassified 520
51 Ga0070705_100000437 3300005440 Bacteria 23892
52 Ga0070705_100029087 3300005440 Bacteria 3034
53 Ga0070705_100042976 3300005440 Bacteria 2587
54 Ga0070705_100144759 3300005440 Unclassified 1569
55 Ga0070705_100364133 3300005440 Bacteria 1059
56 Ga0070705_100840369 3300005440 Bacteria 734
57 Ga0070700_100029723 3300005441 Bacteria 3260
58 Ga0070700_100059344 3300005441 Bacteria 2408
59 Ga0070700_100166559 3300005441 Bacteria 1522
60 Ga0070700_100422363 3300005441 Unclassified 1008
61 Ga0070694_100000687 3300005444 Bacteria 18843
62 Ga0070694_100051853 3300005444 Bacteria 2771
63 Ga0070694_101069429 3300005444 Bacteria 672
64 Ga0070694_101228396 3300005444 Unclassified 629
65 Ga0070708_100064252 3300005445 Bacteria 3288
66 Ga0070678_100135469 3300005456 Bacteria 1963
67 Ga0070662_100062876 3300005457 Bacteria 2714
68 Ga0070662_100119310 3300005457 Bacteria 2020
69 Ga0070662_100131271 3300005457 Bacteria 1932
70 Ga0068867_100000357 3300005459 Bacteria 30376
71 Ga0070685_10318813 3300005466 Bacteria 1053
72 Ga0070706_100162985 3300005467 Bacteria 2082
73 Ga0070706_100772183 3300005467 Bacteria 890
74 Ga0070707_100128740 3300005468 Bacteria 2461
75 Ga0070707_100254230 3300005468 Unclassified 1710
76 Ga0070707_100732889 3300005468 Unclassified 952
77 Ga0070698_100001529 3300005471 Bacteria 25681
78 Ga0070699_100043416 3300005518 Bacteria 3891
79 Ga0070699_100048296 3300005518 Bacteria 3683
80 Ga0070699_100060241 3300005518 Bacteria 3289
81 Ga0070697_100589142 3300005536 Unclassified 977
82 Ga0070697_101976463 3300005536 Bacteria 522
83 Ga0068853_100923154 3300005539 Bacteria 839
84 Ga0068853_102137853 3300005539 Bacteria 543
85 Ga0070672_100091527 3300005543 Bacteria 2454
86 Ga0070686_100080138 3300005544 Bacteria 2160
87 Ga0070695_100020684 3300005545 Bacteria 4019
88 Ga0070695_100041376 3300005545 Bacteria 2921
89 Ga0070695_100109039 3300005545 Unclassified 1876
90 Ga0070695_101484296 3300005545 Bacteria 564
91 Ga0070696_100000238 3300005546 Bacteria 33277
92 Ga0070696_100021623 3300005546 Bacteria 4363
93 Ga0070696_100084401 3300005546 Bacteria 2253
94 Ga0070696_100227814 3300005546 Bacteria 1401
95 Ga0070696_100930189 3300005546 Unclassified 723
96 Ga0070704_100004823 3300005549 Bacteria 7815
97 Ga0070704_100102767 3300005549 Bacteria 2157
98 Ga0070704_100118613 3300005549 Bacteria 2028
99 Ga0070704_100119836 3300005549 Bacteria 2019
100 Ga0070704_101342611 3300005549 Unclassified 655
101 Ga0070664_100181690 3300005564 Bacteria 1870
102 Ga0070664_100256763 3300005564 Bacteria 1572
103 Ga0070664_100466938 3300005564 Bacteria 1160
104 Ga0068857_100009132 3300005577 Bacteria 8603
105 Ga0068857_100050678 3300005577 Bacteria 3682
106 Ga0068857_100996394 3300005577 Bacteria 806
107 Ga0068854_100142735 3300005578 Bacteria 1839
108 Ga0070702_100003684 3300005615 Bacteria 6901
109 Ga0070702_100036258 3300005615 Bacteria 2731
110 Ga0070702_100414770 3300005615 Bacteria 967
111 Ga0070702_100555529 3300005615 Unclassified 853
112 Ga0068852_100578815 3300005616 Bacteria 1125
113 Ga0068859_100001322 3300005617 Bacteria 25276
114 Ga0068859_100022703 3300005617 Bacteria 6291
115 Ga0068859_100438310 3300005617 Bacteria 1403
116 Ga0068859_100480123 3300005617 Unclassified 1338
117 Ga0068864_100221720 3300005618 Bacteria 1745
118 Ga0068864_102141558 3300005618 Bacteria 566
119 Ga0068866_11199577 3300005718 Bacteria 548
