F429646

General Info

Members Datasets Scaffolds Average Seq Length
383 232 766 153

Family's Representative Sequence

Representative Sequence 3300035084|Ga0373928_0160075|Ga0373928_0160075_114_617
Length 167
Sequence LQKRPPDQLIGMGRVAGSYGVRGWMKVAPGGGVLETLAGTKEWWIGDRIYRVAEAKVHSATVVAKLDGIENREQALALKGLEVRVRREALPEAEAGHYYLADLVGLEVRSTGGEPLGRVKRFFTNGAQDVMEVVAGERTRLIPWVSAIVKGVDLERGEIVVDWSAEW

Samples

Sample ID Description Type Environment
1 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.48
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373928_0160075 3300035084 Unclassified 629
2 Ga0065707_10204951 3300005295 Bacteria 1293
3 Ga0070676_10289462 3300005328 Bacteria 1106
4 Ga0070690_100060292 3300005330 Bacteria 2441
5 Ga0070690_100345914 3300005330 Bacteria 1078
6 Ga0070670_100218235 3300005331 Bacteria 1659
7 Ga0070677_10056165 3300005333 Bacteria 1609
8 Ga0068869_100117230 3300005334 Bacteria 2032
9 Ga0068869_100145375 3300005334 Bacteria 1834
10 Ga0070680_100055261 3300005336 Bacteria 3244
11 Ga0070680_100227504 3300005336 Bacteria 1575
12 Ga0070680_100474047 3300005336 Bacteria 1070
13 Ga0070680_101511084 3300005336 Bacteria 582
14 Ga0068868_100396204 3300005338 Bacteria 1191
15 Ga0070689_100141558 3300005340 Bacteria 1934
16 Ga0070689_100196065 3300005340 Bacteria 1646
17 Ga0070691_10231753 3300005341 Unclassified 983
18 Ga0070687_100324665 3300005343 Bacteria 985
19 Ga0070692_10030271 3300005345 Bacteria 2705
20 Ga0070668_100039159 3300005347 Bacteria 3625
21 Ga0070669_100003074 3300005353 Bacteria 12006
22 Ga0070675_100133167 3300005354 Bacteria 2120
23 Ga0070675_100433884 3300005354 Bacteria 1176
24 Ga0070675_101425530 3300005354 Bacteria 639
25 Ga0070674_100083031 3300005356 Bacteria 2293
26 Ga0070674_100662193 3300005356 Bacteria 888
27 Ga0070673_100011780 3300005364 Bacteria 5982
28 Ga0070701_10361601 3300005438 Bacteria 909
29 Ga0070711_100353590 3300005439 Bacteria 1182
30 Ga0070705_100001732 3300005440 Bacteria 11349
31 Ga0070705_100002984 3300005440 Bacteria 8362
32 Ga0070700_100023812 3300005441 Bacteria 3586
33 Ga0070700_100062323 3300005441 Bacteria 2355
34 Ga0070700_100521550 3300005441 Bacteria 918
35 Ga0070694_100024030 3300005444 Bacteria 3929
36 Ga0070694_100024574 3300005444 Bacteria 3890
37 Ga0070694_100163407 3300005444 Bacteria 1636
38 Ga0070694_100215751 3300005444 Bacteria 1437
39 Ga0070694_100334153 3300005444 Bacteria 1170
40 Ga0070694_100431390 3300005444 Bacteria 1037
41 Ga0070681_10000131 3300005458 Bacteria 56441
42 Ga0068867_100005602 3300005459 Bacteria 8897
43 Ga0070706_100102924 3300005467 Bacteria 2655
44 Ga0070707_101467234 3300005468 Bacteria 649
45 Ga0070698_100446281 3300005471 Bacteria 1229
46 Ga0070699_100014103 3300005518 Bacteria 6876
47 Ga0070679_100186793 3300005530 Bacteria 2043
48 Ga0070697_100008262 3300005536 Bacteria 8122
49 Ga0070672_100370627 3300005543 Bacteria 1223
50 Ga0070686_100253412 3300005544 Bacteria 1287
51 Ga0070695_100257616 3300005545 Bacteria 1272
52 Ga0070695_100290487 3300005545 Bacteria 1205
53 Ga0070695_100333927 3300005545 Bacteria 1131
54 Ga0070696_100000395 3300005546 Bacteria 26958
55 Ga0070696_100050732 3300005546 Bacteria 2884
56 Ga0070696_100078042 3300005546 Bacteria 2341
57 Ga0070696_100149989 3300005546 Bacteria 1710
58 Ga0070696_100255851 3300005546 Bacteria 1326
59 Ga0070696_100274304 3300005546 Bacteria 1283
60 Ga0070696_100282323 3300005546 Bacteria 1266
61 Ga0070696_100893221 3300005546 Bacteria 737
62 Ga0070696_100927748 3300005546 Bacteria 724
63 Ga0070693_100731961 3300005547 Bacteria 727
64 Ga0070693_100780401 3300005547 Bacteria 707
65 Ga0070704_100029642 3300005549 Bacteria 3657
66 Ga0070704_100105532 3300005549 Bacteria 2133
