F429563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 383 | 230 | 377 | 473 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10008373|Ga0105240_1000837312 |
| Length | 537 |
| Sequence | VLRPFRLRTFALSSRSSKTWSPRSHAKWPFCTKADFATLDIVANPRHAPSFSPYPESIVKLLSALSLTAVSVFALGAAHAAETRIPDAAVRAAEQLRDRAMNDDTAYKFVEGLTTEVGPRLAAGDNDAKSREWVIAKFKALGFDKVYEEPVSYPKWVRRHEAGAIVAPFAQNLVLAALGHSFPTPAGGLTAEVVRFENLDALKAADPAKVKGKIVYIGFKMQPHKDGHDYGTGSSIRVGGPPLAASKGAAAFLLRSAGTDAKDRMAHTGATGFADAKANGIPAAALSNPDADQLERVLAHGKPVTLKLDLDVGFDGDYTGANVIGEVTGKKHPDQIIDIGGHLDSWDPGTGAIDDAAGVAIAAAAAHLVKQMPQRPDRTIRVIAFANEEAGLYGGKAYAEKHAAEVAKHVLGTESDFGAGPIWRMSASVKPEARAAIAQIAAVLKPIGVDYDDKKPGGGGSDLSQMHAKGMAALTLLQDGTHYFDIHHTANDTLDKIDPKELAQNVAVYATWTYLAAQAEGDFGSAPGAFAKDNGEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 2 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 3 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 4 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 5 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 166 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 167 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 193 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 194 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 225 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 226 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 227 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 0.26 |
| Isolates | 1.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.92 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 87.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003893 | 3300001979 | Bacteria | 6481 |
| 2 | JGI24740J21852_10005928 | 3300001979 | Bacteria | 5119 |
| 3 | JGI24737J22298_10007427 | 3300001990 | Bacteria | 3701 |
| 4 | JGI24738J21930_10000118 | 3300002075 | Bacteria | 18730 |
| 5 | JGI25162J39368_1000360 | 3300002737 | Bacteria | 38829 |
| 6 | rootL2_10144909 | 3300003322 | Bacteria | 8766 |
| 7 | Ga0065165_1000913 | 3300005262 | Bacteria | 38106 |
| 8 | Ga0065714_10014670 | 3300005288 | Bacteria | 2936 |
| 9 | Ga0065715_10000370 | 3300005293 | Bacteria | 13372 |
| 10 | Ga0065715_10004139 | 3300005293 | Bacteria | 4364 |
| 11 | Ga0070676_10005808 | 3300005328 | Bacteria | 6579 |
| 12 | Ga0070676_10009336 | 3300005328 | Bacteria | 5305 |
| 13 | Ga0070683_100037011 | 3300005329 | Bacteria | 4465 |
| 14 | Ga0070670_100001146 | 3300005331 | Bacteria | 21026 |
| 15 | Ga0070670_100001912 | 3300005331 | Bacteria | 17058 |
| 16 | Ga0070670_100017386 | 3300005331 | Bacteria | 6169 |
| 17 | Ga0070670_100048114 | 3300005331 | Bacteria | 3669 |
| 18 | Ga0070677_10000430 | 3300005333 | Bacteria | 14476 |
| 19 | Ga0068869_100018323 | 3300005334 | Bacteria | 4764 |
| 20 | Ga0070666_10000023 | 3300005335 | Bacteria | 161603 |
| 21 | Ga0070666_10001153 | 3300005335 | Bacteria | 16042 |
| 22 | Ga0070666_10062912 | 3300005335 | Bacteria | 2515 |
| 23 | Ga0070680_100133330 | 3300005336 | Bacteria | 2079 |
| 24 | Ga0070682_100055174 | 3300005337 | Bacteria | 2495 |
| 25 | Ga0068868_100034060 | 3300005338 | Bacteria | 3930 |
| 26 | Ga0068868_100055590 | 3300005338 | Bacteria | 3123 |
| 27 | Ga0070691_10000860 | 3300005341 | Bacteria | 12285 |
| 28 | Ga0070668_100000010 | 3300005347 | Bacteria | 132833 |
| 29 | Ga0070668_100004333 | 3300005347 | Bacteria | 10526 |
| 30 | Ga0070668_100055291 | 3300005347 | Bacteria | 3063 |
| 31 | Ga0070669_100008737 | 3300005353 | Bacteria | 7227 |
| 32 | Ga0070669_100017171 | 3300005353 | Bacteria | 5164 |
| 33 | Ga0070675_100002570 | 3300005354 | Bacteria | 13593 |
| 34 | Ga0070671_100084080 | 3300005355 | Bacteria | 2661 |
| 35 | Ga0070671_100167791 | 3300005355 | Bacteria | 1856 |
| 36 | Ga0070674_100024727 | 3300005356 | Bacteria | 3901 |
| 37 | Ga0070673_100109910 | 3300005364 | Bacteria | 2285 |
| 38 | Ga0070659_100027120 | 3300005366 | Bacteria | 4410 |
| 39 | Ga0070667_100002680 | 3300005367 | Bacteria | 15408 |
| 40 | Ga0070667_100003453 | 3300005367 | Bacteria | 13463 |
| 41 | Ga0070667_100078353 | 3300005367 | Bacteria | 2823 |
| 42 | Ga0070667_100168875 | 3300005367 | Bacteria | 1930 |
| 43 | Ga0070711_100000213 | 3300005439 | Bacteria | 30586 |
| 44 | Ga0070694_100103767 | 3300005444 | Bacteria | 2015 |
| 45 | Ga0070708_100009847 | 3300005445 | Bacteria | 7720 |
| 46 | Ga0070663_100012612 | 3300005455 | Bacteria | 5356 |
| 47 | Ga0070663_100101179 | 3300005455 | Bacteria | 2150 |
| 48 | Ga0070678_100018052 | 3300005456 | Bacteria | 4562 |
| 49 | Ga0070678_100063676 | 3300005456 | Bacteria | 2729 |
| 50 | Ga0070662_100001494 | 3300005457 | Bacteria | 14387 |
| 51 | Ga0070662_100001779 | 3300005457 | Bacteria | 13271 |
| 52 | Ga0068867_100016022 | 3300005459 | Bacteria | 5322 |
| 53 | Ga0068867_100081008 | 3300005459 | Bacteria | 2446 |
| 54 | Ga0070685_10000386 | 3300005466 | Bacteria | 26505 |
| 55 | Ga0070699_100124316 | 3300005518 | Unclassified | 2270 |
| 56 | Ga0070679_100091109 | 3300005530 | Bacteria | 3037 |
| 57 | Ga0070684_100005253 | 3300005535 | Bacteria | 9910 |
| 58 | Ga0070697_100004946 | 3300005536 | Bacteria | 10229 |
| 59 | Ga0068853_100001040 | 3300005539 | Bacteria | 19607 |
| 60 | Ga0068853_100001130 | 3300005539 | Bacteria | 18915 |
| 61 | Ga0068853_100006884 | 3300005539 | Bacteria | 9074 |
| 62 | Ga0068853_100070566 | 3300005539 | Bacteria | 3041 |
| 63 | Ga0070672_100001865 | 3300005543 | Bacteria | 13165 |
| 64 | Ga0070672_100039343 | 3300005543 | Bacteria | 3622 |
| 65 | Ga0070696_100038203 | 3300005546 | Bacteria | 3313 |
| 66 | Ga0070665_100000242 | 3300005548 | Bacteria | 90566 |
| 67 | Ga0070665_100003754 | 3300005548 | Bacteria | 16079 |
| 68 | Ga0070665_100022204 | 3300005548 | Bacteria | 6384 |
| 69 | Ga0070665_100079322 | 3300005548 | Bacteria | 3289 |
| 70 | Ga0070665_100097206 | 3300005548 | Bacteria | 2949 |
| 71 | Ga0070665_100256850 | 3300005548 | Bacteria | 1748 |
| 72 | Ga0068855_100009258 | 3300005563 | Bacteria | 11899 |
| 73 | Ga0068855_100038563 | 3300005563 | Bacteria | 5677 |
| 74 | Ga0068855_100064659 | 3300005563 | Bacteria | 4266 |
| 75 | Ga0068855_100147065 | 3300005563 | Bacteria | 2682 |
| 76 | Ga0070664_100038681 | 3300005564 | Bacteria | 4017 |
| 77 | Ga0070664_100058591 | 3300005564 | Bacteria | 3276 |
| 78 | Ga0068857_100065328 | 3300005577 | Bacteria | 3235 |
| 79 | Ga0068854_100004796 | 3300005578 | Bacteria | 8531 |
| 80 | Ga0068856_100040668 | 3300005614 | Bacteria | 4567 |
| 81 | Ga0068856_100086037 | 3300005614 | Bacteria | 3123 |
| 82 | Ga0068859_100008008 | 3300005617 | Bacteria | 10714 |
| 83 | Ga0068859_100220755 | 3300005617 | Bacteria | 1983 |
| 84 | Ga0068859_100245019 | 3300005617 | Bacteria | 1882 |
| 85 | Ga0068864_100129247 | 3300005618 | Bacteria | 2267 |