120 Ga0068861_100003229 3300005719 Bacteria 10788
121 Ga0068870_10013233 3300005840 Bacteria 3874
122 Ga0068870_10021767 3300005840 Bacteria 3142
123 Ga0068863_100719934 3300005841 Bacteria 993
124 Ga0068858_100664771 3300005842 Bacteria 1013
125 Ga0068858_102426370 3300005842 Unclassified 518
126 Ga0068860_100001565 3300005843 Bacteria 24647
127 Ga0068862_100011322 3300005844 Bacteria 7365
128 Ga0081539_10001373 3300005985 Bacteria 42142
129 Ga0075432_10093263 3300006058 Unclassified 1104
130 Ga0075367_10747935 3300006178 Bacteria 622
131 Ga0097621_100137038 3300006237 Bacteria 2088
132 Ga0097621_100140477 3300006237 Bacteria 2063
133 Ga0097621_100858676 3300006237 Unclassified 843
134 Ga0068871_100136611 3300006358 Bacteria 2082
135 Ga0075428_100022526 3300006844 Bacteria 6975
136 Ga0075428_100470350 3300006844 Bacteria 1346
137 Ga0075428_101648678 3300006844 Bacteria 670
138 Ga0075430_100026441 3300006846 Bacteria 4937
139 Ga0075431_100011776 3300006847 Bacteria 8825
140 Ga0075433_10000344 3300006852 Bacteria 28940
141 Ga0075433_10121969 3300006852 Bacteria 2315
142 Ga0075433_10185007 3300006852 Bacteria 1853
143 Ga0075433_11081754 3300006852 Unclassified 697
144 Ga0075434_100000464 3300006871 Bacteria 30368
145 Ga0075434_100001216 3300006871 Bacteria 21379
146 Ga0075434_100128606 3300006871 Bacteria 2550
147 Ga0075434_100549452 3300006871 Bacteria 1175
148 Ga0075434_102445869 3300006871 Unclassified 524
149 Ga0075429_100093008 3300006880 Bacteria 2630
150 Ga0075429_100651537 3300006880 Bacteria 923
151 Ga0075429_100703454 3300006880 Unclassified 885
152 Ga0068865_100171724 3300006881 Bacteria 1663
153 Ga0068865_100281265 3300006881 Bacteria 1325
154 Ga0075436_100188492 3300006914 Bacteria 1459
155 Ga0075436_100784330 3300006914 Bacteria 709
156 Ga0097620_100001322 3300006931 Bacteria 25276
157 Ga0097620_100022704 3300006931 Bacteria 6291
158 Ga0097620_100438302 3300006931 Bacteria 1403
159 Ga0097620_100480131 3300006931 Unclassified 1338
160 Ga0075435_100024510 3300007076 Bacteria 4684
161 Ga0075435_100037185 3300007076 Bacteria 3875
162 Ga0075435_100174530 3300007076 Bacteria 1814
163 Ga0075435_100405017 3300007076 Bacteria 1174
164 Ga0111539_10000346 3300009094 Bacteria 57056
165 Ga0111539_10014362 3300009094 Bacteria 9885
166 Ga0111539_10581097 3300009094 Bacteria 1305
167 Ga0111539_10634978 3300009094 Unclassified 1243
168 Ga0111539_10757510 3300009094 Bacteria 1130
169 Ga0111539_12008969 3300009094 Unclassified 671
170 Ga0114129_10010714 3300009147 Bacteria 13070
171 Ga0114129_10014009 3300009147 Bacteria 11423
172 Ga0114129_10133135 3300009147 Bacteria 3413
173 Ga0114129_10160237 3300009147 Bacteria 3074
174 Ga0114129_10314337 3300009147 Bacteria 2084
175 Ga0114129_10664009 3300009147 Unclassified 1344
176 Ga0114129_10704010 3300009147 Bacteria 1298
177 Ga0114129_11733525 3300009147 Bacteria 761
178 Ga0114129_11922332 3300009147 Bacteria 717
179 Ga0105243_10025066 3300009148 Bacteria 4555
180 Ga0105243_10152078 3300009148 Bacteria 1986
181 Ga0105243_10169876 3300009148 Bacteria 1887
182 Ga0105242_10101541 3300009176 Bacteria 2438
183 Ga0105242_11166957 3300009176 Bacteria 788
184 Ga0105249_10050165 3300009553 Bacteria 3805
185 Ga0105246_10529712 3300011119 Bacteria 1006
186 Ga0157378_10264124 3300013297 Bacteria 1653
187 Ga0157378_10571025 3300013297 Bacteria 1139