67 Ga0070704_100836002 3300005549 Bacteria 825
68 Ga0068857_100860603 3300005577 Bacteria 868
69 Ga0068854_100293528 3300005578 Bacteria 1313
70 Ga0070702_100945081 3300005615 Unclassified 678
71 Ga0068861_100005510 3300005719 Bacteria 8573
72 Ga0068861_102274629 3300005719 Bacteria 544
73 Ga0068870_10009685 3300005840 Bacteria 4392
74 Ga0068870_10233289 3300005840 Bacteria 1132
75 Ga0068860_100084940 3300005843 Bacteria 3011
76 Ga0081539_10000770 3300005985 Bacteria 62993
77 Ga0070715_10261839 3300006163 Bacteria 909
78 Ga0070716_100205657 3300006173 Bacteria 1312
79 Ga0070716_100548377 3300006173 Bacteria 861
80 Ga0097621_100001105 3300006237 Bacteria 18836
81 Ga0075428_100068746 3300006844 Bacteria 3874
82 Ga0075428_100965916 3300006844 Bacteria 902
83 Ga0075428_101338343 3300006844 Unclassified 753
84 Ga0075428_101499177 3300006844 Unclassified 706
85 Ga0075428_101862221 3300006844 Bacteria 625
86 Ga0075430_100001800 3300006846 Bacteria 17530
87 Ga0075430_100024689 3300006846 Bacteria 5112
88 Ga0075430_100038008 3300006846 Bacteria 4079
89 Ga0075430_100081371 3300006846 Bacteria 2713
90 Ga0075431_100029683 3300006847 Bacteria 5630
91 Ga0075431_100053977 3300006847 Bacteria 4144
92 Ga0075431_100059978 3300006847 Bacteria 3926
93 Ga0075431_100281894 3300006847 Bacteria 1682
94 Ga0075431_101164315 3300006847 Bacteria 734
95 Ga0075433_10114839 3300006852 Bacteria 2389
96 Ga0075434_100200387 3300006871 Bacteria 2016
97 Ga0075434_100202485 3300006871 Bacteria 2005
98 Ga0075434_101556477 3300006871 Bacteria 670
99 Ga0075429_100039921 3300006880 Bacteria 4084
100 Ga0075429_101053330 3300006880 Bacteria 711
101 Ga0075429_101186126 3300006880 Bacteria 666
102 Ga0068865_100051672 3300006881 Bacteria 2846
103 Ga0068865_100355750 3300006881 Bacteria 1187
104 Ga0075436_100001151 3300006914 Bacteria 17888
105 Ga0075436_100004120 3300006914 Bacteria 9972
106 Ga0075436_100005456 3300006914 Bacteria 8744
107 Ga0075436_100249489 3300006914 Bacteria 1264
108 Ga0075435_100004704 3300007076 Bacteria 9420
109 Ga0075435_100048439 3300007076 Bacteria 3414
110 Ga0075435_100261770 3300007076 Bacteria 1474
111 Ga0075435_100414906 3300007076 Bacteria 1159
112 Ga0075435_101225923 3300007076 Bacteria 656
113 Ga0099794_10078828 3300007265 Bacteria 1622
114 Ga0111539_10045211 3300009094 Bacteria 5271
115 Ga0111539_10078802 3300009094 Bacteria 3875
116 Ga0111539_10609556 3300009094 Bacteria 1271
117 Ga0111539_11082802 3300009094 Bacteria 931
118 Ga0114129_10016126 3300009147 Bacteria 10629
119 Ga0114129_10160549 3300009147 Bacteria 3071
120 Ga0114129_11083607 3300009147 Bacteria 1004
121 Ga0114129_11175395 3300009147 Bacteria 957
122 Ga0114129_11662562 3300009147 Bacteria 780
123 Ga0105243_10004340 3300009148 Bacteria 11230
124 Ga0105242_10942815 3300009176 Bacteria 867
125 Ga0105248_11364560 3300009177 Bacteria 802
126 Ga0105249_10064538 3300009553 Bacteria 3367
127 Ga0105249_12199099 3300009553 Bacteria 624
128 Ga0157378_11417859 3300013297 Bacteria 738
129 Ga0163162_12736201 3300013306 Unclassified 568
130 Ga0157375_10169331 3300013308 Bacteria 2331
131 Ga0157375_12631562 3300013308 Bacteria 601
132 Ga0157380_10003005 3300014326 Bacteria 11480
133 Ga0157377_10436782 3300014745 Bacteria 900
134 Ga0163161_10322651 3300017792 Unclassified 1221
135 Ga0207682_10128705 3300025893 Bacteria 1129
136 Ga0207642_10095342 3300025899 Bacteria 1480
137 Ga0207699_10241516 3300025906 Bacteria 1241
138 Ga0207645_10044905 3300025907 Bacteria 2826
139 Ga0207643_10025127 3300025908 Bacteria 3291
140 Ga0207643_10229462 3300025908 Bacteria 1138
141 Ga0207684_10085003 3300025910 Bacteria 2695
142 Ga0207707_10003705 3300025912 Bacteria 13535