| 86 | Ga0068851_10095164 | 3300005834 | Bacteria | 1573 |
| 87 | Ga0068863_100000192 | 3300005841 | Bacteria | 64858 |
| 88 | Ga0068863_100007347 | 3300005841 | Bacteria | 10785 |
| 89 | Ga0068858_100016875 | 3300005842 | Bacteria | 6856 |
| 90 | Ga0068860_100079992 | 3300005843 | Bacteria | 3108 |
| 91 | Ga0068860_100193439 | 3300005843 | Bacteria | 1969 |
| 92 | Ga0081540_1012187 | 3300005983 | Bacteria | 5685 |
| 93 | Ga0070716_100072907 | 3300006173 | Bacteria | 2024 |
| 94 | Ga0070712_100002507 | 3300006175 | Bacteria | 11321 |
| 95 | Ga0075366_10094111 | 3300006195 | Bacteria | 1796 |
| 96 | Ga0068871_100021042 | 3300006358 | Bacteria | 5007 |
| 97 | Ga0075431_100043025 | 3300006847 | Bacteria | 4660 |
| 98 | Ga0075429_100031963 | 3300006880 | Bacteria | 4576 |
| 99 | Ga0097620_100008008 | 3300006931 | Bacteria | 10714 |
| 100 | Ga0097620_100245016 | 3300006931 | Bacteria | 1882 |
| 101 | Ga0105240_10000453 | 3300009093 | Bacteria | 75454 |
| 102 | Ga0105240_10000868 | 3300009093 | Bacteria | 54479 |
| 103 | Ga0105240_10008373 | 3300009093 | Bacteria | 14800 |
| 104 | Ga0105240_10094462 | 3300009093 | Bacteria | 3647 |
| 105 | Ga0105240_10201786 | 3300009093 | Bacteria | 2330 |
| 106 | Ga0111539_10014598 | 3300009094 | Bacteria | 9804 |
| 107 | Ga0105247_10016742 | 3300009101 | Bacteria | 4396 |
| 108 | Ga0105243_10005369 | 3300009148 | Bacteria | 9999 |
| 109 | Ga0105241_10076177 | 3300009174 | Bacteria | 2615 |
| 110 | Ga0105241_10102872 | 3300009174 | Bacteria | 2274 |
| 111 | Ga0105248_10105742 | 3300009177 | Bacteria | 3173 |
| 112 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 113 | Ga0105237_10065777 | 3300009545 | Bacteria | 3620 |
| 114 | Ga0105237_10121489 | 3300009545 | Bacteria | 2606 |
| 115 | Ga0105238_10008158 | 3300009551 | Bacteria | 10475 |
| 116 | Ga0105238_10057826 | 3300009551 | Bacteria | 3887 |
| 117 | Ga0105238_10094149 | 3300009551 | Bacteria | 2983 |
| 118 | Ga0105238_10144654 | 3300009551 | Bacteria | 2354 |
| 119 | Ga0105249_10036784 | 3300009553 | Bacteria | 4441 |
| 120 | Ga0105249_10041721 | 3300009553 | Bacteria | 4172 |
| 121 | Ga0105249_10045606 | 3300009553 | Bacteria | 3988 |
| 122 | Ga0105239_10009641 | 3300010375 | Bacteria | 10860 |
| 123 | Ga0105239_10077799 | 3300010375 | Bacteria | 3651 |
| 124 | Ga0157371_10009125 | 3300013102 | Bacteria | 7834 |
| 125 | Ga0157371_10058202 | 3300013102 | Bacteria | 2741 |
| 126 | Ga0157370_10093305 | 3300013104 | Bacteria | 2825 |
| 127 | Ga0157369_10002396 | 3300013105 | Bacteria | 22523 |
| 128 | Ga0157369_10087659 | 3300013105 | Bacteria | 3323 |
| 129 | Ga0157374_10015323 | 3300013296 | Bacteria | 6724 |
| 130 | Ga0157374_10020266 | 3300013296 | Bacteria | 5899 |
| 131 | Ga0157374_10087489 | 3300013296 | Bacteria | 2966 |
| 132 | Ga0163162_10000042 | 3300013306 | Bacteria | 131540 |
| 133 | Ga0163162_10000661 | 3300013306 | Bacteria | 31916 |
| 134 | Ga0163162_10032532 | 3300013306 | Bacteria | 5181 |
| 135 | Ga0163162_10167465 | 3300013306 | Bacteria | 2321 |
| 136 | Ga0163162_10177319 | 3300013306 | Bacteria | 2257 |
| 137 | Ga0157372_10011769 | 3300013307 | Bacteria | 9318 |
| 138 | Ga0157372_10364097 | 3300013307 | Bacteria | 1685 |
| 139 | Ga0157375_10024351 | 3300013308 | Bacteria | 5601 |
| 140 | Ga0157375_10025199 | 3300013308 | Bacteria | 5521 |
| 141 | Ga0157380_10001232 | 3300014326 | Bacteria | 16609 |
| 142 | Ga0157379_10015473 | 3300014968 | Bacteria | 6695 |
| 143 | Ga0157379_10049278 | 3300014968 | Bacteria | 3760 |
| 144 | Ga0157379_10198035 | 3300014968 | Unclassified | 1816 |
| 145 | Ga0163161_10014477 | 3300017792 | Bacteria | 5492 |
| 146 | Ga0163161_10022306 | 3300017792 | Bacteria | 4457 |
| 147 | Ga0163161_10066669 | 3300017792 | Bacteria | 2629 |
| 148 | Ga0206356_11030950 | 3300020070 | Bacteria | 3035 |
| 149 | Ga0209674_100556 | 3300025226 | Bacteria | 14827 |
| 150 | Ga0209148_1002007 | 3300025254 | Bacteria | 7975 |
| 151 | Ga0209759_1002084 | 3300025256 | Bacteria | 9331 |
| 152 | Ga0209129_1000697 | 3300025258 | Bacteria | 22024 |
| 153 | Ga0209233_1001897 | 3300025261 | Bacteria | 8020 |
| 154 | Ga0209051_1018017 | 3300025303 | Bacteria | 3139 |
| 155 | Ga0209257_1022237 | 3300025304 | Bacteria | 2269 |
| 156 | Ga0207697_10003482 | 3300025315 | Bacteria | 7770 |
| 157 | Ga0207682_10001260 | 3300025893 | Bacteria | 11713 |
| 158 | Ga0207642_10007350 | 3300025899 | Bacteria | 3716 |
| 159 | Ga0207688_10009238 | 3300025901 | Bacteria | 5373 |
| 160 | Ga0207680_10002268 | 3300025903 | Bacteria | 8961 |
| 161 | Ga0207680_10064873 | 3300025903 | Bacteria | 2240 |
| 162 | Ga0207647_10000066 | 3300025904 | Bacteria | 81782 |
| 163 | Ga0207645_10006206 | 3300025907 | Bacteria | 8586 |
| 164 | Ga0207645_10018285 | 3300025907 | Bacteria | 4615 |
| 165 | Ga0207684_10004327 | 3300025910 | Bacteria | 13426 |
| 166 | Ga0207654_10073662 | 3300025911 | Bacteria | 2036 |
| 167 | Ga0207695_10000172 | 3300025913 | Bacteria | 190573 |
| 168 | Ga0207695_10012023 | 3300025913 | Bacteria | 10412 |
| 169 | Ga0207695_10023972 | 3300025913 | Bacteria | 6881 |
| 170 | Ga0207695_10031281 | 3300025913 | Bacteria | 5840 |
| 171 | Ga0207671_10001404 | 3300025914 | Bacteria | 28043 |
| 172 | Ga0207693_10004449 | 3300025915 | Bacteria | 11843 |
| 173 | Ga0207663_10006575 | 3300025916 | Bacteria | 5966 |
| 174 | Ga0207660_10052124 | 3300025917 | Bacteria | 2912 |
| 175 | Ga0207657_10005336 | 3300025919 | Bacteria | 13464 |
| 176 | Ga0207657_10005796 | 3300025919 | Bacteria | 12870 |
| 177 | Ga0207657_10012306 | 3300025919 | Bacteria | 8455 |
| 178 | Ga0207649_10012580 | 3300025920 | Bacteria | 4699 |
| 179 | Ga0207652_10018199 | 3300025921 | Bacteria | 5759 |
| 180 | Ga0207652_10222339 | 3300025921 | Bacteria | 1701 |
| 181 | Ga0207681_10000980 | 3300025923 | Bacteria | 18650 |
| 182 | Ga0207681_10033357 | 3300025923 | Bacteria | 3375 |
| 183 | Ga0207681_10061958 | 3300025923 | Bacteria | 2574 |
| 184 | Ga0207694_10000308 | 3300025924 | Bacteria | 45953 |
| 185 | Ga0207650_10000537 | 3300025925 | Bacteria | 30997 |
| 186 | Ga0207650_10002481 | 3300025925 | Bacteria | 12831 |
| 187 | Ga0207650_10006496 | 3300025925 | Bacteria | 7969 |
| 188 | Ga0207687_10000509 | 3300025927 | Bacteria | 26200 |
| 189 | Ga0207644_10156670 | 3300025931 | Bacteria | 1767 |
| 190 | Ga0207690_10007160 | 3300025932 | Bacteria | 6627 |
| 191 | Ga0207690_10019418 | 3300025932 | Bacteria | 4184 |
| 192 | Ga0207706_10000415 | 3300025933 | Bacteria | 45662 |
| 193 | Ga0207706_10003438 | 3300025933 | Bacteria | 15120 |
| 194 | Ga0207686_10117624 | 3300025934 | Bacteria | 1804 |
| 195 | Ga0207704_10058351 | 3300025938 | Bacteria | 2376 |
| 196 | Ga0207691_10006421 | 3300025940 | Bacteria | 11361 |
