F429563

General Info

Members Datasets Scaffolds Average Seq Length
383 230 377 473

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008373|Ga0105240_1000837312
Length 537
Sequence VLRPFRLRTFALSSRSSKTWSPRSHAKWPFCTKADFATLDIVANPRHAPSFSPYPESIVKLLSALSLTAVSVFALGAAHAAETRIPDAAVRAAEQLRDRAMNDDTAYKFVEGLTTEVGPRLAAGDNDAKSREWVIAKFKALGFDKVYEEPVSYPKWVRRHEAGAIVAPFAQNLVLAALGHSFPTPAGGLTAEVVRFENLDALKAADPAKVKGKIVYIGFKMQPHKDGHDYGTGSSIRVGGPPLAASKGAAAFLLRSAGTDAKDRMAHTGATGFADAKANGIPAAALSNPDADQLERVLAHGKPVTLKLDLDVGFDGDYTGANVIGEVTGKKHPDQIIDIGGHLDSWDPGTGAIDDAAGVAIAAAAAHLVKQMPQRPDRTIRVIAFANEEAGLYGGKAYAEKHAAEVAKHVLGTESDFGAGPIWRMSASVKPEARAAIAQIAAVLKPIGVDYDDKKPGGGGSDLSQMHAKGMAALTLLQDGTHYFDIHHTANDTLDKIDPKELAQNVAVYATWTYLAAQAEGDFGSAPGAFAKDNGEE

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
3 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
4 2919513703 Luteimonas sp. 3794 Isolate Unclassified
5 2919675420 Luteimonas terrae 4099 Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.26
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 4.18
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003893 3300001979 Bacteria 6481
2 JGI24740J21852_10005928 3300001979 Bacteria 5119
3 JGI24737J22298_10007427 3300001990 Bacteria 3701
4 JGI24738J21930_10000118 3300002075 Bacteria 18730
5 JGI25162J39368_1000360 3300002737 Bacteria 38829
6 rootL2_10144909 3300003322 Bacteria 8766
7 Ga0065165_1000913 3300005262 Bacteria 38106
8 Ga0065714_10014670 3300005288 Bacteria 2936
9 Ga0065715_10000370 3300005293 Bacteria 13372
10 Ga0065715_10004139 3300005293 Bacteria 4364
11 Ga0070676_10005808 3300005328 Bacteria 6579
12 Ga0070676_10009336 3300005328 Bacteria 5305
13 Ga0070683_100037011 3300005329 Bacteria 4465
14 Ga0070670_100001146 3300005331 Bacteria 21026
15 Ga0070670_100001912 3300005331 Bacteria 17058
16 Ga0070670_100017386 3300005331 Bacteria 6169
17 Ga0070670_100048114 3300005331 Bacteria 3669
18 Ga0070677_10000430 3300005333 Bacteria 14476
19 Ga0068869_100018323 3300005334 Bacteria 4764
20 Ga0070666_10000023 3300005335 Bacteria 161603
21 Ga0070666_10001153 3300005335 Bacteria 16042
22 Ga0070666_10062912 3300005335 Bacteria 2515
23 Ga0070680_100133330 3300005336 Bacteria 2079
24 Ga0070682_100055174 3300005337 Bacteria 2495
25 Ga0068868_100034060 3300005338 Bacteria 3930
26 Ga0068868_100055590 3300005338 Bacteria 3123
27 Ga0070691_10000860 3300005341 Bacteria 12285
28 Ga0070668_100000010 3300005347 Bacteria 132833
29 Ga0070668_100004333 3300005347 Bacteria 10526
30 Ga0070668_100055291 3300005347 Bacteria 3063
31 Ga0070669_100008737 3300005353 Bacteria 7227
32 Ga0070669_100017171 3300005353 Bacteria 5164
33 Ga0070675_100002570 3300005354 Bacteria 13593
34 Ga0070671_100084080 3300005355 Bacteria 2661
35 Ga0070671_100167791 3300005355 Bacteria 1856
36 Ga0070674_100024727 3300005356 Bacteria 3901
37 Ga0070673_100109910 3300005364 Bacteria 2285
38 Ga0070659_100027120 3300005366 Bacteria 4410
39 Ga0070667_100002680 3300005367 Bacteria 15408
40 Ga0070667_100003453 3300005367 Bacteria 13463
41 Ga0070667_100078353 3300005367 Bacteria 2823
42 Ga0070667_100168875 3300005367 Bacteria 1930
43 Ga0070711_100000213 3300005439 Bacteria 30586
44 Ga0070694_100103767 3300005444 Bacteria 2015
45 Ga0070708_100009847 3300005445 Bacteria 7720
46 Ga0070663_100012612 3300005455 Bacteria 5356
47 Ga0070663_100101179 3300005455 Bacteria 2150
48 Ga0070678_100018052 3300005456 Bacteria 4562
49 Ga0070678_100063676 3300005456 Bacteria 2729
50 Ga0070662_100001494 3300005457 Bacteria 14387
51 Ga0070662_100001779 3300005457 Bacteria 13271
52 Ga0068867_100016022 3300005459 Bacteria 5322
53 Ga0068867_100081008 3300005459 Bacteria 2446
54 Ga0070685_10000386 3300005466 Bacteria 26505
55 Ga0070699_100124316 3300005518 Unclassified 2270
56 Ga0070679_100091109 3300005530 Bacteria 3037
57 Ga0070684_100005253 3300005535 Bacteria 9910
58 Ga0070697_100004946 3300005536 Bacteria 10229
59 Ga0068853_100001040 3300005539 Bacteria 19607
60 Ga0068853_100001130 3300005539 Bacteria 18915
61 Ga0068853_100006884 3300005539 Bacteria 9074
62 Ga0068853_100070566 3300005539 Bacteria 3041
63 Ga0070672_100001865 3300005543 Bacteria 13165
64 Ga0070672_100039343 3300005543 Bacteria 3622
65 Ga0070696_100038203 3300005546 Bacteria 3313
66 Ga0070665_100000242 3300005548 Bacteria 90566
67 Ga0070665_100003754 3300005548 Bacteria 16079
68 Ga0070665_100022204 3300005548 Bacteria 6384
69 Ga0070665_100079322 3300005548 Bacteria 3289
70 Ga0070665_100097206 3300005548 Bacteria 2949
71 Ga0070665_100256850 3300005548 Bacteria 1748
72 Ga0068855_100009258 3300005563 Bacteria 11899
73 Ga0068855_100038563 3300005563 Bacteria 5677
74 Ga0068855_100064659 3300005563 Bacteria 4266
75 Ga0068855_100147065 3300005563 Bacteria 2682
76 Ga0070664_100038681 3300005564 Bacteria 4017
77 Ga0070664_100058591 3300005564 Bacteria 3276
78 Ga0068857_100065328 3300005577 Bacteria 3235
79 Ga0068854_100004796 3300005578 Bacteria 8531
80 Ga0068856_100040668 3300005614 Bacteria 4567
81 Ga0068856_100086037 3300005614 Bacteria 3123
82 Ga0068859_100008008 3300005617 Bacteria 10714
83 Ga0068859_100220755 3300005617 Bacteria 1983
84 Ga0068859_100245019 3300005617 Bacteria 1882
85 Ga0068864_100129247 3300005618 Bacteria 2267
86 Ga0068851_10095164 3300005834 Bacteria 1573
87 Ga0068863_100000192 3300005841 Bacteria 64858
88 Ga0068863_100007347 3300005841 Bacteria 10785
89 Ga0068858_100016875 3300005842 Bacteria 6856
90 Ga0068860_100079992 3300005843 Bacteria 3108
91 Ga0068860_100193439 3300005843 Bacteria 1969
92 Ga0081540_1012187 3300005983 Bacteria 5685