143 Ga0207660_10108007 3300025917 Bacteria 2089
144 Ga0207660_10237623 3300025917 Bacteria 1435
145 Ga0207660_10312246 3300025917 Bacteria 1254
146 Ga0207662_10027954 3300025918 Bacteria 3258
147 Ga0207662_10396371 3300025918 Bacteria 935
148 Ga0207681_10008243 3300025923 Bacteria 6371
149 Ga0207659_10102195 3300025926 Bacteria 2163
150 Ga0207644_11066507 3300025931 Bacteria 679
151 Ga0207686_10478332 3300025934 Bacteria 963
152 Ga0207709_10004189 3300025935 Bacteria 8373
153 Ga0207670_10033625 3300025936 Bacteria 3306
154 Ga0207670_10097597 3300025936 Bacteria 2092
155 Ga0207669_10051884 3300025937 Bacteria 2460
156 Ga0207669_10485354 3300025937 Bacteria 986
157 Ga0207704_10008717 3300025938 Bacteria 4864
158 Ga0207691_10075693 3300025940 Bacteria 3035
159 Ga0207689_10185817 3300025942 Bacteria 1714
160 Ga0207689_10305707 3300025942 Bacteria 1318
161 Ga0207651_10205951 3300025960 Unclassified 1580
162 Ga0207651_10562848 3300025960 Bacteria 992
163 Ga0207712_10074146 3300025961 Bacteria 2456
164 Ga0207712_11603811 3300025961 Bacteria 583
165 Ga0207668_10034182 3300025972 Bacteria 3374
166 Ga0207640_10256722 3300025981 Bacteria 1360
167 Ga0207677_10860151 3300026023 Bacteria 815
168 Ga0207703_10632342 3300026035 Bacteria 1014
169 Ga0207708_10120233 3300026075 Bacteria 2046
170 Ga0207708_10390524 3300026075 Bacteria 1149
171 Ga0207708_10398134 3300026075 Bacteria 1138
172 Ga0207708_11326760 3300026075 Bacteria 630
173 Ga0207648_10177146 3300026089 Bacteria 1886
174 Ga0207676_10095416 3300026095 Bacteria 2453
175 Ga0207674_10154298 3300026116 Bacteria 2252
176 Ga0207674_10625988 3300026116 Bacteria 1039
177 Ga0207675_100009750 3300026118 Bacteria 8991
178 Ga0209967_1010267 3300027364 Bacteria 1303
179 Ga0209981_1005423 3300027378 Bacteria 1694
180 Ga0210000_1010925 3300027462 Bacteria 1345
181 Ga0209995_1009503 3300027471 Bacteria 1573
182 Ga0209995_1019627 3300027471 Bacteria 1116
183 Ga0209999_1003775 3300027543 Bacteria 2717
184 Ga0209983_1020866 3300027665 Bacteria 1368
185 Ga0209971_1001671 3300027682 Bacteria 5485
186 Ga0209966_1003526 3300027695 Bacteria 2635
187 Ga0209974_10008622 3300027876 Bacteria 3478
188 Ga0207428_10200739 3300027907 Bacteria 1501
189 Ga0207428_10311625 3300027907 Bacteria 1163
190 Ga0268265_10005422 3300028380 Bacteria 8725
191 Ga0268265_11813379 3300028380 Bacteria 616
192 Ga0307408_100217069 3300031548 Bacteria 1558
193 Ga0307408_101124946 3300031548 Bacteria 729
194 Ga0307410_10393322 3300031852 Bacteria 1118
195 Ga0307406_10446101 3300031901 Bacteria 1037
196 Ga0307412_10335833 3300031911 Bacteria 1208
197 Ga0307416_100750592 3300032002 Bacteria 1068
198 Ga0307411_10060669 3300032005 Bacteria 2513
199 Ga0373958_0042282 3300034819 Bacteria 936
200 Ga0373938_0041447 3300034957 Bacteria 1024
201 Ga0373926_0013575 3300035083 Bacteria 2764
202 Ga0373928_0111036 3300035084 Unclassified 725
203 Ga0373923_0026680 3300035111 Bacteria 2300
204 Ga0373936_0066694 3300035113 Bacteria 1478
205 Ga0373941_0049137 3300035115 Bacteria 1334
206 Ga0373945_0017764 3300035116 Bacteria 2412
207 Ga0373943_0089946 3300035170 Bacteria 1588
208 Ga0373955_0180125 3300035172 Bacteria 1254
209 Ga0373962_0014050 3300035242 Bacteria 2036
210 Ga0373931_0041307 3300035691 Bacteria 2422
211 Ga0373935_0140071 3300035692 Bacteria 1633
212 Ga0373927_0211277 3300035695 Bacteria 1274
213 Ga0373947_0490158 3300035725 Bacteria 834
214 Ga0373937_0008787 3300036401 Bacteria 8764
215 Ga0395905_0226275 3300037471 Bacteria 1750
216 Ga0439453_0000505 3300041408 Bacteria 4313
217 Ga0439461_0088835 3300041410 Bacteria 739
218 Ga0451839_0926019 3300041496 Bacteria 1061
219 Ga0451849_1358645 3300041505 Bacteria 580