188 Ga0157375_10050967 3300013308 Bacteria 4062
189 Ga0157375_10267770 3300013308 Bacteria 1870
190 Ga0157380_10403742 3300014326 Bacteria 1297
191 Ga0157380_10562416 3300014326 Bacteria 1121
192 Ga0157380_10715641 3300014326 Bacteria 1008
193 Ga0157377_10012094 3300014745 Bacteria 4330
194 Ga0157377_10021578 3300014745 Bacteria 3389
195 Ga0157377_10193505 3300014745 Bacteria 1287
196 Ga0157376_10025886 3300014969 Bacteria 4627
197 Ga0157376_11198014 3300014969 Bacteria 787
198 Ga0207697_10099056 3300025315 Bacteria 1241
199 Ga0207653_10131473 3300025885 Bacteria 909
200 Ga0207653_10387382 3300025885 Unclassified 547
201 Ga0207682_10042284 3300025893 Bacteria 1862
202 Ga0207642_10446658 3300025899 Bacteria 783
203 Ga0207688_10313131 3300025901 Bacteria 962
204 Ga0207680_10222281 3300025903 Unclassified 1295
205 Ga0207647_10097144 3300025904 Bacteria 1752
206 Ga0207643_10005334 3300025908 Bacteria 6877
207 Ga0207643_10014642 3300025908 Bacteria 4264
208 Ga0207660_10218175 3300025917 Bacteria 1496
209 Ga0207660_10319337 3300025917 Bacteria 1240
210 Ga0207662_10012133 3300025918 Bacteria 4795
211 Ga0207662_10029397 3300025918 Bacteria 3184
212 Ga0207657_10645468 3300025919 Bacteria 824
213 Ga0207657_10816122 3300025919 Bacteria 721
214 Ga0207649_10107229 3300025920 Bacteria 1860
215 Ga0207649_10455073 3300025920 Bacteria 967
216 Ga0207646_10126061 3300025922 Bacteria 2302
217 Ga0207646_10249464 3300025922 Bacteria 1603
218 Ga0207646_10423077 3300025922 Unclassified 1202
219 Ga0207646_10771393 3300025922 Unclassified 857
220 Ga0207681_10001063 3300025923 Bacteria 17817
221 Ga0207659_10000284 3300025926 Bacteria 30832
222 Ga0207659_10153400 3300025926 Bacteria 1801
223 Ga0207659_10187211 3300025926 Bacteria 1645
224 Ga0207690_10292349 3300025932 Bacteria 1272
225 Ga0207706_10017515 3300025933 Bacteria 6457
226 Ga0207706_10171352 3300025933 Unclassified 1907
227 Ga0207686_10012647 3300025934 Bacteria 4644
228 Ga0207686_10167129 3300025934 Bacteria 1548
229 Ga0207686_11094442 3300025934 Unclassified 649
230 Ga0207709_10081884 3300025935 Bacteria 2082
231 Ga0207709_10093387 3300025935 Bacteria 1972
232 Ga0207670_10224994 3300025936 Bacteria 1438
233 Ga0207670_10481744 3300025936 Bacteria 1005
234 Ga0207669_10207901 3300025937 Bacteria 1426
235 Ga0207704_10587728 3300025938 Bacteria 910
236 Ga0207691_10055696 3300025940 Bacteria 3603
237 Ga0207689_10081575 3300025942 Bacteria 2658
238 Ga0207689_10110754 3300025942 Bacteria 2256
239 Ga0207689_10194671 3300025942 Unclassified 1673
240 Ga0207689_10246999 3300025942 Bacteria 1476
241 Ga0207689_10324358 3300025942 Bacteria 1278
242 Ga0207679_10055341 3300025945 Bacteria 2924
243 Ga0207679_11756629 3300025945 Bacteria 567
244 Ga0207651_10132575 3300025960 Bacteria 1910
245 Ga0207712_10057990 3300025961 Bacteria 2734
246 Ga0207668_10073736 3300025972 Bacteria 2447
247 Ga0207703_10639973 3300026035 Bacteria 1008
248 Ga0207703_10684451 3300026035 Bacteria 975
249 Ga0207708_10027603 3300026075 Bacteria 4299
250 Ga0207708_10033869 3300026075 Bacteria 3884
251 Ga0207708_10335430 3300026075 Bacteria 1237
252 Ga0207641_10049955 3300026088 Bacteria 3537
253 Ga0207648_10001352 3300026089 Bacteria 27122
254 Ga0207648_10149988 3300026089 Bacteria 2057
255 Ga0207676_10019461 3300026095 Bacteria 4954
256 Ga0207676_12357664 3300026095 Bacteria 529
257 Ga0207674_10006443 3300026116 Bacteria 13801