| 197 | Ga0207711_10000892 | 3300025941 | Bacteria | 28721 |
| 198 | Ga0207689_10025732 | 3300025942 | Bacteria | 4930 |
| 199 | Ga0207689_10166786 | 3300025942 | Bacteria | 1815 |
| 200 | Ga0207661_10007878 | 3300025944 | Bacteria | 7591 |
| 201 | Ga0207661_10012276 | 3300025944 | Bacteria | 6221 |
| 202 | Ga0207667_10009556 | 3300025949 | Bacteria | 11412 |
| 203 | Ga0207667_10012830 | 3300025949 | Bacteria | 9629 |
| 204 | Ga0207667_10177398 | 3300025949 | Bacteria | 2189 |
| 205 | Ga0207651_10004533 | 3300025960 | Bacteria | 7021 |
| 206 | Ga0207712_10000589 | 3300025961 | Bacteria | 29134 |
| 207 | Ga0207712_10008952 | 3300025961 | Bacteria | 6331 |
| 208 | Ga0207712_10026173 | 3300025961 | Bacteria | 3884 |
| 209 | Ga0207668_10000020 | 3300025972 | Bacteria | 140737 |
| 210 | Ga0207668_10001025 | 3300025972 | Bacteria | 16716 |
| 211 | Ga0207668_10029007 | 3300025972 | Bacteria | 3624 |
| 212 | Ga0207668_10094294 | 3300025972 | Bacteria | 2207 |
| 213 | Ga0207640_10060496 | 3300025981 | Bacteria | 2504 |
| 214 | Ga0207658_10029760 | 3300025986 | Bacteria | 3860 |
| 215 | Ga0207677_10081819 | 3300026023 | Bacteria | 2319 |
| 216 | Ga0207703_10004533 | 3300026035 | Bacteria | 11391 |
| 217 | Ga0207639_10001429 | 3300026041 | Bacteria | 16142 |
| 218 | Ga0207639_10028578 | 3300026041 | Bacteria | 4073 |
| 219 | Ga0207639_10042503 | 3300026041 | Bacteria | 3406 |
| 220 | Ga0207639_10050016 | 3300026041 | Bacteria | 3172 |
| 221 | Ga0207639_10056004 | 3300026041 | Bacteria | 3020 |
| 222 | Ga0207678_10000577 | 3300026067 | Bacteria | 33572 |
| 223 | Ga0207678_10000605 | 3300026067 | Bacteria | 32938 |
| 224 | Ga0207678_10055150 | 3300026067 | Bacteria | 3423 |
| 225 | Ga0207678_10069017 | 3300026067 | Bacteria | 3031 |
| 226 | Ga0207702_10006322 | 3300026078 | Bacteria | 10234 |
| 227 | Ga0207702_10042381 | 3300026078 | Bacteria | 3818 |
| 228 | Ga0207641_10000074 | 3300026088 | Bacteria | 145908 |
| 229 | Ga0207648_10018259 | 3300026089 | Bacteria | 6353 |
| 230 | Ga0207648_10039257 | 3300026089 | Bacteria | 4163 |
| 231 | Ga0207674_10001374 | 3300026116 | Bacteria | 31441 |
| 232 | Ga0207674_10047073 | 3300026116 | Bacteria | 4424 |
| 233 | Ga0207674_10068142 | 3300026116 | Bacteria | 3581 |
| 234 | Ga0207674_10113220 | 3300026116 | Bacteria | 2686 |
| 235 | Ga0207674_10132842 | 3300026116 | Bacteria | 2452 |
| 236 | Ga0207674_10147057 | 3300026116 | Bacteria | 2315 |
| 237 | Ga0207674_10178213 | 3300026116 | Bacteria | 2077 |
| 238 | Ga0207675_100005627 | 3300026118 | Bacteria | 11998 |
| 239 | Ga0207683_10015266 | 3300026121 | Bacteria | 6537 |
| 240 | Ga0207683_10123231 | 3300026121 | Bacteria | 2328 |
| 241 | Ga0209983_1002121 | 3300027665 | Bacteria | 4372 |
| 242 | Ga0209974_10008722 | 3300027876 | Bacteria | 3455 |
| 243 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 244 | Ga0268266_10013106 | 3300028379 | Bacteria | 7149 |
| 245 | Ga0268265_10003381 | 3300028380 | Bacteria | 11486 |
| 246 | Ga0268265_10162732 | 3300028380 | Bacteria | 1898 |
| 247 | Ga0307517_10115437 | 3300028786 | Bacteria | 2015 |
| 248 | Ga0265316_10000552 | 3300031344 | Bacteria | 42074 |
| 249 | Ga0307408_100160178 | 3300031548 | Bacteria | 1787 |
| 250 | Ga0307508_10036161 | 3300031616 | Bacteria | 4447 |
| 251 | Ga0265314_10001011 | 3300031711 | Bacteria | 32906 |
| 252 | Ga0307516_10001780 | 3300031730 | Bacteria | 29615 |
| 253 | Ga0307410_10003696 | 3300031852 | Bacteria | 7738 |
| 254 | Ga0307412_10041496 | 3300031911 | Bacteria | 2983 |
| 255 | Ga0307409_100126573 | 3300031995 | Bacteria | 2174 |
| 256 | Ga0307414_10000640 | 3300032004 | Bacteria | 17949 |
| 257 | Ga0307415_100014957 | 3300032126 | Bacteria | 4580 |
| 258 | Ga0373928_0006120 | 3300035084 | Bacteria | 2310 |
| 259 | Ga0373927_0178357 | 3300035695 | Bacteria | 1393 |
| 260 | Ga0373937_0001423 | 3300036401 | Bacteria | 19994 |
| 261 | Ga0395900_0030887 | 3300037418 | Bacteria | 5502 |
| 262 | Ga0395900_0068191 | 3300037418 | Bacteria | 3655 |
| 263 | Ga0395900_0108495 | 3300037418 | Bacteria | 2852 |
| 264 | Ga0395900_0200432 | 3300037418 | Bacteria | 2020 |
| 265 | Ga0395898_0029476 | 3300037466 | Bacteria | 5497 |
| 266 | Ga0395905_0001986 | 3300037471 | Bacteria | 23373 |
| 267 | Ga0395905_0051408 | 3300037471 | Bacteria | 3860 |
| 268 | Ga0395905_0067884 | 3300037471 | Bacteria | 3340 |
| 269 | Ga0395905_0113384 | 3300037471 | Bacteria | 2547 |
| 270 | Ga0395905_0242233 | 3300037471 | Bacteria | 1685 |
| 271 | Ga0395905_0268583 | 3300037471 | Bacteria | 1591 |
| 272 | Ga0395901_0016958 | 3300038443 | Bacteria | 7423 |
| 273 | Ga0451793_1028672 | 3300041452 | Bacteria | 4983 |
| 274 | Ga0451807_0280975 | 3300041486 | Bacteria | 2447 |
| 275 | Ga0451837_1074998 | 3300041494 | Bacteria | 4363 |
| 276 | Ga0439445_0000425 | 3300042004 | Bacteria | 8490 |
| 277 | Ga0439440_0003042 | 3300042993 | Bacteria | 3199 |
| 278 | Ga0466972_0018052 | 3300044658 | Bacteria | 3528 |
| 279 | Ga0466972_0018289 | 3300044658 | Bacteria | 3502 |
| 280 | Ga0466961_0048928 | 3300044693 | Bacteria | 2702 |
| 281 | Ga0466963_0022243 | 3300044694 | Bacteria | 4013 |
| 282 | Ga0466963_0030922 | 3300044694 | Bacteria | 3458 |
| 283 | Ga0466970_0042490 | 3300044765 | Bacteria | 2418 |
| 284 | Ga0466970_0066462 | 3300044765 | Bacteria | 1935 |
| 285 | Ga0466958_0016285 | 3300045836 | Bacteria | 4278 |
| 286 | Ga0466958_0021438 | 3300045836 | Bacteria | 3776 |
| 287 | Ga0466958_0051702 | 3300045836 | Bacteria | 2488 |
| 288 | Ga0466967_0098032 | 3300045976 | Bacteria | 2676 |
| 289 | Ga0466967_0167175 | 3300045976 | Bacteria | 2067 |
| 290 | Ga0495638_0000071 | 3300046460 | Bacteria | 166300 |
| 291 | Ga0495638_0023689 | 3300046460 | Bacteria | 4011 |
| 292 | Ga0495650_0001249 | 3300046471 | Bacteria | 26263 |
| 293 | Ga0495580_0010286 | 3300046472 | Bacteria | 7297 |
| 294 | Ga0495606_0008027 | 3300046507 | Bacteria | 9269 |
| 295 | Ga0495616_0000128 | 3300046513 | Bacteria | 66249 |
| 296 | Ga0495632_0033484 | 3300046519 | Bacteria | 2638 |
| 297 | Ga0495621_0012646 | 3300046539 | Bacteria | 2634 |
| 298 | Ga0495621_0013094 | 3300046539 | Bacteria | 2601 |
| 299 | Ga0496100_0081862 | 3300048903 | Unclassified | 2182 |
| 300 | Ga0496101_0064720 | 3300048904 | Bacteria | 2664 |
| 301 | Ga0496101_0239423 | 3300048904 | Bacteria | 1412 |
| 302 | Ga0496102_0079320 | 3300048905 | Bacteria | 3023 |
| 303 | Ga0496103_0003328 | 3300048906 | Bacteria | 9832 |
| 304 | Ga0496103_0059374 | 3300048906 | Bacteria | 2376 |
| 305 | Ga0496104_0024451 | 3300048907 | Bacteria | 5555 |
| 306 | Ga0496106_0067254 | 3300048909 | Bacteria | 2731 |
| 307 | Ga0496108_0096433 | 3300048911 | Bacteria | 2519 |
| 308 | Ga0496108_0103696 | 3300048911 | Bacteria | 2427 |