220 Ga0439441_000327 3300042001 Bacteria 4839
221 Ga0439441_002360 3300042001 Bacteria 2651
222 Ga0439463_052316 3300042016 Bacteria 1042
223 Ga0450896_049769 3300042133 Bacteria 666
224 Ga0439446_0113338 3300042156 Bacteria 867
225 Ga0439446_0127915 3300042156 Bacteria 822
226 Ga0439435_0000235 3300042436 Bacteria 7946
227 Ga0439435_0000397 3300042436 Bacteria 6743
228 Ga0439444_0000992 3300042437 Bacteria 3498
229 Ga0439444_0009114 3300042437 Bacteria 1558
230 Ga0451577_0625960 3300042876 Bacteria 976
231 Ga0466960_0053566 3300044901 Bacteria 1956
232 Ga0451576_0003530 3300045051 Bacteria 21338
233 Ga0451576_0108298 3300045051 Bacteria 2891
234 Ga0451576_0787143 3300045051 Bacteria 999
235 Ga0495592_0000402 3300046454 Bacteria 33287
236 Ga0495603_0029498 3300046455 Bacteria 3307
237 Ga0495629_0169655 3300046459 Bacteria 1515
238 Ga0495641_0066287 3300046461 Bacteria 1625
239 Ga0495653_0089342 3300046463 Bacteria 2258
240 Ga0495580_0009866 3300046472 Bacteria 7482
241 Ga0495582_0058693 3300046473 Bacteria 2122
242 Ga0495639_0155954 3300046475 Bacteria 1103
243 Ga0495662_0015981 3300046476 Bacteria 3641
244 Ga0495662_0027304 3300046476 Bacteria 2758
245 Ga0495584_0175227 3300046491 Bacteria 1090
246 Ga0495594_0017869 3300046499 Bacteria 3752
247 Ga0495608_0005156 3300046511 Bacteria 9336
248 Ga0495618_0019090 3300046514 Bacteria 4216
249 Ga0495628_0006934 3300046516 Bacteria 9838
250 Ga0495630_0003354 3300046517 Bacteria 11154
251 Ga0495630_0471320 3300046517 Bacteria 962
252 Ga0495666_0004736 3300046526 Bacteria 6877
253 Ga0495642_0086748 3300046528 Bacteria 1322
254 Ga0495652_0040139 3300046529 Bacteria 4045
255 Ga0495665_0012539 3300046531 Bacteria 4589
256 Ga0495640_0001475 3300046533 Bacteria 18518
257 Ga0495586_0004678 3300046535 Bacteria 7318
258 Ga0495586_0010260 3300046535 Bacteria 4981
259 Ga0495587_0106069 3300046536 Bacteria 1616
260 Ga0495598_0013911 3300046537 Bacteria 2004
261 Ga0495598_0107109 3300046537 Bacteria 932
262 Ga0495598_0216068 3300046537 Bacteria 698
263 Ga0495621_0036552 3300046539 Bacteria 1705
264 Ga0495622_0339309 3300046557 Bacteria 651
265 Ga0495667_0061890 3300046559 Bacteria 2453
266 Ga0495656_0232497 3300046615 Bacteria 925
267 Ga0495634_0002869 3300046642 Bacteria 14135
268 Ga0495634_0098103 3300046642 Bacteria 1896
269 Ga0495635_0557968 3300046663 Bacteria 750
270 Ga0495659_0044646 3300046664 Bacteria 1594
271 Ga0495659_0046773 3300046664 Bacteria 1563
272 Ga0495659_0276354 3300046664 Bacteria 705
273 Ga0495659_0432015 3300046664 Bacteria 571
274 Ga0495588_0097968 3300046674 Bacteria 1539
275 Ga0495599_0167511 3300046678 Bacteria 1356
276 Ga0495647_0000539 3300046681 Bacteria 11116
277 Ga0495658_0000819 3300046683 Bacteria 16670
278 Ga0495658_0004574 3300046683 Bacteria 6807
279 Ga0495658_0245391 3300046683 Bacteria 1125
280 Ga0495613_0006424 3300046689 Bacteria 8788
281 Ga0495624_0115105 3300046690 Bacteria 1653
282 Ga0495600_0014521 3300046809 Bacteria 4964
283 Ga0495581_0728620 3300047315 Bacteria 571
284 Ga0495604_0003865 3300047317 Bacteria 11932
285 Ga0495680_0000735 3300047322 Bacteria 36769
286 Ga0495684_0110356 3300047471 Bacteria 2076
287 Ga0495593_0328900 3300047673 Bacteria 764
288 Ga0501299_011780 3300049522 Bacteria 1482
289 Ga0501299_037653 3300049522 Bacteria 959
290 Ga0501031_0091055 3300049568 Bacteria 1989
291 Ga0501031_0767305 3300049568 Bacteria 619
292 Ga0501034_0245913 3300049571 Bacteria 1734
293 Ga0501036_0467542 3300049572 Bacteria 1050
294 Ga0501036_0793939 3300049572 Bacteria 780
295 Ga0501037_0341181 3300049573 Bacteria 1035
296 Ga0501037_0519312 3300049573 Bacteria 806
297 Ga0501038_0011332 3300049574 Bacteria 8141