93 Ga0070716_100072907 3300006173 Bacteria 2024
94 Ga0070712_100002507 3300006175 Bacteria 11321
95 Ga0075366_10094111 3300006195 Bacteria 1796
96 Ga0068871_100021042 3300006358 Bacteria 5007
97 Ga0075431_100043025 3300006847 Bacteria 4660
98 Ga0075429_100031963 3300006880 Bacteria 4576
99 Ga0097620_100008008 3300006931 Bacteria 10714
100 Ga0097620_100245016 3300006931 Bacteria 1882
101 Ga0105240_10000453 3300009093 Bacteria 75454
102 Ga0105240_10000868 3300009093 Bacteria 54479
103 Ga0105240_10008373 3300009093 Bacteria 14800
104 Ga0105240_10094462 3300009093 Bacteria 3647
105 Ga0105240_10201786 3300009093 Bacteria 2330
106 Ga0111539_10014598 3300009094 Bacteria 9804
107 Ga0105247_10016742 3300009101 Bacteria 4396
108 Ga0105243_10005369 3300009148 Bacteria 9999
109 Ga0105241_10076177 3300009174 Bacteria 2615
110 Ga0105241_10102872 3300009174 Bacteria 2274
111 Ga0105248_10105742 3300009177 Bacteria 3173
112 Ga0105237_10000036 3300009545 Bacteria 191142
113 Ga0105237_10065777 3300009545 Bacteria 3620
114 Ga0105237_10121489 3300009545 Bacteria 2606
115 Ga0105238_10008158 3300009551 Bacteria 10475
116 Ga0105238_10057826 3300009551 Bacteria 3887
117 Ga0105238_10094149 3300009551 Bacteria 2983
118 Ga0105238_10144654 3300009551 Bacteria 2354
119 Ga0105249_10036784 3300009553 Bacteria 4441
120 Ga0105249_10041721 3300009553 Bacteria 4172
121 Ga0105249_10045606 3300009553 Bacteria 3988
122 Ga0105239_10009641 3300010375 Bacteria 10860
123 Ga0105239_10077799 3300010375 Bacteria 3651
124 Ga0157371_10009125 3300013102 Bacteria 7834
125 Ga0157371_10058202 3300013102 Bacteria 2741
126 Ga0157370_10093305 3300013104 Bacteria 2825
127 Ga0157369_10002396 3300013105 Bacteria 22523
128 Ga0157369_10087659 3300013105 Bacteria 3323
129 Ga0157374_10015323 3300013296 Bacteria 6724
130 Ga0157374_10020266 3300013296 Bacteria 5899
131 Ga0157374_10087489 3300013296 Bacteria 2966
132 Ga0163162_10000042 3300013306 Bacteria 131540
133 Ga0163162_10000661 3300013306 Bacteria 31916
134 Ga0163162_10032532 3300013306 Bacteria 5181
135 Ga0163162_10167465 3300013306 Bacteria 2321
136 Ga0163162_10177319 3300013306 Bacteria 2257
137 Ga0157372_10011769 3300013307 Bacteria 9318
138 Ga0157372_10364097 3300013307 Bacteria 1685
139 Ga0157375_10024351 3300013308 Bacteria 5601
140 Ga0157375_10025199 3300013308 Bacteria 5521
141 Ga0157380_10001232 3300014326 Bacteria 16609
142 Ga0157379_10015473 3300014968 Bacteria 6695
143 Ga0157379_10049278 3300014968 Bacteria 3760
144 Ga0157379_10198035 3300014968 Unclassified 1816
145 Ga0163161_10014477 3300017792 Bacteria 5492
146 Ga0163161_10022306 3300017792 Bacteria 4457
147 Ga0163161_10066669 3300017792 Bacteria 2629
148 Ga0206356_11030950 3300020070 Bacteria 3035
149 Ga0209674_100556 3300025226 Bacteria 14827
150 Ga0209148_1002007 3300025254 Bacteria 7975
151 Ga0209759_1002084 3300025256 Bacteria 9331
152 Ga0209129_1000697 3300025258 Bacteria 22024
153 Ga0209233_1001897 3300025261 Bacteria 8020
154 Ga0209051_1018017 3300025303 Bacteria 3139
155 Ga0209257_1022237 3300025304 Bacteria 2269
156 Ga0207697_10003482 3300025315 Bacteria 7770
157 Ga0207682_10001260 3300025893 Bacteria 11713
158 Ga0207642_10007350 3300025899 Bacteria 3716
159 Ga0207688_10009238 3300025901 Bacteria 5373
160 Ga0207680_10002268 3300025903 Bacteria 8961
161 Ga0207680_10064873 3300025903 Bacteria 2240
162 Ga0207647_10000066 3300025904 Bacteria 81782
163 Ga0207645_10006206 3300025907 Bacteria 8586
164 Ga0207645_10018285 3300025907 Bacteria 4615
165 Ga0207684_10004327 3300025910 Bacteria 13426
166 Ga0207654_10073662 3300025911 Bacteria 2036
167 Ga0207695_10000172 3300025913 Bacteria 190573
168 Ga0207695_10012023 3300025913 Bacteria 10412
169 Ga0207695_10023972 3300025913 Bacteria 6881
170 Ga0207695_10031281 3300025913 Bacteria 5840
171 Ga0207671_10001404 3300025914 Bacteria 28043
172 Ga0207693_10004449 3300025915 Bacteria 11843
173 Ga0207663_10006575 3300025916 Bacteria 5966
174 Ga0207660_10052124 3300025917 Bacteria 2912
175 Ga0207657_10005336 3300025919 Bacteria 13464
176 Ga0207657_10005796 3300025919 Bacteria 12870
177 Ga0207657_10012306 3300025919 Bacteria 8455
178 Ga0207649_10012580 3300025920 Bacteria 4699
179 Ga0207652_10018199 3300025921 Bacteria 5759
180 Ga0207652_10222339 3300025921 Bacteria 1701
181 Ga0207681_10000980 3300025923 Bacteria 18650
182 Ga0207681_10033357 3300025923 Bacteria 3375
183 Ga0207681_10061958 3300025923 Bacteria 2574
184 Ga0207694_10000308 3300025924 Bacteria 45953
185 Ga0207650_10000537 3300025925 Bacteria 30997
186 Ga0207650_10002481 3300025925 Bacteria 12831
187 Ga0207650_10006496 3300025925 Bacteria 7969
188 Ga0207687_10000509 3300025927 Bacteria 26200
189 Ga0207644_10156670 3300025931 Bacteria 1767
190 Ga0207690_10007160 3300025932 Bacteria 6627
191 Ga0207690_10019418 3300025932 Bacteria 4184
192 Ga0207706_10000415 3300025933 Bacteria 45662
193 Ga0207706_10003438 3300025933 Bacteria 15120
194 Ga0207686_10117624 3300025934 Bacteria 1804
195 Ga0207704_10058351 3300025938 Bacteria 2376
196 Ga0207691_10006421 3300025940 Bacteria 11361
197 Ga0207711_10000892 3300025941 Bacteria 28721
198 Ga0207689_10025732 3300025942 Bacteria 4930
199 Ga0207689_10166786 3300025942 Bacteria 1815
200 Ga0207661_10007878 3300025944 Bacteria 7591
201 Ga0207661_10012276 3300025944 Bacteria 6221
202 Ga0207667_10009556 3300025949 Bacteria 11412
203 Ga0207667_10012830 3300025949 Bacteria 9629
204 Ga0207667_10177398 3300025949 Bacteria 2189
205 Ga0207651_10004533 3300025960 Bacteria 7021