| 309 | Ga0496110_0099774 | 3300048913 | Bacteria | 2603 |
| 310 | Ga0496112_0040575 | 3300048915 | Bacteria | 4551 |
| 311 | Ga0496113_0053256 | 3300048916 | Bacteria | 3025 |
| 312 | Ga0496114_0179798 | 3300048917 | Bacteria | 1847 |
| 313 | Ga0496118_0006022 | 3300048921 | Bacteria | 13511 |
| 314 | Ga0496121_0047767 | 3300048924 | Bacteria | 3648 |
| 315 | Ga0496122_0004243 | 3300048925 | Bacteria | 17977 |
| 316 | Ga0496123_0002066 | 3300048926 | Bacteria | 25899 |
| 317 | Ga0496124_0000052 | 3300048927 | Bacteria | 252750 |
| 318 | Ga0496124_0018373 | 3300048927 | Bacteria | 6549 |
| 319 | Ga0501032_0002036 | 3300049569 | Bacteria | 15952 |
| 320 | Ga0501032_0003170 | 3300049569 | Bacteria | 12659 |
| 321 | Ga0501032_0033949 | 3300049569 | Bacteria | 3494 |
| 322 | Ga0501033_0003002 | 3300049570 | Bacteria | 14086 |
| 323 | Ga0501033_0003081 | 3300049570 | Bacteria | 13854 |
| 324 | Ga0501034_0001904 | 3300049571 | Bacteria | 26429 |
| 325 | Ga0501034_0051510 | 3300049571 | Bacteria | 4150 |
| 326 | Ga0501034_0055913 | 3300049571 | Bacteria | 3971 |
| 327 | Ga0501034_0108331 | 3300049571 | Bacteria | 2769 |
| 328 | Ga0501036_0052580 | 3300049572 | Bacteria | 3449 |
| 329 | Ga0501036_0053627 | 3300049572 | Bacteria | 3414 |
| 330 | Ga0501037_0000948 | 3300049573 | Bacteria | 21559 |
| 331 | Ga0501037_0102156 | 3300049573 | Bacteria | 2068 |
| 332 | Ga0501038_0000712 | 3300049574 | Bacteria | 29729 |
| 333 | Ga0501038_0004188 | 3300049574 | Bacteria | 13395 |
| 334 | Ga0501038_0065003 | 3300049574 | Bacteria | 3109 |
| 335 | Ga0501039_0007044 | 3300049575 | Bacteria | 8558 |
| 336 | Ga0501039_0032571 | 3300049575 | Bacteria | 4019 |
| 337 | Ga0501039_0102966 | 3300049575 | Bacteria | 2228 |
| 338 | Ga0501039_0115009 | 3300049575 | Bacteria | 2105 |
| 339 | Ga0501040_0013160 | 3300049576 | Bacteria | 5441 |
| 340 | Ga0501042_0037745 | 3300049578 | Bacteria | 3429 |
| 341 | Ga0501043_0005297 | 3300049579 | Bacteria | 10428 |
| 342 | Ga0501043_0032363 | 3300049579 | Bacteria | 4111 |
| 343 | Ga0501046_0013710 | 3300049580 | Bacteria | 6854 |
| 344 | Ga0501046_0028083 | 3300049580 | Bacteria | 4584 |
| 345 | Ga0501047_0020575 | 3300049581 | Bacteria | 6336 |
| 346 | Ga0501047_0036088 | 3300049581 | Bacteria | 4776 |
| 347 | Ga0501047_0082309 | 3300049581 | Bacteria | 3094 |
| 348 | Ga0501047_0131717 | 3300049581 | Bacteria | 2380 |
| 349 | Ga0501048_0026548 | 3300049582 | Bacteria | 4216 |
| 350 | Ga0501067_0026748 | 3300049583 | Bacteria | 3194 |
| 351 | Ga0501069_0029897 | 3300049585 | Bacteria | 2990 |
| 352 | Ga0501070_0008039 | 3300049586 | Bacteria | 8930 |
| 353 | Ga0501070_0008908 | 3300049586 | Bacteria | 8483 |
| 354 | Ga0501070_0056768 | 3300049586 | Bacteria | 3245 |
| 355 | Ga0501070_0096593 | 3300049586 | Bacteria | 2444 |
| 356 | Ga0501071_0004988 | 3300049587 | Bacteria | 8483 |
| 357 | Ga0501071_0099729 | 3300049587 | Bacteria | 2140 |
| 358 | Ga0501072_0048687 | 3300049588 | Bacteria | 3337 |
| 359 | Ga0501073_0001226 | 3300049589 | Bacteria | 18704 |
| 360 | Ga0501073_0029761 | 3300049589 | Bacteria | 3903 |
| 361 | Ga0501074_0009561 | 3300049590 | Bacteria | 7039 |
| 362 | Ga0501080_0013444 | 3300049742 | Bacteria | 7530 |
| 363 | Ga0501080_0045549 | 3300049742 | Bacteria | 4083 |
| 364 | Ga0501035_0001396 | 3300049822 | Bacteria | 24796 |
| 365 | Ga0501035_0058247 | 3300049822 | Bacteria | 3443 |
| 366 | Ga0501044_0078413 | 3300049823 | Bacteria | 3347 |
| 367 | nmdc:mga00v17_118180_c1 | 3300050491 | Bacteria | 1687 |
| 368 | nmdc:mga06r32_3606_c1 | 3300050510 | Bacteria | 13817 |
| 369 | nmdc:mga08y16_30716_c1 | 3300050511 | Bacteria | 5650 |
| 370 | Ga0500610_0011011 | 3300053079 | Bacteria | 4098 |
| 371 | Ga0500651_0014757 | 3300053093 | Bacteria | 4783 |
| 372 | Ga0500616_0000073 | 3300053153 | Bacteria | 231290 |
| 373 | Ga0500616_0007454 | 3300053153 | Bacteria | 6948 |
| 374 | Ga0500622_0003525 | 3300053156 | Bacteria | 10378 |
| 375 | Ga0501084_0012807 | 3300054114 | Bacteria | 6948 |
| 376 | Ga0501082_0018364 | 3300060353 | Bacteria | 6022 |
| 377 | Ga0466962_0001188 | 3300061719 | Bacteria | 12013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0178357 | Ga0373927_0178357_88_1242 | 384 |
| 2 | 3300045836 | Ga0466958_0021438 | Ga0466958_0021438_2556_3728 | 390 |
| 3 | 3300046472 | Ga0495580_0010286 | Ga0495580_0010286_5938_7224 | 417 |
| 4 | 3300005546 | Ga0070696_100038203 | Ga0070696_1000382033 | 429 |
| 5 | 3300025917 | Ga0207660_10052124 | Ga0207660_100521242 | 429 |
| 6 | 3300050510 | nmdc:mga06r32_3606_c1 | nmdc:mga06r32_3606_c1_6538_8040 | 429 |
| 7 | 3300006847 | Ga0075431_100043025 | Ga0075431_1000430252 | 430 |
| 8 | 3300046460 | Ga0495638_0023689 | Ga0495638_0023689_107_1495 | 433 |
| 9 | 3300013307 | Ga0157372_10364097 | Ga0157372_103640971 | 436 |
| 10 | 3300048925 | Ga0496122_0004243 | Ga0496122_0004243_16305_17729 | 439 |
| 11 | 3300048926 | Ga0496123_0002066 | Ga0496123_0002066_16874_18298 | 439 |
| 12 | 3300048927 | Ga0496124_0018373 | Ga0496124_0018373_906_2330 | 439 |
| 13 | 3300053156 | Ga0500622_0003525 | Ga0500622_0003525_6290_7684 | 439 |
| 14 | 3300036401 | Ga0373937_0001423 | Ga0373937_0001423_17519_18892 | 440 |
| 15 | 3300048904 | Ga0496101_0239423 | Ga0496101_0239423_44_1402 | 441 |
| 16 | 3300006880 | Ga0075429_100031963 | Ga0075429_1000319633 | 442 |
| 17 | 3300026078 | Ga0207702_10042381 | Ga0207702_100423812 | 442 |
| 18 | 3300037418 | Ga0395900_0108495 | Ga0395900_0108495_1186_2586 | 442 |
| 19 | 3300045976 | Ga0466967_0098032 | Ga0466967_0098032_1011_2417 | 443 |
| 20 | 3300061719 | Ga0466962_0001188 | Ga0466962_0001188_10189_11595 | 443 |
| 21 | 3300050491 | nmdc:mga00v17_118180_c1 | nmdc:mga00v17_118180_c1_33_1478 | 444 |
| 22 | 3300032004 | Ga0307414_10000640 | Ga0307414_100006405 | 446 |
| 23 | 3300005548 | Ga0070665_100079322 | Ga0070665_1000793222 | 447 |
| 24 | 3300013296 | Ga0157374_10020266 | Ga0157374_100202662 | 448 |
| 25 | 3300013306 | Ga0163162_10000661 | Ga0163162_1000066119 | 448 |
| 26 | 3300014968 | Ga0157379_10198035 | Ga0157379_101980351 | 448 |
| 27 | 3300037471 | Ga0395905_0268583 | Ga0395905_0268583_112_1512 | 448 |
| 28 | 3300026041 | Ga0207639_10028578 | Ga0207639_100285784 | 449 |
| 29 | 3300031911 | Ga0307412_10041496 | Ga0307412_100414965 | 449 |
| 30 | 3300032126 | Ga0307415_100014957 | Ga0307415_1000149573 | 449 |
| 31 | 3300005353 | Ga0070669_100008737 | Ga0070669_1000087377 | 451 |
| 32 | 3300005355 | Ga0070671_100167791 | Ga0070671_1001677912 | 451 |
| 33 | 3300005459 | Ga0068867_100016022 | Ga0068867_1000160223 | 451 |
| 34 | 3300025923 | Ga0207681_10061958 | Ga0207681_100619582 | 451 |
| 35 | 3300025931 | Ga0207644_10156670 | Ga0207644_101566702 | 451 |
| 36 | 3300026089 | Ga0207648_10018259 | Ga0207648_100182594 | 451 |