298 Ga0501038_1025652 3300049574 Bacteria 605
299 Ga0501039_0050285 3300049575 Bacteria 3224
300 Ga0501039_0229499 3300049575 Bacteria 1459
301 Ga0501039_0623038 3300049575 Bacteria 845
302 Ga0501040_0005896 3300049576 Bacteria 7930
303 Ga0501040_0039070 3300049576 Bacteria 3227
304 Ga0501040_0242370 3300049576 Bacteria 1285
305 Ga0501041_0144103 3300049577 Bacteria 1486
306 Ga0501041_0204072 3300049577 Bacteria 1239
307 Ga0501041_0460079 3300049577 Bacteria 808
308 Ga0501041_0468517 3300049577 Unclassified 800
309 Ga0501042_0005466 3300049578 Bacteria 8183
310 Ga0501042_0065651 3300049578 Bacteria 2593
311 Ga0501042_0134773 3300049578 Bacteria 1781
312 Ga0501042_0555852 3300049578 Bacteria 834
313 Ga0501043_0166409 3300049579 Bacteria 1722
314 Ga0501043_0303202 3300049579 Bacteria 1220
315 Ga0501046_0102756 3300049580 Bacteria 2191
316 Ga0501047_1155245 3300049581 Bacteria 588
317 Ga0501048_0007842 3300049582 Bacteria 8091
318 Ga0501048_0470648 3300049582 Bacteria 900
319 Ga0501067_0118324 3300049583 Bacteria 1474
320 Ga0501068_0065564 3300049584 Bacteria 2211
321 Ga0501069_0203467 3300049585 Bacteria 1148
322 Ga0501070_0738172 3300049586 Bacteria 777
323 Ga0501071_0006924 3300049587 Bacteria 7396
324 Ga0501071_0137832 3300049587 Bacteria 1816
325 Ga0501071_0373492 3300049587 Bacteria 1087
326 Ga0501071_0952810 3300049587 Unclassified 663
327 Ga0501072_0001610 3300049588 Bacteria 16870
328 Ga0501074_0410568 3300049590 Bacteria 960
329 Ga0501075_0012740 3300049591 Bacteria 5983
330 Ga0501075_0069211 3300049591 Bacteria 2667
331 Ga0501076_0001109 3300049592 Bacteria 17761
332 Ga0501207_022131 3300049654 Bacteria 1025
333 Ga0501079_0002363 3300049741 Bacteria 13707
334 Ga0501080_0078327 3300049742 Bacteria 3074
335 Ga0501080_0938012 3300049742 Bacteria 753
336 Ga0501080_1227528 3300049742 Bacteria 644
337 Ga0501081_0040236 3300049743 Bacteria 3200
338 Ga0501083_0375333 3300049744 Bacteria 925
339 Ga0501035_0193461 3300049822 Bacteria 1748
340 Ga0501045_0000911 3300049824 Bacteria 19278
341 Ga0501045_0026543 3300049824 Bacteria 4167
342 nmdc:mga05p37_19955_c1 3300050507 Bacteria 8109
343 nmdc:mga05p37_342613_c1 3300050507 Bacteria 1762
344 nmdc:mga05p37_490294_c1 3300050507 Bacteria 1413
345 nmdc:mga05p37_911498_c1 3300050507 Bacteria 946
346 nmdc:mga09592_114421_c1 3300050508 Bacteria 2316
347 nmdc:mga09592_125305_c1 3300050508 Bacteria 2208
348 nmdc:mga09592_196823_c1 3300050508 Bacteria 1745
349 nmdc:mga09592_444631_c1 3300050508 Bacteria 1119
350 nmdc:mga0qj67_16969_c1 3300050509 Bacteria 5531
351 nmdc:mga0qj67_470563_c1 3300050509 Unclassified 1012
352 nmdc:mga0qj67_620945_c1 3300050509 Bacteria 864
353 nmdc:mga06r32_123554_c1 3300050510 Bacteria 2555
354 nmdc:mga06r32_2510_c1 3300050510 Bacteria 16409
355 nmdc:mga06r32_408544_c1 3300050510 Bacteria 1339
356 nmdc:mga08y16_203251_c1 3300050511 Bacteria 2053
357 nmdc:mga08y16_434530_c1 3300050511 Bacteria 1341
358 nmdc:mga08y16_63867_c1 3300050511 Bacteria 3846
359 nmdc:mga0n895_102058_c1 3300050512 Bacteria 2879
360 nmdc:mga0n895_1391502_c1 3300050512 Bacteria 670
361 nmdc:mga0n895_679118_c1 3300050512 Bacteria 1027
362 nmdc:mga0rr50_1023026_c1 3300050513 Bacteria 704
363 nmdc:mga0rr50_1236628_c1 3300050513 Bacteria 634
364 nmdc:mga0rr50_252525_c1 3300050513 Bacteria 1465
365 nmdc:mga0rr50_260934_c1 3300050513 Bacteria 1441
366 nmdc:mga08x19_15044_c1 3300050514 Bacteria 4700
367 nmdc:mga08x19_210982_c1 3300050514 Bacteria 1333
368 nmdc:mga08x19_2480_c1 3300050514 Bacteria 11226
369 nmdc:mga08x19_37040_c1 3300050514 Bacteria 3093
370 nmdc:mga08x19_81_c1 3300050514 Bacteria 87015
371 nmdc:mga0a205_160819_c1 3300050515 Bacteria 2142
372 nmdc:mga0a205_161413_c1 3300050515 Bacteria 2138