206 Ga0207712_10000589 3300025961 Bacteria 29134
207 Ga0207712_10008952 3300025961 Bacteria 6331
208 Ga0207712_10026173 3300025961 Bacteria 3884
209 Ga0207668_10000020 3300025972 Bacteria 140737
210 Ga0207668_10001025 3300025972 Bacteria 16716
211 Ga0207668_10029007 3300025972 Bacteria 3624
212 Ga0207668_10094294 3300025972 Bacteria 2207
213 Ga0207640_10060496 3300025981 Bacteria 2504
214 Ga0207658_10029760 3300025986 Bacteria 3860
215 Ga0207677_10081819 3300026023 Bacteria 2319
216 Ga0207703_10004533 3300026035 Bacteria 11391
217 Ga0207639_10001429 3300026041 Bacteria 16142
218 Ga0207639_10028578 3300026041 Bacteria 4073
219 Ga0207639_10042503 3300026041 Bacteria 3406
220 Ga0207639_10050016 3300026041 Bacteria 3172
221 Ga0207639_10056004 3300026041 Bacteria 3020
222 Ga0207678_10000577 3300026067 Bacteria 33572
223 Ga0207678_10000605 3300026067 Bacteria 32938
224 Ga0207678_10055150 3300026067 Bacteria 3423
225 Ga0207678_10069017 3300026067 Bacteria 3031
226 Ga0207702_10006322 3300026078 Bacteria 10234
227 Ga0207702_10042381 3300026078 Bacteria 3818
228 Ga0207641_10000074 3300026088 Bacteria 145908
229 Ga0207648_10018259 3300026089 Bacteria 6353
230 Ga0207648_10039257 3300026089 Bacteria 4163
231 Ga0207674_10001374 3300026116 Bacteria 31441
232 Ga0207674_10047073 3300026116 Bacteria 4424
233 Ga0207674_10068142 3300026116 Bacteria 3581
234 Ga0207674_10113220 3300026116 Bacteria 2686
235 Ga0207674_10132842 3300026116 Bacteria 2452
236 Ga0207674_10147057 3300026116 Bacteria 2315
237 Ga0207674_10178213 3300026116 Bacteria 2077
238 Ga0207675_100005627 3300026118 Bacteria 11998
239 Ga0207683_10015266 3300026121 Bacteria 6537
240 Ga0207683_10123231 3300026121 Bacteria 2328
241 Ga0209983_1002121 3300027665 Bacteria 4372
242 Ga0209974_10008722 3300027876 Bacteria 3455
243 Ga0268266_10000008 3300028379 Bacteria 1161875
244 Ga0268266_10013106 3300028379 Bacteria 7149
245 Ga0268265_10003381 3300028380 Bacteria 11486
246 Ga0268265_10162732 3300028380 Bacteria 1898
247 Ga0307517_10115437 3300028786 Bacteria 2015
248 Ga0265316_10000552 3300031344 Bacteria 42074
249 Ga0307408_100160178 3300031548 Bacteria 1787
250 Ga0307508_10036161 3300031616 Bacteria 4447
251 Ga0265314_10001011 3300031711 Bacteria 32906
252 Ga0307516_10001780 3300031730 Bacteria 29615
253 Ga0307410_10003696 3300031852 Bacteria 7738
254 Ga0307412_10041496 3300031911 Bacteria 2983
255 Ga0307409_100126573 3300031995 Bacteria 2174
256 Ga0307414_10000640 3300032004 Bacteria 17949
257 Ga0307415_100014957 3300032126 Bacteria 4580
258 Ga0373928_0006120 3300035084 Bacteria 2310
259 Ga0373927_0178357 3300035695 Bacteria 1393
260 Ga0373937_0001423 3300036401 Bacteria 19994
261 Ga0395900_0030887 3300037418 Bacteria 5502
262 Ga0395900_0068191 3300037418 Bacteria 3655
263 Ga0395900_0108495 3300037418 Bacteria 2852
264 Ga0395900_0200432 3300037418 Bacteria 2020
265 Ga0395898_0029476 3300037466 Bacteria 5497
266 Ga0395905_0001986 3300037471 Bacteria 23373
267 Ga0395905_0051408 3300037471 Bacteria 3860
268 Ga0395905_0067884 3300037471 Bacteria 3340
269 Ga0395905_0113384 3300037471 Bacteria 2547
270 Ga0395905_0242233 3300037471 Bacteria 1685
271 Ga0395905_0268583 3300037471 Bacteria 1591
272 Ga0395901_0016958 3300038443 Bacteria 7423
273 Ga0451793_1028672 3300041452 Bacteria 4983
274 Ga0451807_0280975 3300041486 Bacteria 2447
275 Ga0451837_1074998 3300041494 Bacteria 4363
276 Ga0439445_0000425 3300042004 Bacteria 8490
277 Ga0439440_0003042 3300042993 Bacteria 3199
278 Ga0466972_0018052 3300044658 Bacteria 3528
279 Ga0466972_0018289 3300044658 Bacteria 3502
280 Ga0466961_0048928 3300044693 Bacteria 2702
281 Ga0466963_0022243 3300044694 Bacteria 4013
282 Ga0466963_0030922 3300044694 Bacteria 3458
283 Ga0466970_0042490 3300044765 Bacteria 2418
284 Ga0466970_0066462 3300044765 Bacteria 1935
285 Ga0466958_0016285 3300045836 Bacteria 4278
286 Ga0466958_0021438 3300045836 Bacteria 3776
287 Ga0466958_0051702 3300045836 Bacteria 2488
288 Ga0466967_0098032 3300045976 Bacteria 2676
289 Ga0466967_0167175 3300045976 Bacteria 2067
290 Ga0495638_0000071 3300046460 Bacteria 166300
291 Ga0495638_0023689 3300046460 Bacteria 4011
292 Ga0495650_0001249 3300046471 Bacteria 26263
293 Ga0495580_0010286 3300046472 Bacteria 7297
294 Ga0495606_0008027 3300046507 Bacteria 9269
295 Ga0495616_0000128 3300046513 Bacteria 66249
296 Ga0495632_0033484 3300046519 Bacteria 2638
297 Ga0495621_0012646 3300046539 Bacteria 2634
298 Ga0495621_0013094 3300046539 Bacteria 2601
299 Ga0496100_0081862 3300048903 Unclassified 2182
300 Ga0496101_0064720 3300048904 Bacteria 2664
301 Ga0496101_0239423 3300048904 Bacteria 1412
302 Ga0496102_0079320 3300048905 Bacteria 3023
303 Ga0496103_0003328 3300048906 Bacteria 9832
304 Ga0496103_0059374 3300048906 Bacteria 2376
305 Ga0496104_0024451 3300048907 Bacteria 5555
306 Ga0496106_0067254 3300048909 Bacteria 2731
307 Ga0496108_0096433 3300048911 Bacteria 2519
308 Ga0496108_0103696 3300048911 Bacteria 2427
309 Ga0496110_0099774 3300048913 Bacteria 2603
310 Ga0496112_0040575 3300048915 Bacteria 4551
311 Ga0496113_0053256 3300048916 Bacteria 3025
312 Ga0496114_0179798 3300048917 Bacteria 1847
313 Ga0496118_0006022 3300048921 Bacteria 13511
314 Ga0496121_0047767 3300048924 Bacteria 3648
315 Ga0496122_0004243 3300048925 Bacteria 17977
316 Ga0496123_0002066 3300048926 Bacteria 25899
317 Ga0496124_0000052 3300048927 Bacteria 252750
318 Ga0496124_0018373 3300048927 Bacteria 6549
319 Ga0501032_0002036 3300049569 Bacteria 15952
320 Ga0501032_0003170 3300049569 Bacteria 12659