258 Ga0207674_10020863 3300026116 Bacteria 7070
259 Ga0207674_10616472 3300026116 Bacteria 1048
260 Ga0207675_100012150 3300026118 Bacteria 8043
261 Ga0207675_100475216 3300026118 Bacteria 1241
262 Ga0207683_10042221 3300026121 Bacteria 3983
263 Ga0207698_10600821 3300026142 Bacteria 1085
264 Ga0209999_1113480 3300027543 Bacteria 530
265 Ga0210002_1059053 3300027617 Bacteria 668
266 Ga0209971_1182077 3300027682 Bacteria 518
267 Ga0209998_10040761 3300027717 Bacteria 1054
268 Ga0209998_10178166 3300027717 Bacteria 552
269 Ga0209974_10132870 3300027876 Bacteria 888
270 Ga0209974_10171184 3300027876 Bacteria 792
271 Ga0207428_10000405 3300027907 Bacteria 53583
272 Ga0207428_10034419 3300027907 Bacteria 4151
273 Ga0207428_10145428 3300027907 Bacteria 1807
274 Ga0207428_10613770 3300027907 Unclassified 783
275 Ga0268266_11534104 3300028379 Bacteria 642
276 Ga0268265_10000349 3300028380 Bacteria 49983
277 Ga0268264_10006355 3300028381 Bacteria 9958
278 Ga0307408_100070944 3300031548 Bacteria 2574
279 Ga0307408_100293201 3300031548 Unclassified 1359
280 Ga0307408_100320962 3300031548 Unclassified 1304
281 Ga0307408_101533244 3300031548 Unclassified 631
282 Ga0307413_11192970 3300031824 Unclassified 661
283 Ga0307413_11243483 3300031824 Unclassified 649
284 Ga0307410_10079940 3300031852 Bacteria 2292
285 Ga0307410_10314464 3300031852 Unclassified 1240
286 Ga0307410_10795103 3300031852 Bacteria 804
287 Ga0307406_10008416 3300031901 Bacteria 5752
288 Ga0307406_10822798 3300031901 Bacteria 785
289 Ga0307407_10187355 3300031903 Bacteria 1376
290 Ga0307412_10073270 3300031911 Bacteria 2342
291 Ga0307412_10462541 3300031911 Bacteria 1048
292 Ga0307409_100623877 3300031995 Bacteria 1068
293 Ga0307409_101220999 3300031995 Bacteria 775
294 Ga0307416_100078462 3300032002 Unclassified 2778
295 Ga0307416_100159019 3300032002 Bacteria 2085
296 Ga0307416_100189513 3300032002 Bacteria 1937
297 Ga0307414_10090322 3300032004 Unclassified 2273
298 Ga0307411_10125374 3300032005 Bacteria 1866
299 Ga0307411_10141895 3300032005 Unclassified 1772
300 Ga0307415_100757150 3300032126 Bacteria 882
301 Ga0373962_0024939 3300035242 Bacteria 1603
302 Ga0395905_0217900 3300037471 Unclassified 1787
303 Ga0439461_0191591 3300041410 Unclassified 546
304 Ga0451807_0728986 3300041486 Bacteria 918
305 Ga0451807_1640287 3300041486 Bacteria 541
306 Ga0450923_005420 3300042125 Bacteria 2060
307 Ga0450898_047090 3300042134 Unclassified 826
308 Ga0439446_0218585 3300042156 Bacteria 649
309 Ga0439434_0074891 3300042435 Unclassified 1069
310 Ga0451577_0164932 3300042876 Bacteria 1996
311 Ga0451577_0324141 3300042876 Bacteria 1397
312 Ga0451577_0738598 3300042876 Unclassified 891
313 Ga0451577_0954447 3300042876 Unclassified 771
314 Ga0453683_0039507 3300044673 Bacteria 2966
315 Ga0453683_0474591 3300044673 Unclassified 810
316 Ga0466963_1065811 3300044694 Bacteria 569
317 Ga0453684_1053969 3300044712 Unclassified 862
318 Ga0451576_0013114 3300045051 Bacteria 9280
319 Ga0451576_0075324 3300045051 Bacteria 3511
320 Ga0451576_0127331 3300045051 Bacteria 2653
321 Ga0451576_0131380 3300045051 Bacteria 2610
322 Ga0451576_0302457 3300045051 Bacteria 1673
323 Ga0451576_0654133 3300045051 Bacteria 1104
324 Ga0451576_1146231 3300045051 Unclassified 813
325 Ga0495584_0403999 3300046491 Unclassified 694
326 Ga0495585_0230469 3300046492 Bacteria 931