| 37 | 3300028786 | Ga0307517_10115437 | Ga0307517_101154372 | 451 |
| 38 | 3300046539 | Ga0495621_0013094 | Ga0495621_0013094_43_1446 | 451 |
| 39 | 3300005293 | Ga0065715_10004139 | Ga0065715_100041392 | 452 |
| 40 | 3300006173 | Ga0070716_100072907 | Ga0070716_1000729072 | 452 |
| 41 | 3300014968 | Ga0157379_10049278 | Ga0157379_100492782 | 452 |
| 42 | 3300044693 | Ga0466961_0048928 | Ga0466961_0048928_372_1778 | 452 |
| 43 | 3300048905 | Ga0496102_0079320 | Ga0496102_0079320_939_2369 | 452 |
| 44 | 3300048906 | Ga0496103_0003328 | Ga0496103_0003328_755_2185 | 452 |
| 45 | 3300048907 | Ga0496104_0024451 | Ga0496104_0024451_2069_3499 | 452 |
| 46 | 3300048909 | Ga0496106_0067254 | Ga0496106_0067254_916_2346 | 452 |
| 47 | 3300045836 | Ga0466958_0051702 | Ga0466958_0051702_449_1855 | 453 |
| 48 | 3300048911 | Ga0496108_0096433 | Ga0496108_0096433_794_2191 | 453 |
| 49 | 3300048916 | Ga0496113_0053256 | Ga0496113_0053256_357_1754 | 453 |
| 50 | 3300003322 | rootL2_10144909 | rootL2_101449098 | 454 |
| 51 | 3300005564 | Ga0070664_100038681 | Ga0070664_1000386812 | 454 |
| 52 | 3300010375 | Ga0105239_10077799 | Ga0105239_100777992 | 454 |
| 53 | 3300037418 | Ga0395900_0068191 | Ga0395900_0068191_1896_3296 | 454 |
| 54 | 3300037471 | Ga0395905_0001986 | Ga0395905_0001986_10936_12336 | 454 |
| 55 | 3300037471 | Ga0395905_0067884 | Ga0395905_0067884_100_1500 | 454 |
| 56 | 3300038443 | Ga0395901_0016958 | Ga0395901_0016958_2918_4318 | 454 |
| 57 | 3300044694 | Ga0466963_0030922 | Ga0466963_0030922_1356_2762 | 454 |
| 58 | 3300006195 | Ga0075366_10094111 | Ga0075366_100941112 | 457 |
| 59 | 3300026116 | Ga0207674_10113220 | Ga0207674_101132202 | 457 |
| 60 | 3300044694 | Ga0466963_0022243 | Ga0466963_0022243_866_2269 | 457 |
| 61 | 3300045976 | Ga0466967_0167175 | Ga0466967_0167175_101_1504 | 457 |
| 62 | 3300005329 | Ga0070683_100037011 | Ga0070683_1000370111 | 458 |
| 63 | 3300005334 | Ga0068869_100018323 | Ga0068869_1000183233 | 458 |
| 64 | 3300005338 | Ga0068868_100034060 | Ga0068868_1000340602 | 458 |
| 65 | 3300005347 | Ga0070668_100000010 | Ga0070668_100000010110 | 458 |
| 66 | 3300005347 | Ga0070668_100055291 | Ga0070668_1000552911 | 458 |
| 67 | 3300005353 | Ga0070669_100017171 | Ga0070669_1000171712 | 458 |
| 68 | 3300005366 | Ga0070659_100027120 | Ga0070659_1000271204 | 458 |
| 69 | 3300005367 | Ga0070667_100002680 | Ga0070667_1000026808 | 458 |
| 70 | 3300005439 | Ga0070711_100000213 | Ga0070711_1000002133 | 458 |
| 71 | 3300005444 | Ga0070694_100103767 | Ga0070694_1001037671 | 458 |
| 72 | 3300005455 | Ga0070663_100101179 | Ga0070663_1001011791 | 458 |
| 73 | 3300005456 | Ga0070678_100063676 | Ga0070678_1000636762 | 458 |
| 74 | 3300005457 | Ga0070662_100001779 | Ga0070662_1000017793 | 458 |
| 75 | 3300005548 | Ga0070665_100003754 | Ga0070665_1000037542 | 458 |
| 76 | 3300005614 | Ga0068856_100086037 | Ga0068856_1000860371 | 458 |
| 77 | 3300005841 | Ga0068863_100000192 | Ga0068863_10000019232 | 458 |
| 78 | 3300005843 | Ga0068860_100079992 | Ga0068860_1000799923 | 458 |
| 79 | 3300006175 | Ga0070712_100002507 | Ga0070712_1000025071 | 458 |
| 80 | 3300009101 | Ga0105247_10016742 | Ga0105247_100167423 | 458 |
| 81 | 3300009148 | Ga0105243_10005369 | Ga0105243_100053693 | 458 |
| 82 | 3300009174 | Ga0105241_10102872 | Ga0105241_101028722 | 458 |
| 83 | 3300009177 | Ga0105248_10105742 | Ga0105248_101057423 | 458 |
| 84 | 3300009551 | Ga0105238_10057826 | Ga0105238_100578263 | 458 |
| 85 | 3300009553 | Ga0105249_10041721 | Ga0105249_100417211 | 458 |
| 86 | 3300013102 | Ga0157371_10009125 | Ga0157371_100091252 | 458 |
| 87 | 3300013105 | Ga0157369_10087659 | Ga0157369_100876591 | 458 |
| 88 | 3300013296 | Ga0157374_10015323 | Ga0157374_100153232 | 458 |
| 89 | 3300013296 | Ga0157374_10087489 | Ga0157374_100874892 | 458 |
| 90 | 3300013306 | Ga0163162_10032532 | Ga0163162_100325322 | 458 |
| 91 | 3300013308 | Ga0157375_10024351 | Ga0157375_100243513 | 458 |
| 92 | 3300014968 | Ga0157379_10015473 | Ga0157379_100154736 | 458 |
| 93 | 3300025899 | Ga0207642_10007350 | Ga0207642_100073503 | 458 |
| 94 | 3300025907 | Ga0207645_10018285 | Ga0207645_100182852 | 458 |
| 95 | 3300025911 | Ga0207654_10073662 | Ga0207654_100736622 | 458 |
| 96 | 3300025913 | Ga0207695_10023972 | Ga0207695_100239725 | 458 |
| 97 | 3300025915 | Ga0207693_10004449 | Ga0207693_100044492 | 458 |
| 98 | 3300025916 | Ga0207663_10006575 | Ga0207663_100065754 | 458 |
| 99 | 3300025919 | Ga0207657_10005796 | Ga0207657_100057964 | 458 |
| 100 | 3300025921 | Ga0207652_10222339 | Ga0207652_102223392 | 458 |
| 101 | 3300025923 | Ga0207681_10033357 | Ga0207681_100333572 | 458 |
| 102 | 3300025933 | Ga0207706_10003438 | Ga0207706_100034385 | 458 |
| 103 | 3300025934 | Ga0207686_10117624 | Ga0207686_101176241 | 458 |
| 104 | 3300025938 | Ga0207704_10058351 | Ga0207704_100583511 | 458 |
| 105 | 3300025941 | Ga0207711_10000892 | Ga0207711_1000089218 | 458 |
| 106 | 3300025942 | Ga0207689_10025732 | Ga0207689_100257323 | 458 |
| 107 | 3300025944 | Ga0207661_10007878 | Ga0207661_100078785 | 458 |
| 108 | 3300025949 | Ga0207667_10012830 | Ga0207667_100128308 | 458 |
| 109 | 3300025949 | Ga0207667_10177398 | Ga0207667_101773981 | 458 |
| 110 | 3300025961 | Ga0207712_10026173 | Ga0207712_100261731 | 458 |
| 111 | 3300025972 | Ga0207668_10000020 | Ga0207668_10000020112 | 458 |
| 112 | 3300026067 | Ga0207678_10000605 | Ga0207678_100006055 | 458 |
| 113 | 3300026078 | Ga0207702_10006322 | Ga0207702_100063221 | 458 |
| 114 | 3300026088 | Ga0207641_10000074 | Ga0207641_1000007433 | 458 |
| 115 | 3300026089 | Ga0207648_10039257 | Ga0207648_100392573 | 458 |
| 116 | 3300026116 | Ga0207674_10068142 | Ga0207674_100681422 | 458 |
| 117 | 3300026121 | Ga0207683_10123231 | Ga0207683_101232311 | 458 |
| 118 | 3300035084 | Ga0373928_0006120 | Ga0373928_0006120_433_1887 | 458 |
| 119 | 3300046471 | Ga0495650_0001249 | Ga0495650_0001249_5397_6782 | 458 |
| 120 | 3300048903 | Ga0496100_0081862 | Ga0496100_0081862_282_1814 | 458 |
| 121 | 3300048904 | Ga0496101_0064720 | Ga0496101_0064720_52_1518 | 458 |
| 122 | 3300048906 | Ga0496103_0059374 | Ga0496103_0059374_726_2180 | 458 |
| 123 | 3300048911 | Ga0496108_0103696 | Ga0496108_0103696_117_1571 | 458 |
| 124 | 3300048915 | Ga0496112_0040575 | Ga0496112_0040575_3034_4488 | 458 |
| 125 | 3300048917 | Ga0496114_0179798 | Ga0496114_0179798_315_1772 | 458 |
| 126 | 3300053153 | Ga0500616_0007454 | Ga0500616_0007454_1864_3285 | 458 |
| 127 | 3300005293 | Ga0065715_10000370 | Ga0065715_100003706 | 459 |
| 128 | 3300005328 | Ga0070676_10005808 | Ga0070676_100058086 | 459 |
| 129 | 3300005331 | Ga0070670_100001146 | Ga0070670_1000011464 | 459 |
| 130 | 3300005331 | Ga0070670_100001912 | Ga0070670_1000019125 | 459 |