321 Ga0501032_0033949 3300049569 Bacteria 3494
322 Ga0501033_0003002 3300049570 Bacteria 14086
323 Ga0501033_0003081 3300049570 Bacteria 13854
324 Ga0501034_0001904 3300049571 Bacteria 26429
325 Ga0501034_0051510 3300049571 Bacteria 4150
326 Ga0501034_0055913 3300049571 Bacteria 3971
327 Ga0501034_0108331 3300049571 Bacteria 2769
328 Ga0501036_0052580 3300049572 Bacteria 3449
329 Ga0501036_0053627 3300049572 Bacteria 3414
330 Ga0501037_0000948 3300049573 Bacteria 21559
331 Ga0501037_0102156 3300049573 Bacteria 2068
332 Ga0501038_0000712 3300049574 Bacteria 29729
333 Ga0501038_0004188 3300049574 Bacteria 13395
334 Ga0501038_0065003 3300049574 Bacteria 3109
335 Ga0501039_0007044 3300049575 Bacteria 8558
336 Ga0501039_0032571 3300049575 Bacteria 4019
337 Ga0501039_0102966 3300049575 Bacteria 2228
338 Ga0501039_0115009 3300049575 Bacteria 2105
339 Ga0501040_0013160 3300049576 Bacteria 5441
340 Ga0501042_0037745 3300049578 Bacteria 3429
341 Ga0501043_0005297 3300049579 Bacteria 10428
342 Ga0501043_0032363 3300049579 Bacteria 4111
343 Ga0501046_0013710 3300049580 Bacteria 6854
344 Ga0501046_0028083 3300049580 Bacteria 4584
345 Ga0501047_0020575 3300049581 Bacteria 6336
346 Ga0501047_0036088 3300049581 Bacteria 4776
347 Ga0501047_0082309 3300049581 Bacteria 3094
348 Ga0501047_0131717 3300049581 Bacteria 2380
349 Ga0501048_0026548 3300049582 Bacteria 4216
350 Ga0501067_0026748 3300049583 Bacteria 3194
351 Ga0501069_0029897 3300049585 Bacteria 2990
352 Ga0501070_0008039 3300049586 Bacteria 8930
353 Ga0501070_0008908 3300049586 Bacteria 8483
354 Ga0501070_0056768 3300049586 Bacteria 3245
355 Ga0501070_0096593 3300049586 Bacteria 2444
356 Ga0501071_0004988 3300049587 Bacteria 8483
357 Ga0501071_0099729 3300049587 Bacteria 2140
358 Ga0501072_0048687 3300049588 Bacteria 3337
359 Ga0501073_0001226 3300049589 Bacteria 18704
360 Ga0501073_0029761 3300049589 Bacteria 3903
361 Ga0501074_0009561 3300049590 Bacteria 7039
362 Ga0501080_0013444 3300049742 Bacteria 7530
363 Ga0501080_0045549 3300049742 Bacteria 4083
364 Ga0501035_0001396 3300049822 Bacteria 24796
365 Ga0501035_0058247 3300049822 Bacteria 3443
366 Ga0501044_0078413 3300049823 Bacteria 3347
367 nmdc:mga00v17_118180_c1 3300050491 Bacteria 1687
368 nmdc:mga06r32_3606_c1 3300050510 Bacteria 13817
369 nmdc:mga08y16_30716_c1 3300050511 Bacteria 5650
370 Ga0500610_0011011 3300053079 Bacteria 4098
371 Ga0500651_0014757 3300053093 Bacteria 4783
372 Ga0500616_0000073 3300053153 Bacteria 231290
373 Ga0500616_0007454 3300053153 Bacteria 6948
374 Ga0500622_0003525 3300053156 Bacteria 10378
375 Ga0501084_0012807 3300054114 Bacteria 6948
376 Ga0501082_0018364 3300060353 Bacteria 6022
377 Ga0466962_0001188 3300061719 Bacteria 12013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0178357 Ga0373927_0178357_88_1242 384
2 3300045836 Ga0466958_0021438 Ga0466958_0021438_2556_3728 390
3 3300046472 Ga0495580_0010286 Ga0495580_0010286_5938_7224 417
4 3300005546 Ga0070696_100038203 Ga0070696_1000382033 429
5 3300025917 Ga0207660_10052124 Ga0207660_100521242 429
6 3300050510 nmdc:mga06r32_3606_c1 nmdc:mga06r32_3606_c1_6538_8040 429
7 3300006847 Ga0075431_100043025 Ga0075431_1000430252 430
8 3300046460 Ga0495638_0023689 Ga0495638_0023689_107_1495 433
9 3300013307 Ga0157372_10364097 Ga0157372_103640971 436
10 3300048925 Ga0496122_0004243 Ga0496122_0004243_16305_17729 439
11 3300048926 Ga0496123_0002066 Ga0496123_0002066_16874_18298 439
12 3300048927 Ga0496124_0018373 Ga0496124_0018373_906_2330 439
13 3300053156 Ga0500622_0003525 Ga0500622_0003525_6290_7684 439
14 3300036401 Ga0373937_0001423 Ga0373937_0001423_17519_18892 440
15 3300048904 Ga0496101_0239423 Ga0496101_0239423_44_1402 441
16 3300006880 Ga0075429_100031963 Ga0075429_1000319633 442
17 3300026078 Ga0207702_10042381 Ga0207702_100423812 442
18 3300037418 Ga0395900_0108495 Ga0395900_0108495_1186_2586 442
19 3300045976 Ga0466967_0098032 Ga0466967_0098032_1011_2417 443
20 3300061719 Ga0466962_0001188 Ga0466962_0001188_10189_11595 443
21 3300050491 nmdc:mga00v17_118180_c1 nmdc:mga00v17_118180_c1_33_1478 444
22 3300032004 Ga0307414_10000640 Ga0307414_100006405 446
23 3300005548 Ga0070665_100079322 Ga0070665_1000793222 447
24 3300013296 Ga0157374_10020266 Ga0157374_100202662 448
25 3300013306 Ga0163162_10000661 Ga0163162_1000066119 448
26 3300014968 Ga0157379_10198035 Ga0157379_101980351 448
27 3300037471 Ga0395905_0268583 Ga0395905_0268583_112_1512 448
28 3300026041 Ga0207639_10028578 Ga0207639_100285784 449
29 3300031911 Ga0307412_10041496 Ga0307412_100414965 449
30 3300032126 Ga0307415_100014957 Ga0307415_1000149573 449
31 3300005353 Ga0070669_100008737 Ga0070669_1000087377 451
32 3300005355 Ga0070671_100167791 Ga0070671_1001677912 451
33 3300005459 Ga0068867_100016022 Ga0068867_1000160223 451
34 3300025923 Ga0207681_10061958 Ga0207681_100619582 451
35 3300025931 Ga0207644_10156670 Ga0207644_101566702 451
36 3300026089 Ga0207648_10018259 Ga0207648_100182594 451
37 3300028786 Ga0307517_10115437 Ga0307517_101154372 451
38 3300046539 Ga0495621_0013094 Ga0495621_0013094_43_1446 451
39 3300005293 Ga0065715_10004139 Ga0065715_100041392 452
40 3300006173 Ga0070716_100072907 Ga0070716_1000729072 452
41 3300014968 Ga0157379_10049278 Ga0157379_100492782 452
42 3300044693 Ga0466961_0048928 Ga0466961_0048928_372_1778 452
43 3300048905 Ga0496102_0079320 Ga0496102_0079320_939_2369 452
44 3300048906 Ga0496103_0003328 Ga0496103_0003328_755_2185 452
45 3300048907 Ga0496104_0024451 Ga0496104_0024451_2069_3499 452
46 3300048909 Ga0496106_0067254 Ga0496106_0067254_916_2346 452