327 Ga0495663_0033627 3300046525 Bacteria 1532
328 Ga0495609_0201422 3300046538 Bacteria 832
329 Ga0495621_0046286 3300046539 Bacteria 1543
330 Ga0495621_0057879 3300046539 Bacteria 1400
331 Ga0495621_0381300 3300046539 Unclassified 595
332 Ga0495659_0013953 3300046664 Bacteria 2622
333 Ga0495659_0020989 3300046664 Bacteria 2197
334 Ga0495659_0307664 3300046664 Unclassified 671
335 Ga0495661_0459541 3300046665 Unclassified 612
336 Ga0495669_0075971 3300046684 Bacteria 1537
337 Ga0495669_0369460 3300046684 Bacteria 694
338 Ga0495636_0111597 3300047318 Bacteria 1203
339 Ga0495636_0264204 3300047318 Bacteria 798
340 Ga0496109_1725487 3300048912 Unclassified 560
341 Ga0496113_0463060 3300048916 Unclassified 1019
342 Ga0501298_162094 3300049521 Unclassified 553
343 Ga0501040_0865683 3300049576 Unclassified 654
344 Ga0501046_0000029 3300049580 Bacteria 194168
345 Ga0501046_0418130 3300049580 Bacteria 967
346 Ga0501201_043299 3300049651 Bacteria 546
347 Ga0501081_0037937 3300049743 Bacteria 3289
348 Ga0501272_072363 3300049769 Unclassified 506
349 Ga0501045_0484866 3300049824 Bacteria 918
350 nmdc:mga06z11_692012_c1 3300050494 Bacteria 621
351 nmdc:mga05p37_12164_c1 3300050507 Bacteria 10275
352 nmdc:mga05p37_1454228_c1 3300050507 Unclassified 686
353 nmdc:mga05p37_158272_c1 3300050507 Bacteria 2767
354 nmdc:mga05p37_1646867_c1 3300050507 Bacteria 629
355 nmdc:mga05p37_318710_c1 3300050507 Unclassified 1841
356 nmdc:mga05p37_75583_c1 3300050507 Bacteria 4146
357 nmdc:mga09592_299223_c1 3300050508 Bacteria 1395
358 nmdc:mga09592_83583_c1 3300050508 Bacteria 2721
359 nmdc:mga09592_901057_c1 3300050508 Bacteria 743
360 nmdc:mga0qj67_7450_c1 3300050509 Bacteria 8083
361 nmdc:mga06r32_1653962_c1 3300050510 Bacteria 578
362 nmdc:mga06r32_42508_c1 3300050510 Bacteria 4321
363 nmdc:mga08y16_1632392_c1 3300050511 Unclassified 602
364 nmdc:mga08y16_169612_c1 3300050511 Bacteria 2267
365 nmdc:mga08y16_432461_c1 3300050511 Bacteria 1344
366 nmdc:mga08y16_6805_c1 3300050511 Bacteria 11993
367 nmdc:mga08y16_901_c1 3300050511 Bacteria 28715
368 nmdc:mga0n895_140233_c1 3300050512 Unclassified 2446
369 nmdc:mga0n895_154645_c1 3300050512 Bacteria 2324
370 nmdc:mga0n895_17506_c1 3300050512 Bacteria 6606
371 nmdc:mga0n895_504471_c1 3300050512 Bacteria 1219
372 nmdc:mga0rr50_1896929_c1 3300050513 Unclassified 501
373 nmdc:mga0rr50_433191_c1 3300050513 Bacteria 1113
374 nmdc:mga0rr50_66624_c1 3300050513 Bacteria 2733
375 nmdc:mga0rr50_84742_c1 3300050513 Bacteria 2454
376 nmdc:mga0rr50_85017_c1 3300050513 Bacteria 2451
377 nmdc:mga08x19_655139_c1 3300050514 Unclassified 745
378 nmdc:mga08x19_813901_c1 3300050514 Bacteria 663
379 nmdc:mga0a205_263043_c1 3300050515 Unclassified 1603
380 nmdc:mga0a205_4686_c1 3300050515 Bacteria 12273
381 nmdc:mga0a205_85571_c1 3300050515 Bacteria 3045
382 nmdc:mga0a205_865749_c1 3300050515 Unclassified 751
383 2898795103 2898795034 Bacteria 4294459
384 Ga0495659_0088415
385 SwRhRL2b_contig_2405541
386 JGI25406J46586_10018994
387 Ga0065704_10098118
388 Ga0065715_10377662
389 Ga0065707_10143698
390 Ga0065707_10423096
391 Ga0070690_100037542
392 Ga0070690_100262818
393 Ga0070670_100071746
394 Ga0070670_101445281
395 Ga0070677_10815237
396 Ga0068869_100048793
397 Ga0068869_100547459
398 Ga0070666_10140993
399 Ga0070680_100305951
400 Ga0068868_101553758
401 Ga0070660_100726968
402 Ga0070689_100104063
403 Ga0070689_100399067