373 nmdc:mga0a205_697235_c1 3300050515 Bacteria 865
374 Ga0495601_0021237 3300053077 Bacteria 3974
375 Ga0495601_0273891 3300053077 Bacteria 1101
376 Ga0501084_0036631 3300054114 Bacteria 4098
377 Ga0590075_068801 3300059424 Bacteria 914
378 Ga0590077_025583 3300059426 Bacteria 1272
379 Ga0590077_069237 3300059426 Bacteria 805
380 Ga0501082_0001630 3300060353 Bacteria 19783
381 Ga0501082_0267638 3300060353 Bacteria 1487
382 Ga0530510_0000091 3300061734 Bacteria 48589
383 Ga0530510_0383756 3300061734 Bacteria 1058
384 Ga0373928_0160075
385 Ga0065707_10204951
386 Ga0070676_10289462
387 Ga0070690_100060292
388 Ga0070690_100345914
389 Ga0070670_100218235
390 Ga0070677_10056165
391 Ga0068869_100117230
392 Ga0068869_100145375
393 Ga0070680_100055261
394 Ga0070680_100227504
395 Ga0070680_100474047
396 Ga0070680_101511084
397 Ga0068868_100396204
398 Ga0070689_100141558
399 Ga0070689_100196065
400 Ga0070691_10231753
401 Ga0070687_100324665
402 Ga0070692_10030271
403 Ga0070668_100039159
404 Ga0070669_100003074
405 Ga0070675_100133167
406 Ga0070675_100433884
407 Ga0070675_101425530
408 Ga0070674_100083031
409 Ga0070674_100662193
410 Ga0070673_100011780
411 Ga0070701_10361601
412 Ga0070711_100353590
413 Ga0070705_100001732
414 Ga0070705_100002984
415 Ga0070700_100023812
416 Ga0070700_100062323
417 Ga0070700_100521550
418 Ga0070694_100024030
419 Ga0070694_100024574
420 Ga0070694_100163407
421 Ga0070694_100215751
422 Ga0070694_100334153
423 Ga0070694_100431390
424 Ga0070681_10000131
425 Ga0068867_100005602
426 Ga0070706_100102924
427 Ga0070707_101467234
428 Ga0070698_100446281
429 Ga0070699_100014103
430 Ga0070679_100186793
431 Ga0070697_100008262
432 Ga0070672_100370627
433 Ga0070686_100253412
434 Ga0070695_100257616
435 Ga0070695_100290487
436 Ga0070695_100333927
437 Ga0070696_100000395
438 Ga0070696_100050732
439 Ga0070696_100078042
440 Ga0070696_100149989
441 Ga0070696_100255851
442 Ga0070696_100274304
443 Ga0070696_100282323
444 Ga0070696_100893221
445 Ga0070696_100927748
446 Ga0070693_100731961
447 Ga0070693_100780401
448 Ga0070704_100029642
449 Ga0070704_100105532
450 Ga0070704_100836002
451 Ga0068857_100860603
452 Ga0068854_100293528
453 Ga0070702_100945081
454 Ga0068861_100005510
455 Ga0068861_102274629
456 Ga0068870_10009685
457 Ga0068870_10233289
458 Ga0068860_100084940
459 Ga0081539_10000770
460 Ga0070715_10261839
461 Ga0070716_100205657
462 Ga0070716_100548377
463 Ga0097621_100001105
464 Ga0075428_100068746
465 Ga0075428_100965916
466 Ga0075428_101338343
467 Ga0075428_101499177
468 Ga0075428_101862221
469 Ga0075430_100001800
470 Ga0075430_100024689
471 Ga0075430_100038008
472 Ga0075430_100081371
473 Ga0075431_100029683
474 Ga0075431_100053977
475 Ga0075431_100059978
476 Ga0075431_100281894
477 Ga0075431_101164315
478 Ga0075433_10114839
479 Ga0075434_100200387
480 Ga0075434_100202485
481 Ga0075434_101556477
482 Ga0075429_100039921
483 Ga0075429_101053330
484 Ga0075429_101186126
485 Ga0068865_100051672
486 Ga0068865_100355750
487 Ga0075436_100001151
488 Ga0075436_100004120
489 Ga0075436_100005456
490 Ga0075436_100249489
491 Ga0075435_100004704
492 Ga0075435_100048439
493 Ga0075435_100261770
494 Ga0075435_100414906
495 Ga0075435_101225923
496 Ga0099794_10078828
497 Ga0111539_10045211
498 Ga0111539_10078802
499 Ga0111539_10609556
500 Ga0111539_11082802
501 Ga0114129_10016126
502 Ga0114129_10160549
503 Ga0114129_11083607
504 Ga0114129_11175395
505 Ga0114129_11662562
506 Ga0105243_10004340
507 Ga0105242_10942815
508 Ga0105248_11364560
509 Ga0105249_10064538
510 Ga0105249_12199099
511 Ga0157378_11417859
512 Ga0163162_12736201
513 Ga0157375_10169331
514 Ga0157375_12631562
515 Ga0157380_10003005