47 3300045836 Ga0466958_0051702 Ga0466958_0051702_449_1855 453
48 3300048911 Ga0496108_0096433 Ga0496108_0096433_794_2191 453
49 3300048916 Ga0496113_0053256 Ga0496113_0053256_357_1754 453
50 3300003322 rootL2_10144909 rootL2_101449098 454
51 3300005564 Ga0070664_100038681 Ga0070664_1000386812 454
52 3300010375 Ga0105239_10077799 Ga0105239_100777992 454
53 3300037418 Ga0395900_0068191 Ga0395900_0068191_1896_3296 454
54 3300037471 Ga0395905_0001986 Ga0395905_0001986_10936_12336 454
55 3300037471 Ga0395905_0067884 Ga0395905_0067884_100_1500 454
56 3300038443 Ga0395901_0016958 Ga0395901_0016958_2918_4318 454
57 3300044694 Ga0466963_0030922 Ga0466963_0030922_1356_2762 454
58 3300006195 Ga0075366_10094111 Ga0075366_100941112 457
59 3300026116 Ga0207674_10113220 Ga0207674_101132202 457
60 3300044694 Ga0466963_0022243 Ga0466963_0022243_866_2269 457
61 3300045976 Ga0466967_0167175 Ga0466967_0167175_101_1504 457
62 3300005329 Ga0070683_100037011 Ga0070683_1000370111 458
63 3300005334 Ga0068869_100018323 Ga0068869_1000183233 458
64 3300005338 Ga0068868_100034060 Ga0068868_1000340602 458
65 3300005347 Ga0070668_100000010 Ga0070668_100000010110 458
66 3300005347 Ga0070668_100055291 Ga0070668_1000552911 458
67 3300005353 Ga0070669_100017171 Ga0070669_1000171712 458
68 3300005366 Ga0070659_100027120 Ga0070659_1000271204 458
69 3300005367 Ga0070667_100002680 Ga0070667_1000026808 458
70 3300005439 Ga0070711_100000213 Ga0070711_1000002133 458
71 3300005444 Ga0070694_100103767 Ga0070694_1001037671 458
72 3300005455 Ga0070663_100101179 Ga0070663_1001011791 458
73 3300005456 Ga0070678_100063676 Ga0070678_1000636762 458
74 3300005457 Ga0070662_100001779 Ga0070662_1000017793 458
75 3300005548 Ga0070665_100003754 Ga0070665_1000037542 458
76 3300005614 Ga0068856_100086037 Ga0068856_1000860371 458
77 3300005841 Ga0068863_100000192 Ga0068863_10000019232 458
78 3300005843 Ga0068860_100079992 Ga0068860_1000799923 458
79 3300006175 Ga0070712_100002507 Ga0070712_1000025071 458
80 3300009101 Ga0105247_10016742 Ga0105247_100167423 458
81 3300009148 Ga0105243_10005369 Ga0105243_100053693 458
82 3300009174 Ga0105241_10102872 Ga0105241_101028722 458
83 3300009177 Ga0105248_10105742 Ga0105248_101057423 458
84 3300009551 Ga0105238_10057826 Ga0105238_100578263 458
85 3300009553 Ga0105249_10041721 Ga0105249_100417211 458
86 3300013102 Ga0157371_10009125 Ga0157371_100091252 458
87 3300013105 Ga0157369_10087659 Ga0157369_100876591 458
88 3300013296 Ga0157374_10015323 Ga0157374_100153232 458
89 3300013296 Ga0157374_10087489 Ga0157374_100874892 458
90 3300013306 Ga0163162_10032532 Ga0163162_100325322 458
91 3300013308 Ga0157375_10024351 Ga0157375_100243513 458
92 3300014968 Ga0157379_10015473 Ga0157379_100154736 458
93 3300025899 Ga0207642_10007350 Ga0207642_100073503 458
94 3300025907 Ga0207645_10018285 Ga0207645_100182852 458
95 3300025911 Ga0207654_10073662 Ga0207654_100736622 458
96 3300025913 Ga0207695_10023972 Ga0207695_100239725 458
97 3300025915 Ga0207693_10004449 Ga0207693_100044492 458
98 3300025916 Ga0207663_10006575 Ga0207663_100065754 458
99 3300025919 Ga0207657_10005796 Ga0207657_100057964 458
100 3300025921 Ga0207652_10222339 Ga0207652_102223392 458
101 3300025923 Ga0207681_10033357 Ga0207681_100333572 458
102 3300025933 Ga0207706_10003438 Ga0207706_100034385 458
103 3300025934 Ga0207686_10117624 Ga0207686_101176241 458
104 3300025938 Ga0207704_10058351 Ga0207704_100583511 458
105 3300025941 Ga0207711_10000892 Ga0207711_1000089218 458
106 3300025942 Ga0207689_10025732 Ga0207689_100257323 458
107 3300025944 Ga0207661_10007878 Ga0207661_100078785 458
108 3300025949 Ga0207667_10012830 Ga0207667_100128308 458
109 3300025949 Ga0207667_10177398 Ga0207667_101773981 458
110 3300025961 Ga0207712_10026173 Ga0207712_100261731 458
111 3300025972 Ga0207668_10000020 Ga0207668_10000020112 458
112 3300026067 Ga0207678_10000605 Ga0207678_100006055 458
113 3300026078 Ga0207702_10006322 Ga0207702_100063221 458
114 3300026088 Ga0207641_10000074 Ga0207641_1000007433 458
115 3300026089 Ga0207648_10039257 Ga0207648_100392573 458
116 3300026116 Ga0207674_10068142 Ga0207674_100681422 458
117 3300026121 Ga0207683_10123231 Ga0207683_101232311 458
118 3300035084 Ga0373928_0006120 Ga0373928_0006120_433_1887 458
119 3300046471 Ga0495650_0001249 Ga0495650_0001249_5397_6782 458
120 3300048903 Ga0496100_0081862 Ga0496100_0081862_282_1814 458
121 3300048904 Ga0496101_0064720 Ga0496101_0064720_52_1518 458
122 3300048906 Ga0496103_0059374 Ga0496103_0059374_726_2180 458
123 3300048911 Ga0496108_0103696 Ga0496108_0103696_117_1571 458
124 3300048915 Ga0496112_0040575 Ga0496112_0040575_3034_4488 458
125 3300048917 Ga0496114_0179798 Ga0496114_0179798_315_1772 458
126 3300053153 Ga0500616_0007454 Ga0500616_0007454_1864_3285 458
127 3300005293 Ga0065715_10000370 Ga0065715_100003706 459
128 3300005328 Ga0070676_10005808 Ga0070676_100058086 459
129 3300005331 Ga0070670_100001146 Ga0070670_1000011464 459
130 3300005331 Ga0070670_100001912 Ga0070670_1000019125 459
131 3300005333 Ga0070677_10000430 Ga0070677_1000043010 459
132 3300005335 Ga0070666_10062912 Ga0070666_100629124 459
133 3300005347 Ga0070668_100004333 Ga0070668_1000043336 459
134 3300005354 Ga0070675_100002570 Ga0070675_1000025709 459
135 3300005356 Ga0070674_100024727 Ga0070674_1000247272 459
136 3300005364 Ga0070673_100109910 Ga0070673_1001099104 459
137 3300005367 Ga0070667_100168875 Ga0070667_1001688752 459
138 3300005445 Ga0070708_100009847 Ga0070708_1000098474 459