404 Ga0070689_101058832
405 Ga0070687_100025619
406 Ga0070687_100027666
407 Ga0070687_101335725
408 Ga0070661_100105886
409 Ga0070661_100354790
410 Ga0070661_101383556
411 Ga0070692_10160443
412 Ga0070692_10192298
413 Ga0070668_100130556
414 Ga0070669_100002851
415 Ga0070669_100743473
416 Ga0070675_100000326
417 Ga0070675_100193602
418 Ga0070675_100427719
419 Ga0070674_100207057
420 Ga0070674_100646383
421 Ga0070673_100084735
422 Ga0070673_100095205
423 Ga0070673_101225082
424 Ga0070688_100057595
425 Ga0070688_100176190
426 Ga0070688_100544224
427 Ga0070659_101731631
428 Ga0070703_10099863
429 Ga0070701_10001183
430 Ga0070701_10044076
431 Ga0070701_10268135
432 Ga0070701_10401274
433 Ga0070701_11294869
434 Ga0070705_100000437
435 Ga0070705_100029087
436 Ga0070705_100042976
437 Ga0070705_100144759
438 Ga0070705_100364133
439 Ga0070705_100840369
440 Ga0070700_100029723
441 Ga0070700_100059344
442 Ga0070700_100166559
443 Ga0070700_100422363
444 Ga0070694_100000687
445 Ga0070694_100051853
446 Ga0070694_101069429
447 Ga0070694_101228396
448 Ga0070708_100064252
449 Ga0070678_100135469
450 Ga0070662_100062876
451 Ga0070662_100119310
452 Ga0070662_100131271
453 Ga0068867_100000357
454 Ga0070685_10318813
455 Ga0070706_100162985
456 Ga0070706_100772183
457 Ga0070707_100128740
458 Ga0070707_100254230
459 Ga0070707_100732889
460 Ga0070698_100001529
461 Ga0070699_100043416
462 Ga0070699_100048296
463 Ga0070699_100060241
464 Ga0070697_100589142
465 Ga0070697_101976463
466 Ga0068853_100923154
467 Ga0068853_102137853
468 Ga0070672_100091527
469 Ga0070686_100080138
470 Ga0070695_100020684
471 Ga0070695_100041376
472 Ga0070695_100109039
473 Ga0070695_101484296
474 Ga0070696_100000238
475 Ga0070696_100021623
476 Ga0070696_100084401
477 Ga0070696_100227814
478 Ga0070696_100930189
479 Ga0070704_100004823
480 Ga0070704_100102767
481 Ga0070704_100118613
482 Ga0070704_100119836
483 Ga0070704_101342611
484 Ga0070664_100181690
485 Ga0070664_100256763
486 Ga0070664_100466938
487 Ga0068857_100009132
488 Ga0068857_100050678
489 Ga0068857_100996394
490 Ga0068854_100142735
491 Ga0070702_100003684
492 Ga0070702_100036258
493 Ga0070702_100414770
494 Ga0070702_100555529
495 Ga0068852_100578815
496 Ga0068859_100001322
497 Ga0068859_100022703
498 Ga0068859_100438310
499 Ga0068859_100480123
500 Ga0068864_100221720
501 Ga0068864_102141558
502 Ga0068866_11199577
503 Ga0068861_100003229
504 Ga0068870_10013233
505 Ga0068870_10021767
506 Ga0068863_100719934
507 Ga0068858_100664771
508 Ga0068858_102426370
509 Ga0068860_100001565
510 Ga0068862_100011322
511 Ga0081539_10001373
512 Ga0075432_10093263
513 Ga0075367_10747935
514 Ga0097621_100137038
515 Ga0097621_100140477
516 Ga0097621_100858676
517 Ga0068871_100136611
518 Ga0075428_100022526
519 Ga0075428_100470350
520 Ga0075428_101648678
521 Ga0075430_100026441
522 Ga0075431_100011776
523 Ga0075433_10000344
524 Ga0075433_10121969
525 Ga0075433_10185007
526 Ga0075433_11081754
527 Ga0075434_100000464
528 Ga0075434_100001216
529 Ga0075434_100128606
530 Ga0075434_100549452
531 Ga0075434_102445869
532 Ga0075429_100093008
533 Ga0075429_100651537
534 Ga0075429_100703454
535 Ga0068865_100171724
536 Ga0068865_100281265
537 Ga0075436_100188492
538 Ga0075436_100784330
539 Ga0097620_100001322
540 Ga0097620_100022704
541 Ga0097620_100438302
542 Ga0097620_100480131
543 Ga0075435_100024510
544 Ga0075435_100037185