| 131 | 3300005333 | Ga0070677_10000430 | Ga0070677_1000043010 | 459 |
| 132 | 3300005335 | Ga0070666_10062912 | Ga0070666_100629124 | 459 |
| 133 | 3300005347 | Ga0070668_100004333 | Ga0070668_1000043336 | 459 |
| 134 | 3300005354 | Ga0070675_100002570 | Ga0070675_1000025709 | 459 |
| 135 | 3300005356 | Ga0070674_100024727 | Ga0070674_1000247272 | 459 |
| 136 | 3300005364 | Ga0070673_100109910 | Ga0070673_1001099104 | 459 |
| 137 | 3300005367 | Ga0070667_100168875 | Ga0070667_1001688752 | 459 |
| 138 | 3300005445 | Ga0070708_100009847 | Ga0070708_1000098474 | 459 |
| 139 | 3300005456 | Ga0070678_100018052 | Ga0070678_1000180525 | 459 |
| 140 | 3300005457 | Ga0070662_100001494 | Ga0070662_1000014945 | 459 |
| 141 | 3300005518 | Ga0070699_100124316 | Ga0070699_1001243162 | 459 |
| 142 | 3300005536 | Ga0070697_100004946 | Ga0070697_1000049465 | 459 |
| 143 | 3300005543 | Ga0070672_100001865 | Ga0070672_1000018655 | 459 |
| 144 | 3300005577 | Ga0068857_100065328 | Ga0068857_1000653285 | 459 |
| 145 | 3300005617 | Ga0068859_100008008 | Ga0068859_1000080086 | 459 |
| 146 | 3300005617 | Ga0068859_100245019 | Ga0068859_1002450192 | 459 |
| 147 | 3300005618 | Ga0068864_100129247 | Ga0068864_1001292473 | 459 |
| 148 | 3300005843 | Ga0068860_100193439 | Ga0068860_1001934392 | 459 |
| 149 | 3300006931 | Ga0097620_100008008 | Ga0097620_1000080086 | 459 |
| 150 | 3300006931 | Ga0097620_100245016 | Ga0097620_1002450161 | 459 |
| 151 | 3300009094 | Ga0111539_10014598 | Ga0111539_100145987 | 459 |
| 152 | 3300009553 | Ga0105249_10036784 | Ga0105249_100367843 | 459 |
| 153 | 3300014326 | Ga0157380_10001232 | Ga0157380_100012329 | 459 |
| 154 | 3300017792 | Ga0163161_10014477 | Ga0163161_100144775 | 459 |
| 155 | 3300025315 | Ga0207697_10003482 | Ga0207697_100034825 | 459 |
| 156 | 3300025893 | Ga0207682_10001260 | Ga0207682_100012609 | 459 |
| 157 | 3300025901 | Ga0207688_10009238 | Ga0207688_100092382 | 459 |
| 158 | 3300025903 | Ga0207680_10064873 | Ga0207680_100648732 | 459 |
| 159 | 3300025907 | Ga0207645_10006206 | Ga0207645_100062063 | 459 |
| 160 | 3300025910 | Ga0207684_10004327 | Ga0207684_100043274 | 459 |
| 161 | 3300025923 | Ga0207681_10000980 | Ga0207681_100009809 | 459 |
| 162 | 3300025925 | Ga0207650_10000537 | Ga0207650_1000053718 | 459 |
| 163 | 3300025925 | Ga0207650_10002481 | Ga0207650_100024815 | 459 |
| 164 | 3300025933 | Ga0207706_10000415 | Ga0207706_1000041541 | 459 |
| 165 | 3300025940 | Ga0207691_10006421 | Ga0207691_100064219 | 459 |
| 166 | 3300025942 | Ga0207689_10166786 | Ga0207689_101667861 | 459 |
| 167 | 3300025960 | Ga0207651_10004533 | Ga0207651_100045335 | 459 |
| 168 | 3300025961 | Ga0207712_10008952 | Ga0207712_100089525 | 459 |
| 169 | 3300025972 | Ga0207668_10001025 | Ga0207668_100010257 | 459 |
| 170 | 3300025986 | Ga0207658_10029760 | Ga0207658_100297603 | 459 |
| 171 | 3300026067 | Ga0207678_10069017 | Ga0207678_100690175 | 459 |
| 172 | 3300026118 | Ga0207675_100005627 | Ga0207675_1000056278 | 459 |
| 173 | 3300026121 | Ga0207683_10015266 | Ga0207683_100152666 | 459 |
| 174 | 3300028380 | Ga0268265_10003381 | Ga0268265_100033816 | 459 |
| 175 | 3300028380 | Ga0268265_10162732 | Ga0268265_101627322 | 459 |
| 176 | 3300041494 | Ga0451837_1074998 | Ga0451837_1074998_2478_3902 | 459 |
| 177 | 3300042004 | Ga0439445_0000425 | Ga0439445_0000425_6232_7614 | 459 |
| 178 | 3300046539 | Ga0495621_0012646 | Ga0495621_0012646_67_1512 | 459 |
| 179 | 3300048927 | Ga0496124_0000052 | Ga0496124_0000052_168273_169685 | 459 |
| 180 | 3300050511 | nmdc:mga08y16_30716_c1 | nmdc:mga08y16_30716_c1_2896_4341 | 459 |
| 181 | 3300025932 | Ga0207690_10019418 | Ga0207690_100194183 | 460 |
| 182 | 3300025972 | Ga0207668_10094294 | Ga0207668_100942944 | 460 |
| 183 | 3300031344 | Ga0265316_10000552 | Ga0265316_1000055237 | 460 |
| 184 | 3300031711 | Ga0265314_10001011 | Ga0265314_1000101132 | 460 |
| 185 | iso_pu_bacteria | 8002869464 | 8002871140 | 460 |
| 186 | 3300025927 | Ga0207687_10000509 | Ga0207687_1000050914 | 461 |
| 187 | 3300031852 | Ga0307410_10003696 | Ga0307410_100036963 | 461 |
| 188 | 3300031995 | Ga0307409_100126573 | Ga0307409_1001265731 | 461 |
| 189 | 3300049570 | Ga0501033_0003002 | Ga0501033_0003002_3560_4951 | 461 |
| 190 | 3300005331 | Ga0070670_100048114 | Ga0070670_1000481142 | 462 |
| 191 | 3300005539 | Ga0068853_100070566 | Ga0068853_1000705662 | 462 |
| 192 | 3300005543 | Ga0070672_100039343 | Ga0070672_1000393433 | 462 |
| 193 | 3300005563 | Ga0068855_100038563 | Ga0068855_1000385632 | 462 |
| 194 | 3300009545 | Ga0105237_10000036 | Ga0105237_10000036117 | 462 |
| 195 | 3300013104 | Ga0157370_10093305 | Ga0157370_100933052 | 462 |
| 196 | 3300013306 | Ga0163162_10177319 | Ga0163162_101773192 | 462 |
| 197 | 3300013308 | Ga0157375_10025199 | Ga0157375_100251996 | 462 |
| 198 | 3300017792 | Ga0163161_10066669 | Ga0163161_100666695 | 462 |
| 199 | 3300020070 | Ga0206356_11030950 | Ga0206356_110309503 | 462 |
| 200 | 3300025913 | Ga0207695_10031281 | Ga0207695_100312812 | 462 |
| 201 | 3300025914 | Ga0207671_10001404 | Ga0207671_1000140414 | 462 |
| 202 | 3300026041 | Ga0207639_10056004 | Ga0207639_100560042 | 462 |
| 203 | 3300026116 | Ga0207674_10147057 | Ga0207674_101470572 | 462 |
| 204 | 3300031730 | Ga0307516_10001780 | Ga0307516_1000178021 | 462 |
| 205 | 3300037418 | Ga0395900_0030887 | Ga0395900_0030887_2951_4351 | 462 |
| 206 | 3300037418 | Ga0395900_0200432 | Ga0395900_0200432_170_1561 | 462 |
| 207 | 3300037471 | Ga0395905_0051408 | Ga0395905_0051408_1146_2546 | 462 |
| 208 | 3300037471 | Ga0395905_0113384 | Ga0395905_0113384_1076_2473 | 462 |
| 209 | 3300048913 | Ga0496110_0099774 | Ga0496110_0099774_437_1834 | 462 |
| 210 | 3300005338 | Ga0068868_100055590 | Ga0068868_1000555902 | 463 |
| 211 | 3300013105 | Ga0157369_10002396 | Ga0157369_1000239612 | 463 |
| 212 | 3300026023 | Ga0207677_10081819 | Ga0207677_100818193 | 463 |
| 213 | 3300031548 | Ga0307408_100160178 | Ga0307408_1001601781 | 463 |
| 214 | 3300042993 | Ga0439440_0003042 | Ga0439440_0003042_1237_2649 | 463 |
| 215 | 3300001979 | JGI24740J21852_10005928 | JGI24740J21852_100059286 | 464 |
| 216 | 3300001990 | JGI24737J22298_10007427 | JGI24737J22298_100074275 | 464 |
| 217 | 3300005328 | Ga0070676_10009336 | Ga0070676_100093362 | 464 |
| 218 | 3300005336 | Ga0070680_100133330 | Ga0070680_1001333303 | 464 |
| 219 | 3300005341 | Ga0070691_10000860 | Ga0070691_100008604 | 464 |
| 220 | 3300005455 | Ga0070663_100012612 | Ga0070663_1000126122 | 464 |
| 221 | 3300005535 | Ga0070684_100005253 | Ga0070684_1000052532 | 464 |
| 222 | 3300005539 | Ga0068853_100006884 | Ga0068853_1000068847 | 464 |
| 223 | 3300005578 | Ga0068854_100004796 | Ga0068854_1000047963 | 464 |