139 3300005456 Ga0070678_100018052 Ga0070678_1000180525 459
140 3300005457 Ga0070662_100001494 Ga0070662_1000014945 459
141 3300005518 Ga0070699_100124316 Ga0070699_1001243162 459
142 3300005536 Ga0070697_100004946 Ga0070697_1000049465 459
143 3300005543 Ga0070672_100001865 Ga0070672_1000018655 459
144 3300005577 Ga0068857_100065328 Ga0068857_1000653285 459
145 3300005617 Ga0068859_100008008 Ga0068859_1000080086 459
146 3300005617 Ga0068859_100245019 Ga0068859_1002450192 459
147 3300005618 Ga0068864_100129247 Ga0068864_1001292473 459
148 3300005843 Ga0068860_100193439 Ga0068860_1001934392 459
149 3300006931 Ga0097620_100008008 Ga0097620_1000080086 459
150 3300006931 Ga0097620_100245016 Ga0097620_1002450161 459
151 3300009094 Ga0111539_10014598 Ga0111539_100145987 459
152 3300009553 Ga0105249_10036784 Ga0105249_100367843 459
153 3300014326 Ga0157380_10001232 Ga0157380_100012329 459
154 3300017792 Ga0163161_10014477 Ga0163161_100144775 459
155 3300025315 Ga0207697_10003482 Ga0207697_100034825 459
156 3300025893 Ga0207682_10001260 Ga0207682_100012609 459
157 3300025901 Ga0207688_10009238 Ga0207688_100092382 459
158 3300025903 Ga0207680_10064873 Ga0207680_100648732 459
159 3300025907 Ga0207645_10006206 Ga0207645_100062063 459
160 3300025910 Ga0207684_10004327 Ga0207684_100043274 459
161 3300025923 Ga0207681_10000980 Ga0207681_100009809 459
162 3300025925 Ga0207650_10000537 Ga0207650_1000053718 459
163 3300025925 Ga0207650_10002481 Ga0207650_100024815 459
164 3300025933 Ga0207706_10000415 Ga0207706_1000041541 459
165 3300025940 Ga0207691_10006421 Ga0207691_100064219 459
166 3300025942 Ga0207689_10166786 Ga0207689_101667861 459
167 3300025960 Ga0207651_10004533 Ga0207651_100045335 459
168 3300025961 Ga0207712_10008952 Ga0207712_100089525 459
169 3300025972 Ga0207668_10001025 Ga0207668_100010257 459
170 3300025986 Ga0207658_10029760 Ga0207658_100297603 459
171 3300026067 Ga0207678_10069017 Ga0207678_100690175 459
172 3300026118 Ga0207675_100005627 Ga0207675_1000056278 459
173 3300026121 Ga0207683_10015266 Ga0207683_100152666 459
174 3300028380 Ga0268265_10003381 Ga0268265_100033816 459
175 3300028380 Ga0268265_10162732 Ga0268265_101627322 459
176 3300041494 Ga0451837_1074998 Ga0451837_1074998_2478_3902 459
177 3300042004 Ga0439445_0000425 Ga0439445_0000425_6232_7614 459
178 3300046539 Ga0495621_0012646 Ga0495621_0012646_67_1512 459
179 3300048927 Ga0496124_0000052 Ga0496124_0000052_168273_169685 459
180 3300050511 nmdc:mga08y16_30716_c1 nmdc:mga08y16_30716_c1_2896_4341 459
181 3300025932 Ga0207690_10019418 Ga0207690_100194183 460
182 3300025972 Ga0207668_10094294 Ga0207668_100942944 460
183 3300031344 Ga0265316_10000552 Ga0265316_1000055237 460
184 3300031711 Ga0265314_10001011 Ga0265314_1000101132 460
185 iso_pu_bacteria 8002869464 8002871140 460
186 3300025927 Ga0207687_10000509 Ga0207687_1000050914 461
187 3300031852 Ga0307410_10003696 Ga0307410_100036963 461
188 3300031995 Ga0307409_100126573 Ga0307409_1001265731 461
189 3300049570 Ga0501033_0003002 Ga0501033_0003002_3560_4951 461
190 3300005331 Ga0070670_100048114 Ga0070670_1000481142 462
191 3300005539 Ga0068853_100070566 Ga0068853_1000705662 462
192 3300005543 Ga0070672_100039343 Ga0070672_1000393433 462
193 3300005563 Ga0068855_100038563 Ga0068855_1000385632 462
194 3300009545 Ga0105237_10000036 Ga0105237_10000036117 462
195 3300013104 Ga0157370_10093305 Ga0157370_100933052 462
196 3300013306 Ga0163162_10177319 Ga0163162_101773192 462
197 3300013308 Ga0157375_10025199 Ga0157375_100251996 462
198 3300017792 Ga0163161_10066669 Ga0163161_100666695 462
199 3300020070 Ga0206356_11030950 Ga0206356_110309503 462
200 3300025913 Ga0207695_10031281 Ga0207695_100312812 462
201 3300025914 Ga0207671_10001404 Ga0207671_1000140414 462
202 3300026041 Ga0207639_10056004 Ga0207639_100560042 462
203 3300026116 Ga0207674_10147057 Ga0207674_101470572 462
204 3300031730 Ga0307516_10001780 Ga0307516_1000178021 462
205 3300037418 Ga0395900_0030887 Ga0395900_0030887_2951_4351 462
206 3300037418 Ga0395900_0200432 Ga0395900_0200432_170_1561 462
207 3300037471 Ga0395905_0051408 Ga0395905_0051408_1146_2546 462
208 3300037471 Ga0395905_0113384 Ga0395905_0113384_1076_2473 462
209 3300048913 Ga0496110_0099774 Ga0496110_0099774_437_1834 462
210 3300005338 Ga0068868_100055590 Ga0068868_1000555902 463
211 3300013105 Ga0157369_10002396 Ga0157369_1000239612 463
212 3300026023 Ga0207677_10081819 Ga0207677_100818193 463
213 3300031548 Ga0307408_100160178 Ga0307408_1001601781 463
214 3300042993 Ga0439440_0003042 Ga0439440_0003042_1237_2649 463
215 3300001979 JGI24740J21852_10005928 JGI24740J21852_100059286 464
216 3300001990 JGI24737J22298_10007427 JGI24737J22298_100074275 464
217 3300005328 Ga0070676_10009336 Ga0070676_100093362 464
218 3300005336 Ga0070680_100133330 Ga0070680_1001333303 464
219 3300005341 Ga0070691_10000860 Ga0070691_100008604 464
220 3300005455 Ga0070663_100012612 Ga0070663_1000126122 464
221 3300005535 Ga0070684_100005253 Ga0070684_1000052532 464
222 3300005539 Ga0068853_100006884 Ga0068853_1000068847 464
223 3300005578 Ga0068854_100004796 Ga0068854_1000047963 464
224 3300005834 Ga0068851_10095164 Ga0068851_100951641 464
225 3300009174 Ga0105241_10076177 Ga0105241_100761775 464
226 3300009545 Ga0105237_10121489 Ga0105237_101214895 464
227 3300009551 Ga0105238_10094149 Ga0105238_100941491 464
228 3300013307 Ga0157372_10011769 Ga0157372_100117693 464
229 3300025919 Ga0207657_10005336 Ga0207657_100053367 464
230 3300025919 Ga0207657_10012306 Ga0207657_100123062 464