545 Ga0075435_100174530
546 Ga0075435_100405017
547 Ga0111539_10000346
548 Ga0111539_10014362
549 Ga0111539_10581097
550 Ga0111539_10634978
551 Ga0111539_10757510
552 Ga0111539_12008969
553 Ga0114129_10010714
554 Ga0114129_10014009
555 Ga0114129_10133135
556 Ga0114129_10160237
557 Ga0114129_10314337
558 Ga0114129_10664009
559 Ga0114129_10704010
560 Ga0114129_11733525
561 Ga0114129_11922332
562 Ga0105243_10025066
563 Ga0105243_10152078
564 Ga0105243_10169876
565 Ga0105242_10101541
566 Ga0105242_11166957
567 Ga0105249_10050165
568 Ga0105246_10529712
569 Ga0157378_10264124
570 Ga0157378_10571025
571 Ga0157375_10050967
572 Ga0157375_10267770
573 Ga0157380_10403742
574 Ga0157380_10562416
575 Ga0157380_10715641
576 Ga0157377_10012094
577 Ga0157377_10021578
578 Ga0157377_10193505
579 Ga0157376_10025886
580 Ga0157376_11198014
581 Ga0207697_10099056
582 Ga0207653_10131473
583 Ga0207653_10387382
584 Ga0207682_10042284
585 Ga0207642_10446658
586 Ga0207688_10313131
587 Ga0207680_10222281
588 Ga0207647_10097144
589 Ga0207643_10005334
590 Ga0207643_10014642
591 Ga0207660_10218175
592 Ga0207660_10319337
593 Ga0207662_10012133
594 Ga0207662_10029397
595 Ga0207657_10645468
596 Ga0207657_10816122
597 Ga0207649_10107229
598 Ga0207649_10455073
599 Ga0207646_10126061
600 Ga0207646_10249464
601 Ga0207646_10423077
602 Ga0207646_10771393
603 Ga0207681_10001063
604 Ga0207659_10000284
605 Ga0207659_10153400
606 Ga0207659_10187211
607 Ga0207690_10292349
608 Ga0207706_10017515
609 Ga0207706_10171352
610 Ga0207686_10012647
611 Ga0207686_10167129
612 Ga0207686_11094442
613 Ga0207709_10081884
614 Ga0207709_10093387
615 Ga0207670_10224994
616 Ga0207670_10481744
617 Ga0207669_10207901
618 Ga0207704_10587728
619 Ga0207691_10055696
620 Ga0207689_10081575
621 Ga0207689_10110754
622 Ga0207689_10194671
623 Ga0207689_10246999
624 Ga0207689_10324358
625 Ga0207679_10055341
626 Ga0207679_11756629
627 Ga0207651_10132575
628 Ga0207712_10057990
629 Ga0207668_10073736
630 Ga0207703_10639973
631 Ga0207703_10684451
632 Ga0207708_10027603
633 Ga0207708_10033869
634 Ga0207708_10335430
635 Ga0207641_10049955
636 Ga0207648_10001352
637 Ga0207648_10149988
638 Ga0207676_10019461
639 Ga0207676_12357664
640 Ga0207674_10006443
641 Ga0207674_10020863
642 Ga0207674_10616472
643 Ga0207675_100012150
644 Ga0207675_100475216
645 Ga0207683_10042221
646 Ga0207698_10600821
647 Ga0209999_1113480
648 Ga0210002_1059053
649 Ga0209971_1182077
650 Ga0209998_10040761
651 Ga0209998_10178166
652 Ga0209974_10132870
653 Ga0209974_10171184
654 Ga0207428_10000405
655 Ga0207428_10034419
656 Ga0207428_10145428
657 Ga0207428_10613770
658 Ga0268266_11534104
659 Ga0268265_10000349
660 Ga0268264_10006355
661 Ga0307408_100070944
662 Ga0307408_100293201
663 Ga0307408_100320962
664 Ga0307408_101533244
665 Ga0307413_11192970
666 Ga0307413_11243483
667 Ga0307410_10079940
668 Ga0307410_10314464
669 Ga0307410_10795103
670 Ga0307406_10008416
671 Ga0307406_10822798
672 Ga0307407_10187355
673 Ga0307412_10073270
674 Ga0307412_10462541
675 Ga0307409_100623877
676 Ga0307409_101220999
677 Ga0307416_100078462
678 Ga0307416_100159019
679 Ga0307416_100189513
680 Ga0307414_10090322
681 Ga0307411_10125374
682 Ga0307411_10141895
683 Ga0307415_100757150
684 Ga0373962_0024939
685 Ga0395905_0217900
686 Ga0439461_0191591
687 Ga0451807_0728986
688 Ga0451807_1640287
689 Ga0450923_005420
690 Ga0450898_047090
691 Ga0439446_0218585
692 Ga0439434_0074891
693 Ga0451577_0164932
694 Ga0451577_0324141
695 Ga0451577_0738598
696 Ga0451577_0954447
697 Ga0453683_0039507
698 Ga0453683_0474591
699 Ga0466963_1065811
700 Ga0453684_1053969
701 Ga0451576_0013114
702 Ga0451576_0075324
703 Ga0451576_0127331
704 Ga0451576_0131380
705 Ga0451576_0302457
706 Ga0451576_0654133
707 Ga0451576_1146231
708 Ga0495584_0403999
709 Ga0495585_0230469
710 Ga0495663_0033627
711 Ga0495609_0201422
712 Ga0495621_0046286
713 Ga0495621_0057879
714 Ga0495621_0381300
715 Ga0495659_0013953
716 Ga0495659_0020989
717 Ga0495659_0307664
718 Ga0495661_0459541
719 Ga0495669_0075971
720 Ga0495669_0369460
721 Ga0495636_0111597
722 Ga0495636_0264204
723 Ga0496109_1725487
724 Ga0496113_0463060
725 Ga0501298_162094
726 Ga0501040_0865683
727 Ga0501046_0000029
728 Ga0501046_0418130
729 Ga0501201_043299
730 Ga0501081_0037937
731 Ga0501272_072363
732 Ga0501045_0484866
733 nmdc:mga06z11_692012_c1
734 nmdc:mga05p37_12164_c1
735 nmdc:mga05p37_1454228_c1
736 nmdc:mga05p37_158272_c1
737 nmdc:mga05p37_1646867_c1
738 nmdc:mga05p37_318710_c1
739 nmdc:mga05p37_75583_c1
740 nmdc:mga09592_299223_c1
741 nmdc:mga09592_83583_c1
742 nmdc:mga09592_901057_c1
743 nmdc:mga0qj67_7450_c1
744 nmdc:mga06r32_1653962_c1
745 nmdc:mga06r32_42508_c1
746 nmdc:mga08y16_1632392_c1
747 nmdc:mga08y16_169612_c1
748 nmdc:mga08y16_432461_c1
749 nmdc:mga08y16_6805_c1
750 nmdc:mga08y16_901_c1
751 nmdc:mga0n895_140233_c1
752 nmdc:mga0n895_154645_c1
753 nmdc:mga0n895_17506_c1
754 nmdc:mga0n895_504471_c1
755 nmdc:mga0rr50_1896929_c1
756 nmdc:mga0rr50_433191_c1
757 nmdc:mga0rr50_66624_c1
758 nmdc:mga0rr50_84742_c1
759 nmdc:mga0rr50_85017_c1
760 nmdc:mga08x19_655139_c1
761 nmdc:mga08x19_813901_c1
762 nmdc:mga0a205_263043_c1
763 nmdc:mga0a205_4686_c1
764 nmdc:mga0a205_85571_c1
765 nmdc:mga0a205_865749_c1
766 2898795103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

19

115

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ww7-assembly1.cif.gz_E structure of the human er membrane protein complex in a lipid nanodisc 0.7151 22 79
8bqs-assembly1.cif.gz_BD cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.6801 31 79
7a0g-assembly1.cif.gz_JJJ structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.5024 9 101
6h2f-assembly1.cif.gz_A structure of the pre-pore ahlb of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.5008 9 101
7tgh-assembly1.cif.gz_T5 cryo-em structure of respiratory super-complex ci+iii2 from tetrahymena thermophila 0.4962 31 101
ID Description Score Start End Superfamily
af_A4I5V7_70_187_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6731 9 72 1.20.5.110
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6457 11 76 1.10.10.1740
af_A0A0B4K6B2_1_102_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6315 9 72 1.20.58.90
af_Q4DMF5_143_245_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.605 9 74 1.20.1280.290
af_Q9LTI3_151_234_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5908 9 67 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A3N1JPQ3-F1-model_v4 deleted 0.9744 6 102
AF-A0A3C1WEP4-F1-model_v4 DUF962 domain-containing protein 0.9566 4 102 GO:0016020
AF-A0A1F8WIN5-F1-model_v4 Permease 0.9528 12 102 GO:0016020
GO:0046521
AF-A0A136KAY9-F1-model_v4 deleted 0.9518 4 97
AF-A0A7Y5GVX5-F1-model_v4 DUF962 domain-containing protein 0.9508 9 98 GO:0016020

Map