516 Ga0157377_10436782
517 Ga0163161_10322651
518 Ga0207682_10128705
519 Ga0207642_10095342
520 Ga0207699_10241516
521 Ga0207645_10044905
522 Ga0207643_10025127
523 Ga0207643_10229462
524 Ga0207684_10085003
525 Ga0207707_10003705
526 Ga0207660_10108007
527 Ga0207660_10237623
528 Ga0207660_10312246
529 Ga0207662_10027954
530 Ga0207662_10396371
531 Ga0207681_10008243
532 Ga0207659_10102195
533 Ga0207644_11066507
534 Ga0207686_10478332
535 Ga0207709_10004189
536 Ga0207670_10033625
537 Ga0207670_10097597
538 Ga0207669_10051884
539 Ga0207669_10485354
540 Ga0207704_10008717
541 Ga0207691_10075693
542 Ga0207689_10185817
543 Ga0207689_10305707
544 Ga0207651_10205951
545 Ga0207651_10562848
546 Ga0207712_10074146
547 Ga0207712_11603811
548 Ga0207668_10034182
549 Ga0207640_10256722
550 Ga0207677_10860151
551 Ga0207703_10632342
552 Ga0207708_10120233
553 Ga0207708_10390524
554 Ga0207708_10398134
555 Ga0207708_11326760
556 Ga0207648_10177146
557 Ga0207676_10095416
558 Ga0207674_10154298
559 Ga0207674_10625988
560 Ga0207675_100009750
561 Ga0209967_1010267
562 Ga0209981_1005423
563 Ga0210000_1010925
564 Ga0209995_1009503
565 Ga0209995_1019627
566 Ga0209999_1003775
567 Ga0209983_1020866
568 Ga0209971_1001671
569 Ga0209966_1003526
570 Ga0209974_10008622
571 Ga0207428_10200739
572 Ga0207428_10311625
573 Ga0268265_10005422
574 Ga0268265_11813379
575 Ga0307408_100217069
576 Ga0307408_101124946
577 Ga0307410_10393322
578 Ga0307406_10446101
579 Ga0307412_10335833
580 Ga0307416_100750592
581 Ga0307411_10060669
582 Ga0373958_0042282
583 Ga0373938_0041447
584 Ga0373926_0013575
585 Ga0373928_0111036
586 Ga0373923_0026680
587 Ga0373936_0066694
588 Ga0373941_0049137
589 Ga0373945_0017764
590 Ga0373943_0089946
591 Ga0373955_0180125
592 Ga0373962_0014050
593 Ga0373931_0041307
594 Ga0373935_0140071
595 Ga0373927_0211277
596 Ga0373947_0490158
597 Ga0373937_0008787
598 Ga0395905_0226275
599 Ga0439453_0000505
600 Ga0439461_0088835
601 Ga0451839_0926019
602 Ga0451849_1358645
603 Ga0439441_000327
604 Ga0439441_002360
605 Ga0439463_052316
606 Ga0450896_049769
607 Ga0439446_0113338
608 Ga0439446_0127915
609 Ga0439435_0000235
610 Ga0439435_0000397
611 Ga0439444_0000992
612 Ga0439444_0009114
613 Ga0451577_0625960
614 Ga0466960_0053566
615 Ga0451576_0003530
616 Ga0451576_0108298
617 Ga0451576_0787143
618 Ga0495592_0000402
619 Ga0495603_0029498
620 Ga0495629_0169655
621 Ga0495641_0066287
622 Ga0495653_0089342
623 Ga0495580_0009866
624 Ga0495582_0058693
625 Ga0495639_0155954
626 Ga0495662_0015981
627 Ga0495662_0027304
628 Ga0495584_0175227
629 Ga0495594_0017869
630 Ga0495608_0005156
631 Ga0495618_0019090
632 Ga0495628_0006934
633 Ga0495630_0003354
634 Ga0495630_0471320
635 Ga0495666_0004736
636 Ga0495642_0086748
637 Ga0495652_0040139
638 Ga0495665_0012539
639 Ga0495640_0001475
640 Ga0495586_0004678
641 Ga0495586_0010260
642 Ga0495587_0106069
643 Ga0495598_0013911
644 Ga0495598_0107109
645 Ga0495598_0216068
646 Ga0495621_0036552
647 Ga0495622_0339309
648 Ga0495667_0061890
649 Ga0495656_0232497
650 Ga0495634_0002869
651 Ga0495634_0098103
652 Ga0495635_0557968
653 Ga0495659_0044646
654 Ga0495659_0046773
655 Ga0495659_0276354
656 Ga0495659_0432015
657 Ga0495588_0097968
658 Ga0495599_0167511
659 Ga0495647_0000539
660 Ga0495658_0000819
661 Ga0495658_0004574
662 Ga0495658_0245391
663 Ga0495613_0006424
664 Ga0495624_0115105
665 Ga0495600_0014521
666 Ga0495581_0728620
667 Ga0495604_0003865
668 Ga0495680_0000735
669 Ga0495684_0110356
670 Ga0495593_0328900
671 Ga0501299_011780
672 Ga0501299_037653
673 Ga0501031_0091055
674 Ga0501031_0767305
675 Ga0501034_0245913
676 Ga0501036_0467542
677 Ga0501036_0793939
678 Ga0501037_0341181
679 Ga0501037_0519312