| 224 | 3300005834 | Ga0068851_10095164 | Ga0068851_100951641 | 464 |
| 225 | 3300009174 | Ga0105241_10076177 | Ga0105241_100761775 | 464 |
| 226 | 3300009545 | Ga0105237_10121489 | Ga0105237_101214895 | 464 |
| 227 | 3300009551 | Ga0105238_10094149 | Ga0105238_100941491 | 464 |
| 228 | 3300013307 | Ga0157372_10011769 | Ga0157372_100117693 | 464 |
| 229 | 3300025919 | Ga0207657_10005336 | Ga0207657_100053367 | 464 |
| 230 | 3300025919 | Ga0207657_10012306 | Ga0207657_100123062 | 464 |
| 231 | 3300025920 | Ga0207649_10012580 | Ga0207649_100125806 | 464 |
| 232 | 3300025932 | Ga0207690_10007160 | Ga0207690_100071607 | 464 |
| 233 | 3300025944 | Ga0207661_10012276 | Ga0207661_100122765 | 464 |
| 234 | 3300026116 | Ga0207674_10001374 | Ga0207674_1000137427 | 464 |
| 235 | 3300026116 | Ga0207674_10132842 | Ga0207674_101328422 | 464 |
| 236 | 3300028379 | Ga0268266_10013106 | Ga0268266_100131064 | 464 |
| 237 | 3300044658 | Ga0466972_0018052 | Ga0466972_0018052_216_1622 | 464 |
| 238 | 3300044765 | Ga0466970_0042490 | Ga0466970_0042490_445_1851 | 464 |
| 239 | 3300044765 | Ga0466970_0066462 | Ga0466970_0066462_385_1791 | 464 |
| 240 | 3300045836 | Ga0466958_0016285 | Ga0466958_0016285_2615_4021 | 464 |
| 241 | 3300005617 | Ga0068859_100220755 | Ga0068859_1002207552 | 465 |
| 242 | 3300009093 | Ga0105240_10094462 | Ga0105240_100944622 | 465 |
| 243 | 3300037471 | Ga0395905_0242233 | Ga0395905_0242233_133_1533 | 465 |
| 244 | 3300005564 | Ga0070664_100058591 | Ga0070664_1000585913 | 466 |
| 245 | 3300031616 | Ga0307508_10036161 | Ga0307508_100361613 | 466 |
| 246 | 3300049569 | Ga0501032_0003170 | Ga0501032_0003170_6496_7908 | 466 |
| 247 | 3300049571 | Ga0501034_0055913 | Ga0501034_0055913_1249_2664 | 466 |
| 248 | 3300049572 | Ga0501036_0052580 | Ga0501036_0052580_1503_2915 | 466 |
| 249 | 3300049574 | Ga0501038_0004188 | Ga0501038_0004188_4996_6408 | 466 |
| 250 | 3300049575 | Ga0501039_0102966 | Ga0501039_0102966_201_1613 | 466 |
| 251 | 3300049581 | Ga0501047_0020575 | Ga0501047_0020575_2109_3521 | 466 |
| 252 | 3300049586 | Ga0501070_0008908 | Ga0501070_0008908_6640_8052 | 466 |
| 253 | 3300049587 | Ga0501071_0099729 | Ga0501071_0099729_387_1799 | 466 |
| 254 | 3300049589 | Ga0501073_0029761 | Ga0501073_0029761_2116_3528 | 466 |
| 255 | 3300049822 | Ga0501035_0058247 | Ga0501035_0058247_823_2235 | 466 |
| 256 | 3300005288 | Ga0065714_10014670 | Ga0065714_100146703 | 467 |
| 257 | 3300013102 | Ga0157371_10058202 | Ga0157371_100582022 | 467 |
| 258 | 3300046507 | Ga0495606_0008027 | Ga0495606_0008027_4641_6050 | 467 |
| 259 | 3300013306 | Ga0163162_10000042 | Ga0163162_1000004215 | 468 |
| 260 | 3300025972 | Ga0207668_10029007 | Ga0207668_100290075 | 468 |
| 261 | 3300027665 | Ga0209983_1002121 | Ga0209983_10021212 | 468 |
| 262 | 3300027876 | Ga0209974_10008722 | Ga0209974_100087224 | 468 |
| 263 | 3300053153 | Ga0500616_0000073 | Ga0500616_0000073_13181_14623 | 468 |
| 264 | iso_pu_bacteria | 2919513703 | 2919515433 | 468 |
| 265 | iso_pu_bacteria | 2919675420 | 2919675814 | 468 |
| 266 | 3300049569 | Ga0501032_0033949 | Ga0501032_0033949_159_1580 | 469 |
| 267 | 3300049571 | Ga0501034_0108331 | Ga0501034_0108331_172_1593 | 469 |
| 268 | 3300049573 | Ga0501037_0102156 | Ga0501037_0102156_356_1777 | 469 |
| 269 | 3300049575 | Ga0501039_0115009 | Ga0501039_0115009_125_1546 | 469 |
| 270 | 3300049581 | Ga0501047_0082309 | Ga0501047_0082309_1533_2954 | 469 |
| 271 | 3300049586 | Ga0501070_0096593 | Ga0501070_0096593_33_1454 | 469 |
| 272 | 3300010375 | Ga0105239_10009641 | Ga0105239_100096415 | 470 |
| 273 | 3300005530 | Ga0070679_100091109 | Ga0070679_1000911093 | 471 |
| 274 | 3300025921 | Ga0207652_10018199 | Ga0207652_100181995 | 471 |
| 275 | 3300041452 | Ga0451793_1028672 | Ga0451793_1028672_384_1799 | 471 |
| 276 | 3300005355 | Ga0070671_100084080 | Ga0070671_1000840801 | 473 |
| 277 | 3300005367 | Ga0070667_100078353 | Ga0070667_1000783532 | 473 |
| 278 | 3300005539 | Ga0068853_100001040 | Ga0068853_10000104016 | 473 |
| 279 | 3300005539 | Ga0068853_100001130 | Ga0068853_10000113010 | 473 |
| 280 | 3300005548 | Ga0070665_100097206 | Ga0070665_1000972062 | 473 |
| 281 | 3300005563 | Ga0068855_100009258 | Ga0068855_10000925810 | 473 |
| 282 | 3300005563 | Ga0068855_100064659 | Ga0068855_1000646594 | 473 |
| 283 | 3300005614 | Ga0068856_100040668 | Ga0068856_1000406684 | 473 |
| 284 | 3300005841 | Ga0068863_100007347 | Ga0068863_1000073477 | 473 |
| 285 | 3300005983 | Ga0081540_1012187 | Ga0081540_10121876 | 473 |
| 286 | 3300009093 | Ga0105240_10201786 | Ga0105240_102017862 | 473 |
| 287 | 3300025303 | Ga0209051_1018017 | Ga0209051_10180172 | 473 |
| 288 | 3300025949 | Ga0207667_10009556 | Ga0207667_100095565 | 473 |
| 289 | 3300025981 | Ga0207640_10060496 | Ga0207640_100604962 | 473 |
| 290 | 3300026041 | Ga0207639_10001429 | Ga0207639_1000142915 | 473 |
| 291 | 3300026041 | Ga0207639_10050016 | Ga0207639_100500163 | 473 |
| 292 | 3300026067 | Ga0207678_10055150 | Ga0207678_100551502 | 473 |
| 293 | 3300026116 | Ga0207674_10047073 | Ga0207674_100470733 | 473 |
| 294 | 3300026116 | Ga0207674_10178213 | Ga0207674_101782132 | 473 |
| 295 | 3300044658 | Ga0466972_0018289 | Ga0466972_0018289_1060_2499 | 473 |
| 296 | 3300049569 | Ga0501032_0002036 | Ga0501032_0002036_6599_8023 | 473 |
| 297 | 3300049570 | Ga0501033_0003081 | Ga0501033_0003081_11247_12671 | 473 |
| 298 | 3300049571 | Ga0501034_0001904 | Ga0501034_0001904_17119_18543 | 473 |
| 299 | 3300049572 | Ga0501036_0053627 | Ga0501036_0053627_1424_2848 | 473 |
| 300 | 3300049573 | Ga0501037_0000948 | Ga0501037_0000948_10001_11425 | 473 |
| 301 | 3300049574 | Ga0501038_0000712 | Ga0501038_0000712_19454_20878 | 473 |
| 302 | 3300049575 | Ga0501039_0007044 | Ga0501039_0007044_5314_6738 | 473 |
| 303 | 3300049579 | Ga0501043_0005297 | Ga0501043_0005297_7878_9302 | 473 |
| 304 | 3300049580 | Ga0501046_0028083 | Ga0501046_0028083_873_2297 | 473 |
| 305 | 3300049581 | Ga0501047_0036088 | Ga0501047_0036088_2416_3840 | 473 |
| 306 | 3300049589 | Ga0501073_0001226 | Ga0501073_0001226_3396_4820 | 473 |
| 307 | 3300049742 | Ga0501080_0013444 | Ga0501080_0013444_5727_7151 | 473 |
| 308 | 3300049822 | Ga0501035_0001396 | Ga0501035_0001396_16182_17606 | 473 |
| 309 | 3300053093 | Ga0500651_0014757 | Ga0500651_0014757_1637_3061 | 473 |
| 310 | 3300005548 | Ga0070665_100022204 | Ga0070665_1000222045 | 474 |
| 311 | 3300005548 | Ga0070665_100256850 | Ga0070665_1002568501 | 474 |
| 312 | 3300049571 | Ga0501034_0051510 | Ga0501034_0051510_1715_3142 | 474 |
| 313 | 3300049574 | Ga0501038_0065003 | Ga0501038_0065003_1424_2851 | 474 |
| 314 | 3300049575 | Ga0501039_0032571 | Ga0501039_0032571_1403_2830 | 474 |