231 3300025920 Ga0207649_10012580 Ga0207649_100125806 464
232 3300025932 Ga0207690_10007160 Ga0207690_100071607 464
233 3300025944 Ga0207661_10012276 Ga0207661_100122765 464
234 3300026116 Ga0207674_10001374 Ga0207674_1000137427 464
235 3300026116 Ga0207674_10132842 Ga0207674_101328422 464
236 3300028379 Ga0268266_10013106 Ga0268266_100131064 464
237 3300044658 Ga0466972_0018052 Ga0466972_0018052_216_1622 464
238 3300044765 Ga0466970_0042490 Ga0466970_0042490_445_1851 464
239 3300044765 Ga0466970_0066462 Ga0466970_0066462_385_1791 464
240 3300045836 Ga0466958_0016285 Ga0466958_0016285_2615_4021 464
241 3300005617 Ga0068859_100220755 Ga0068859_1002207552 465
242 3300009093 Ga0105240_10094462 Ga0105240_100944622 465
243 3300037471 Ga0395905_0242233 Ga0395905_0242233_133_1533 465
244 3300005564 Ga0070664_100058591 Ga0070664_1000585913 466
245 3300031616 Ga0307508_10036161 Ga0307508_100361613 466
246 3300049569 Ga0501032_0003170 Ga0501032_0003170_6496_7908 466
247 3300049571 Ga0501034_0055913 Ga0501034_0055913_1249_2664 466
248 3300049572 Ga0501036_0052580 Ga0501036_0052580_1503_2915 466
249 3300049574 Ga0501038_0004188 Ga0501038_0004188_4996_6408 466
250 3300049575 Ga0501039_0102966 Ga0501039_0102966_201_1613 466
251 3300049581 Ga0501047_0020575 Ga0501047_0020575_2109_3521 466
252 3300049586 Ga0501070_0008908 Ga0501070_0008908_6640_8052 466
253 3300049587 Ga0501071_0099729 Ga0501071_0099729_387_1799 466
254 3300049589 Ga0501073_0029761 Ga0501073_0029761_2116_3528 466
255 3300049822 Ga0501035_0058247 Ga0501035_0058247_823_2235 466
256 3300005288 Ga0065714_10014670 Ga0065714_100146703 467
257 3300013102 Ga0157371_10058202 Ga0157371_100582022 467
258 3300046507 Ga0495606_0008027 Ga0495606_0008027_4641_6050 467
259 3300013306 Ga0163162_10000042 Ga0163162_1000004215 468
260 3300025972 Ga0207668_10029007 Ga0207668_100290075 468
261 3300027665 Ga0209983_1002121 Ga0209983_10021212 468
262 3300027876 Ga0209974_10008722 Ga0209974_100087224 468
263 3300053153 Ga0500616_0000073 Ga0500616_0000073_13181_14623 468
264 iso_pu_bacteria 2919513703 2919515433 468
265 iso_pu_bacteria 2919675420 2919675814 468
266 3300049569 Ga0501032_0033949 Ga0501032_0033949_159_1580 469
267 3300049571 Ga0501034_0108331 Ga0501034_0108331_172_1593 469
268 3300049573 Ga0501037_0102156 Ga0501037_0102156_356_1777 469
269 3300049575 Ga0501039_0115009 Ga0501039_0115009_125_1546 469
270 3300049581 Ga0501047_0082309 Ga0501047_0082309_1533_2954 469
271 3300049586 Ga0501070_0096593 Ga0501070_0096593_33_1454 469
272 3300010375 Ga0105239_10009641 Ga0105239_100096415 470
273 3300005530 Ga0070679_100091109 Ga0070679_1000911093 471
274 3300025921 Ga0207652_10018199 Ga0207652_100181995 471
275 3300041452 Ga0451793_1028672 Ga0451793_1028672_384_1799 471
276 3300005355 Ga0070671_100084080 Ga0070671_1000840801 473
277 3300005367 Ga0070667_100078353 Ga0070667_1000783532 473
278 3300005539 Ga0068853_100001040 Ga0068853_10000104016 473
279 3300005539 Ga0068853_100001130 Ga0068853_10000113010 473
280 3300005548 Ga0070665_100097206 Ga0070665_1000972062 473
281 3300005563 Ga0068855_100009258 Ga0068855_10000925810 473
282 3300005563 Ga0068855_100064659 Ga0068855_1000646594 473
283 3300005614 Ga0068856_100040668 Ga0068856_1000406684 473
284 3300005841 Ga0068863_100007347 Ga0068863_1000073477 473
285 3300005983 Ga0081540_1012187 Ga0081540_10121876 473
286 3300009093 Ga0105240_10201786 Ga0105240_102017862 473
287 3300025303 Ga0209051_1018017 Ga0209051_10180172 473
288 3300025949 Ga0207667_10009556 Ga0207667_100095565 473
289 3300025981 Ga0207640_10060496 Ga0207640_100604962 473
290 3300026041 Ga0207639_10001429 Ga0207639_1000142915 473
291 3300026041 Ga0207639_10050016 Ga0207639_100500163 473
292 3300026067 Ga0207678_10055150 Ga0207678_100551502 473
293 3300026116 Ga0207674_10047073 Ga0207674_100470733 473
294 3300026116 Ga0207674_10178213 Ga0207674_101782132 473
295 3300044658 Ga0466972_0018289 Ga0466972_0018289_1060_2499 473
296 3300049569 Ga0501032_0002036 Ga0501032_0002036_6599_8023 473
297 3300049570 Ga0501033_0003081 Ga0501033_0003081_11247_12671 473
298 3300049571 Ga0501034_0001904 Ga0501034_0001904_17119_18543 473
299 3300049572 Ga0501036_0053627 Ga0501036_0053627_1424_2848 473
300 3300049573 Ga0501037_0000948 Ga0501037_0000948_10001_11425 473
301 3300049574 Ga0501038_0000712 Ga0501038_0000712_19454_20878 473
302 3300049575 Ga0501039_0007044 Ga0501039_0007044_5314_6738 473
303 3300049579 Ga0501043_0005297 Ga0501043_0005297_7878_9302 473
304 3300049580 Ga0501046_0028083 Ga0501046_0028083_873_2297 473
305 3300049581 Ga0501047_0036088 Ga0501047_0036088_2416_3840 473
306 3300049589 Ga0501073_0001226 Ga0501073_0001226_3396_4820 473
307 3300049742 Ga0501080_0013444 Ga0501080_0013444_5727_7151 473
308 3300049822 Ga0501035_0001396 Ga0501035_0001396_16182_17606 473
309 3300053093 Ga0500651_0014757 Ga0500651_0014757_1637_3061 473
310 3300005548 Ga0070665_100022204 Ga0070665_1000222045 474
311 3300005548 Ga0070665_100256850 Ga0070665_1002568501 474
312 3300049571 Ga0501034_0051510 Ga0501034_0051510_1715_3142 474
313 3300049574 Ga0501038_0065003 Ga0501038_0065003_1424_2851 474
314 3300049575 Ga0501039_0032571 Ga0501039_0032571_1403_2830 474
315 3300049576 Ga0501040_0013160 Ga0501040_0013160_1547_2974 474
316 3300049578 Ga0501042_0037745 Ga0501042_0037745_1216_2643 474
317 3300049580 Ga0501046_0013710 Ga0501046_0013710_1785_3281 474
318 3300049581 Ga0501047_0131717 Ga0501047_0131717_556_1983 474
319 3300049582 Ga0501048_0026548 Ga0501048_0026548_1877_3304 474
320 3300049583 Ga0501067_0026748 Ga0501067_0026748_1676_3103 474
321 3300049585 Ga0501069_0029897 Ga0501069_0029897_230_1657 474
322 3300049586 Ga0501070_0056768 Ga0501070_0056768_1165_2592 474
323 3300049587 Ga0501071_0004988 Ga0501071_0004988_1292_2719 474
324 3300049588 Ga0501072_0048687 Ga0501072_0048687_1779_3206 474
325 3300049590 Ga0501074_0009561 Ga0501074_0009561_4207_5634 474
326 3300049823 Ga0501044_0078413 Ga0501044_0078413_259_1686 474
327 3300053079 Ga0500610_0011011 Ga0500610_0011011_2362_3789 474
328 3300054114 Ga0501084_0012807 Ga0501084_0012807_3655_5082 474
329 3300060353 Ga0501082_0018364 Ga0501082_0018364_3475_4902 474
330 3300005367 Ga0070667_100003453 Ga0070667_10000345311 475
331 3300005466 Ga0070685_10000386 Ga0070685_100003867 475
332 3300009093 Ga0105240_10000453 Ga0105240_1000045315 475
333 3300009545 Ga0105237_10065777 Ga0105237_100657774 475
334 3300025261 Ga0209233_1001897 Ga0209233_10018979 475
335 3300025913 Ga0207695_10000172 Ga0207695_10000172152 475
336 3300048921 Ga0496118_0006022 Ga0496118_0006022_841_2451 475
337 3300049586 Ga0501070_0008039 Ga0501070_0008039_2713_4197 476
338 3300049742 Ga0501080_0045549 Ga0501080_0045549_492_1976 476
339 iso_pu_bacteria 2593339238 2595447733 476
340 iso_pu_bacteria 2818991440 2819566284 476
341 iso_pu_bacteria 2904463128 2904466560 476
342 3300005331 Ga0070670_100017386 Ga0070670_1000173864 477
343 3300005335 Ga0070666_10001153 Ga0070666_100011536 477
344 3300005337 Ga0070682_100055174 Ga0070682_1000551743 477
345 3300005459 Ga0068867_100081008 Ga0068867_1000810082 477
346 3300005548 Ga0070665_100000242 Ga0070665_10000024241 477
347 3300005563 Ga0068855_100147065 Ga0068855_1001470651 477
348 3300005842 Ga0068858_100016875 Ga0068858_1000168755 477
349 3300006358 Ga0068871_100021042 Ga0068871_1000210425 477
350 3300009093 Ga0105240_10008373 Ga0105240_1000837312 477
351 3300009551 Ga0105238_10008158 Ga0105238_100081582 477
352 3300009551 Ga0105238_10144654 Ga0105238_101446542 477
353 3300009553 Ga0105249_10045606 Ga0105249_100456062 477
354 3300025903 Ga0207680_10002268 Ga0207680_100022686 477
355 3300025904 Ga0207647_10000066 Ga0207647_1000006653 477
356 3300025913 Ga0207695_10012023 Ga0207695_100120236 477
357 3300025924 Ga0207694_10000308 Ga0207694_1000030816 477
358 3300025925 Ga0207650_10006496 Ga0207650_100064966 477
359 3300025961 Ga0207712_10000589 Ga0207712_1000058917 477
360 3300026035 Ga0207703_10004533 Ga0207703_100045339 477
361 3300026041 Ga0207639_10042503 Ga0207639_100425033 477
362 3300026067 Ga0207678_10000577 Ga0207678_100005773 477
363 3300028379 Ga0268266_10000008 Ga0268266_10000008955 477
364 3300041486 Ga0451807_0280975 Ga0451807_0280975_253_1689 477
365 3300005335 Ga0070666_10000023 Ga0070666_10000023149 478
366 3300025256 Ga0209759_1002084 Ga0209759_10020847 478
367 3300037466 Ga0395898_0029476 Ga0395898_0029476_1534_2970 478
368 3300049579 Ga0501043_0032363 Ga0501043_0032363_304_1740 478
369 3300002075 JGI24738J21930_10000118 JGI24738J21930_100001187 479
370 3300002737 JGI25162J39368_1000360 JGI25162J39368_100036018 479
371 3300005262 Ga0065165_1000913 Ga0065165_100091321 479
372 3300013306 Ga0163162_10167465 Ga0163162_101674652 479
373 3300017792 Ga0163161_10022306 Ga0163161_100223064 479
374 3300025226 Ga0209674_100556 Ga0209674_1005567 479
375 3300025254 Ga0209148_1002007 Ga0209148_10020075 479
376 3300025258 Ga0209129_1000697 Ga0209129_100069712 479
377 3300025304 Ga0209257_1022237 Ga0209257_10222372 479
378 3300046460 Ga0495638_0000071 Ga0495638_0000071_139196_140635 479
379 3300046513 Ga0495616_0000128 Ga0495616_0000128_14926_16368 479
380 3300046519 Ga0495632_0033484 Ga0495632_0033484_699_2141 479
381 3300001979 JGI24740J21852_10003893 JGI24740J21852_100038931 480
382 3300009093 Ga0105240_10000868 Ga0105240_1000086813 480
383 3300048924 Ga0496121_0047767 Ga0496121_0047767_1691_3133 480

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

322

513

0.88

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

348

514

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9641 33 470
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9491 33 470
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8282 264 334
1xbu-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with p-iodo-d-phenylalanine 0.7928 262 460
1tkf-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with d-tryptophan 0.7855 262 460
ID Description Score Start End Superfamily
3iibA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.9412 104 254 3.50.30.30
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9365 33 470 3.40.630.10
3iibA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.9351 104 254 3.50.30.30
af_Q9Y646_117_259_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9205 104 254 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9176 33 470 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A1G3G213-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9997 32 480 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A848QH50-F1-model_v4 deleted 0.9983 312 480
AF-A0A1G3G213-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9953 32 480 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7V8GJV0-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9873 135 341 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A4R6YQZ5-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9864 20 480 GO:0004180
GO:0005576
GO:0005764
GO:0070573

Feature Viewer

pLDDT pTM Quality
93.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map