680 Ga0501038_0011332
681 Ga0501038_1025652
682 Ga0501039_0050285
683 Ga0501039_0229499
684 Ga0501039_0623038
685 Ga0501040_0005896
686 Ga0501040_0039070
687 Ga0501040_0242370
688 Ga0501041_0144103
689 Ga0501041_0204072
690 Ga0501041_0460079
691 Ga0501041_0468517
692 Ga0501042_0005466
693 Ga0501042_0065651
694 Ga0501042_0134773
695 Ga0501042_0555852
696 Ga0501043_0166409
697 Ga0501043_0303202
698 Ga0501046_0102756
699 Ga0501047_1155245
700 Ga0501048_0007842
701 Ga0501048_0470648
702 Ga0501067_0118324
703 Ga0501068_0065564
704 Ga0501069_0203467
705 Ga0501070_0738172
706 Ga0501071_0006924
707 Ga0501071_0137832
708 Ga0501071_0373492
709 Ga0501071_0952810
710 Ga0501072_0001610
711 Ga0501074_0410568
712 Ga0501075_0012740
713 Ga0501075_0069211
714 Ga0501076_0001109
715 Ga0501207_022131
716 Ga0501079_0002363
717 Ga0501080_0078327
718 Ga0501080_0938012
719 Ga0501080_1227528
720 Ga0501081_0040236
721 Ga0501083_0375333
722 Ga0501035_0193461
723 Ga0501045_0000911
724 Ga0501045_0026543
725 nmdc:mga05p37_19955_c1
726 nmdc:mga05p37_342613_c1
727 nmdc:mga05p37_490294_c1
728 nmdc:mga05p37_911498_c1
729 nmdc:mga09592_114421_c1
730 nmdc:mga09592_125305_c1
731 nmdc:mga09592_196823_c1
732 nmdc:mga09592_444631_c1
733 nmdc:mga0qj67_16969_c1
734 nmdc:mga0qj67_470563_c1
735 nmdc:mga0qj67_620945_c1
736 nmdc:mga06r32_123554_c1
737 nmdc:mga06r32_2510_c1
738 nmdc:mga06r32_408544_c1
739 nmdc:mga08y16_203251_c1
740 nmdc:mga08y16_434530_c1
741 nmdc:mga08y16_63867_c1
742 nmdc:mga0n895_102058_c1
743 nmdc:mga0n895_1391502_c1
744 nmdc:mga0n895_679118_c1
745 nmdc:mga0rr50_1023026_c1
746 nmdc:mga0rr50_1236628_c1
747 nmdc:mga0rr50_252525_c1
748 nmdc:mga0rr50_260934_c1
749 nmdc:mga08x19_15044_c1
750 nmdc:mga08x19_210982_c1
751 nmdc:mga08x19_2480_c1
752 nmdc:mga08x19_37040_c1
753 nmdc:mga08x19_81_c1
754 nmdc:mga0a205_160819_c1
755 nmdc:mga0a205_161413_c1
756 nmdc:mga0a205_697235_c1
757 Ga0495601_0021237
758 Ga0495601_0273891
759 Ga0501084_0036631
760 Ga0590075_068801
761 Ga0590077_025583
762 Ga0590077_069237
763 Ga0501082_0001630
764 Ga0501082_0267638
765 Ga0530510_0000091
766 Ga0530510_0383756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

11

89

0.97

PF05239

PRC

PRC-barrel domain

95

167

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.864 86 152
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8401 1 81
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.7708 1 81
4d7e-assembly2.cif.gz_A an unprecedented nadph domain conformation in lysine monooxygenase nbtg from nocardia farcinica 0.7555 106 131
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7551 86 152
ID Description Score Start End Superfamily
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9335 83 153 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.931 83 152 2.30.30.240
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9307 83 153 2.30.30.240
af_I1KSK3_174_274_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8851 83 153 2.30.30.240
2f1lA02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8734 87 155 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A3C1WIJ6-F1-model_v4 Ribosome maturation factor RimM 0.8491 2 150 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A6I1ZKI3-F1-model_v4 Ribosome maturation factor RimM 0.8417 1 153 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A1F7LYU6-F1-model_v4 Ribosome maturation factor RimM 0.8327 1 153 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A6I1ZKI3-F1-model_v4 Ribosome maturation factor RimM 0.8271 1 153 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A1F7LYU6-F1-model_v4 Ribosome maturation factor RimM 0.8188 1 153 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Map