| 315 | 3300049576 | Ga0501040_0013160 | Ga0501040_0013160_1547_2974 | 474 |
| 316 | 3300049578 | Ga0501042_0037745 | Ga0501042_0037745_1216_2643 | 474 |
| 317 | 3300049580 | Ga0501046_0013710 | Ga0501046_0013710_1785_3281 | 474 |
| 318 | 3300049581 | Ga0501047_0131717 | Ga0501047_0131717_556_1983 | 474 |
| 319 | 3300049582 | Ga0501048_0026548 | Ga0501048_0026548_1877_3304 | 474 |
| 320 | 3300049583 | Ga0501067_0026748 | Ga0501067_0026748_1676_3103 | 474 |
| 321 | 3300049585 | Ga0501069_0029897 | Ga0501069_0029897_230_1657 | 474 |
| 322 | 3300049586 | Ga0501070_0056768 | Ga0501070_0056768_1165_2592 | 474 |
| 323 | 3300049587 | Ga0501071_0004988 | Ga0501071_0004988_1292_2719 | 474 |
| 324 | 3300049588 | Ga0501072_0048687 | Ga0501072_0048687_1779_3206 | 474 |
| 325 | 3300049590 | Ga0501074_0009561 | Ga0501074_0009561_4207_5634 | 474 |
| 326 | 3300049823 | Ga0501044_0078413 | Ga0501044_0078413_259_1686 | 474 |
| 327 | 3300053079 | Ga0500610_0011011 | Ga0500610_0011011_2362_3789 | 474 |
| 328 | 3300054114 | Ga0501084_0012807 | Ga0501084_0012807_3655_5082 | 474 |
| 329 | 3300060353 | Ga0501082_0018364 | Ga0501082_0018364_3475_4902 | 474 |
| 330 | 3300005367 | Ga0070667_100003453 | Ga0070667_10000345311 | 475 |
| 331 | 3300005466 | Ga0070685_10000386 | Ga0070685_100003867 | 475 |
| 332 | 3300009093 | Ga0105240_10000453 | Ga0105240_1000045315 | 475 |
| 333 | 3300009545 | Ga0105237_10065777 | Ga0105237_100657774 | 475 |
| 334 | 3300025261 | Ga0209233_1001897 | Ga0209233_10018979 | 475 |
| 335 | 3300025913 | Ga0207695_10000172 | Ga0207695_10000172152 | 475 |
| 336 | 3300048921 | Ga0496118_0006022 | Ga0496118_0006022_841_2451 | 475 |
| 337 | 3300049586 | Ga0501070_0008039 | Ga0501070_0008039_2713_4197 | 476 |
| 338 | 3300049742 | Ga0501080_0045549 | Ga0501080_0045549_492_1976 | 476 |
| 339 | iso_pu_bacteria | 2593339238 | 2595447733 | 476 |
| 340 | iso_pu_bacteria | 2818991440 | 2819566284 | 476 |
| 341 | iso_pu_bacteria | 2904463128 | 2904466560 | 476 |
| 342 | 3300005331 | Ga0070670_100017386 | Ga0070670_1000173864 | 477 |
| 343 | 3300005335 | Ga0070666_10001153 | Ga0070666_100011536 | 477 |
| 344 | 3300005337 | Ga0070682_100055174 | Ga0070682_1000551743 | 477 |
| 345 | 3300005459 | Ga0068867_100081008 | Ga0068867_1000810082 | 477 |
| 346 | 3300005548 | Ga0070665_100000242 | Ga0070665_10000024241 | 477 |
| 347 | 3300005563 | Ga0068855_100147065 | Ga0068855_1001470651 | 477 |
| 348 | 3300005842 | Ga0068858_100016875 | Ga0068858_1000168755 | 477 |
| 349 | 3300006358 | Ga0068871_100021042 | Ga0068871_1000210425 | 477 |
| 350 | 3300009093 | Ga0105240_10008373 | Ga0105240_1000837312 | 477 |
| 351 | 3300009551 | Ga0105238_10008158 | Ga0105238_100081582 | 477 |
| 352 | 3300009551 | Ga0105238_10144654 | Ga0105238_101446542 | 477 |
| 353 | 3300009553 | Ga0105249_10045606 | Ga0105249_100456062 | 477 |
| 354 | 3300025903 | Ga0207680_10002268 | Ga0207680_100022686 | 477 |
| 355 | 3300025904 | Ga0207647_10000066 | Ga0207647_1000006653 | 477 |
| 356 | 3300025913 | Ga0207695_10012023 | Ga0207695_100120236 | 477 |
| 357 | 3300025924 | Ga0207694_10000308 | Ga0207694_1000030816 | 477 |
| 358 | 3300025925 | Ga0207650_10006496 | Ga0207650_100064966 | 477 |
| 359 | 3300025961 | Ga0207712_10000589 | Ga0207712_1000058917 | 477 |
| 360 | 3300026035 | Ga0207703_10004533 | Ga0207703_100045339 | 477 |
| 361 | 3300026041 | Ga0207639_10042503 | Ga0207639_100425033 | 477 |
| 362 | 3300026067 | Ga0207678_10000577 | Ga0207678_100005773 | 477 |
| 363 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008955 | 477 |
| 364 | 3300041486 | Ga0451807_0280975 | Ga0451807_0280975_253_1689 | 477 |
| 365 | 3300005335 | Ga0070666_10000023 | Ga0070666_10000023149 | 478 |
| 366 | 3300025256 | Ga0209759_1002084 | Ga0209759_10020847 | 478 |
| 367 | 3300037466 | Ga0395898_0029476 | Ga0395898_0029476_1534_2970 | 478 |
| 368 | 3300049579 | Ga0501043_0032363 | Ga0501043_0032363_304_1740 | 478 |
| 369 | 3300002075 | JGI24738J21930_10000118 | JGI24738J21930_100001187 | 479 |
| 370 | 3300002737 | JGI25162J39368_1000360 | JGI25162J39368_100036018 | 479 |
| 371 | 3300005262 | Ga0065165_1000913 | Ga0065165_100091321 | 479 |
| 372 | 3300013306 | Ga0163162_10167465 | Ga0163162_101674652 | 479 |
| 373 | 3300017792 | Ga0163161_10022306 | Ga0163161_100223064 | 479 |
| 374 | 3300025226 | Ga0209674_100556 | Ga0209674_1005567 | 479 |
| 375 | 3300025254 | Ga0209148_1002007 | Ga0209148_10020075 | 479 |
| 376 | 3300025258 | Ga0209129_1000697 | Ga0209129_100069712 | 479 |
| 377 | 3300025304 | Ga0209257_1022237 | Ga0209257_10222372 | 479 |
| 378 | 3300046460 | Ga0495638_0000071 | Ga0495638_0000071_139196_140635 | 479 |
| 379 | 3300046513 | Ga0495616_0000128 | Ga0495616_0000128_14926_16368 | 479 |
| 380 | 3300046519 | Ga0495632_0033484 | Ga0495632_0033484_699_2141 | 479 |
| 381 | 3300001979 | JGI24740J21852_10003893 | JGI24740J21852_100038931 | 480 |
| 382 | 3300009093 | Ga0105240_10000868 | Ga0105240_1000086813 | 480 |
| 383 | 3300048924 | Ga0496121_0047767 | Ga0496121_0047767_1691_3133 | 480 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.9641 | 33 | 470 |
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.9491 | 33 | 470 |
| 1q7l-assembly1.cif.gz_A | zn-binding domain of the t347g mutant of human aminoacylase-i | 0.8282 | 264 | 334 |
| 1xbu-assembly1.cif.gz_A | streptomyces griseus aminopeptidase complexed with p-iodo-d-phenylalanine | 0.7928 | 262 | 460 |
| 1tkf-assembly1.cif.gz_A | streptomyces griseus aminopeptidase complexed with d-tryptophan | 0.7855 | 262 | 460 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iibA02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; | 0.9412 | 104 | 254 | 3.50.30.30 |
| 3iibA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9365 | 33 | 470 | 3.40.630.10 |
| 3iibA02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; | 0.9351 | 104 | 254 | 3.50.30.30 |
| af_Q9Y646_117_259_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9205 | 104 | 254 | 3.40.630.10 |
| 3iibA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9176 | 33 | 470 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3G213-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9997 | 32 | 480 |
GO:0004177
GO:0004180 GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A848QH50-F1-model_v4 | deleted | 0.9983 | 312 | 480 |
|
| AF-A0A1G3G213-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9953 | 32 | 480 |
GO:0004177
GO:0004180 GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A7V8GJV0-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9873 | 135 | 341 |
GO:0004177
GO:0004180 GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A4R6YQZ5-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9864 | 20 | 480 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar