F429495

General Info

Members Datasets Scaffolds Average Seq Length
383 234 766 306

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100036965|Ga0070680_1000369653
Length 349
Sequence MLLAEVADSAARGPMYNRSASLPAAITRPQGWGRLLAPRYWPTWAGIGVLRLLSFLPFSLQLAIGAALGGVLRRLPVRFVRIARRNIELCLPELEAPERRRLLERHFTSLGIALLEIAAAWXXSKARLKSVSRLEGVEHLRAALARGRGAILLTAHFTPLEIGGRILAADCPANIIYRPTKNEALAHVLGRCRSRNGGHAIPRDDIRAMIAALKNNECVWYAPDQSYRKKGAQMVSLFGIPAATNIATSRIARMTGCAVLPFFVERLPGTAGYRAVIQPPLENFPSQCPRADAELFHRFIEAQVRAVPDQYLWIHRRFKGLTPQDPDYYGAAVPPRISVPQPSAASPAA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 6.79
Rhizosphere 81.72
Stem 0
Stem Tuber 0
Unclassified 13.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100036965 3300005336 Bacteria 3946
2 Ga0065707_10083925 3300005295 Bacteria 7970
3 Ga0070690_100037038 3300005330 Bacteria 3071
4 Ga0070690_100063454 3300005330 Bacteria 2384
5 Ga0070670_100076212 3300005331 Unclassified 2882
6 Ga0070666_10034670 3300005335 Bacteria 3344
7 Ga0070666_10044184 3300005335 Bacteria 2984
8 Ga0070680_100029683 3300005336 Bacteria 4391
9 Ga0070680_100413017 3300005336 Bacteria 1151
10 Ga0070682_100009192 3300005337 Bacteria 5587
11 Ga0068868_100019625 3300005338 Bacteria 5066
12 Ga0070689_100013431 3300005340 Bacteria 5924
13 Ga0070689_100199318 3300005340 Bacteria 1634
14 Ga0070675_100023435 3300005354 Bacteria 4936
15 Ga0070675_100166541 3300005354 Unclassified 1898
16 Ga0070675_100188001 3300005354 Bacteria 1788
17 Ga0070671_100003426 3300005355 Bacteria 12379
18 Ga0070671_100037228 3300005355 Bacteria 4034
19 Ga0070674_100134099 3300005356 Unclassified 1850
20 Ga0070673_100039162 3300005364 Bacteria 3625
21 Ga0070688_100041270 3300005365 Bacteria 2831
22 Ga0070667_100009121 3300005367 Bacteria 8209
23 Ga0070667_100076010 3300005367 Bacteria 2867
24 Ga0070709_10005821 3300005434 Bacteria 6681
25 Ga0070714_100003114 3300005435 Bacteria 12318
26 Ga0070714_100015668 3300005435 Bacteria 6103
27 Ga0070713_100004970 3300005436 Bacteria 9028
28 Ga0070713_100006151 3300005436 Bacteria 8291
29 Ga0070713_100064871 3300005436 Bacteria 3066
30 Ga0070713_100568502 3300005436 Bacteria 1075
31 Ga0070710_10009661 3300005437 Bacteria 4724
32 Ga0070711_100004452 3300005439 Bacteria 8270
33 Ga0070711_100070127 3300005439 Bacteria 2467
34 Ga0070705_100018274 3300005440 Bacteria 3673
35 Ga0070700_100004161 3300005441 Bacteria 7542
36 Ga0070700_100110461 3300005441 Bacteria 1827
37 Ga0070694_100150864 3300005444 Bacteria 1697
38 Ga0070678_100001784 3300005456 Bacteria 11596
39 Ga0070678_100029161 3300005456 Bacteria 3776
40 Ga0070662_100054705 3300005457 Bacteria 2893
41 Ga0070681_10001209 3300005458 Bacteria 22462
42 Ga0070681_10001824 3300005458 Bacteria 19197
43 Ga0070681_10003869 3300005458 Bacteria 14089
44 Ga0070681_10005070 3300005458 Bacteria 12706
45 Ga0070681_10010132 3300005458 Bacteria 9292
46 Ga0070681_10244887 3300005458 Bacteria 1706
47 Ga0068867_100125170 3300005459 Bacteria 1991
48 Ga0068867_100135941 3300005459 Bacteria 1916
49 Ga0070679_100033576 3300005530 Bacteria 5081
50 Ga0070679_100073739 3300005530 Bacteria 3404
51 Ga0070672_100166839 3300005543 Bacteria 1829
52 Ga0070686_100048051 3300005544 Unclassified 2702
53 Ga0070686_100086925 3300005544 Bacteria 2083
54 Ga0070695_100076011 3300005545 Bacteria 2211
55 Ga0070695_100110026 3300005545 Bacteria 1868
56 Ga0070696_100018118 3300005546 Bacteria 4757
57 Ga0070693_100114586 3300005547 Bacteria 1663
58 Ga0070665_100003982 3300005548 Bacteria 15579
59 Ga0070665_100222105 3300005548 Bacteria 1889
60 Ga0070665_100268180 3300005548 Unclassified 1709
61 Ga0068855_100002406 3300005563 Bacteria 23081
62 Ga0068855_100041504 3300005563 Bacteria 5453
63 Ga0070664_100058761 3300005564 Bacteria 3271
64 Ga0068856_100013665 3300005614 Bacteria 7851
65 Ga0068856_100221825 3300005614 Bacteria 1906
66 Ga0070702_100116706 3300005615 Unclassified 1664
67 Ga0068859_100000165 3300005617 Bacteria 64110
68 Ga0068859_100115501 3300005617 Bacteria 2749
69 Ga0068866_10019267 3300005718 Bacteria 3102
70 Ga0068861_100004081 3300005719 Bacteria 9787
71 Ga0068861_100014884 3300005719 Bacteria 5466
72 Ga0068861_100014893 3300005719 Bacteria 5466
73 Ga0068861_100179654 3300005719 Bacteria 1760
74 Ga0068861_100253222 3300005719 Bacteria 1503
75 Ga0068851_10109846 3300005834 Unclassified 1471
76 Ga0068870_10003304 3300005840 Bacteria 6814
77 Ga0068863_100005295 3300005841 Bacteria 12736
78 Ga0068863_100052649 3300005841 Bacteria 3858
79 Ga0068858_100000531 3300005842 Bacteria 39942
80 Ga0068858_100013821 3300005842 Bacteria 7620
81 Ga0068860_100019574 3300005843 Bacteria 6563
82 Ga0068860_100044770 3300005843 Bacteria 4217
83 Ga0068860_100074751 3300005843 Bacteria 3223
84 Ga0068860_100114961 3300005843 Bacteria 2573
85 Ga0070717_10001281 3300006028 Bacteria 17192
86 Ga0070715_10006137 3300006163 Bacteria 4065
87 Ga0070715_10032083 3300006163 Bacteria 2137
88 Ga0070716_100000392 3300006173 Bacteria 17892
89 Ga0070712_100092509 3300006175 Bacteria 2218
90 Ga0097621_100082454 3300006237 Unclassified 2678
91 Ga0097621_100122461 3300006237 Unclassified 2207
92 Ga0097621_100172619 3300006237 Unclassified 1864
93 Ga0068871_100006862 3300006358 Bacteria 8105
94 Ga0068871_100132751 3300006358 Bacteria 2112
95 Ga0068871_100156792 3300006358 Unclassified 1944
96 Ga0068871_100302544 3300006358 Unclassified 1404
97 Ga0068865_100039316 3300006881 Bacteria 3208
98 Ga0068865_100053501 3300006881 Bacteria 2801
99 Ga0075436_100015502 3300006914 Bacteria 5218
100 Ga0097620_100000165 3300006931 Bacteria 64110
101 Ga0097620_100115506 3300006931 Bacteria 2749
102 Ga0075435_100141034 3300007076 Bacteria 2022
103 Ga0099794_10057928 3300007265 Bacteria 1877
104 Ga0099794_10123404 3300007265 Bacteria 1305
105 Ga0099795_10000339 3300007788 Bacteria 8426
106 Ga0099795_10008944 3300007788 Bacteria 2885
107 Ga0105250_10029311 3300009092 Unclassified 2215
108 Ga0105240_10003307 3300009093 Bacteria 25192
109 Ga0105240_10009387 3300009093 Bacteria 13859
110 Ga0105240_10027867 3300009093 Bacteria 7391
111 Ga0111539_10014515 3300009094 Bacteria 9836
112 Ga0111539_10827015 3300009094 Bacteria 1078
113 Ga0105245_10007021 3300009098 Bacteria 9881
114 Ga0105247_10000371 3300009101 Bacteria 38197
115 Ga0105243_10020445 3300009148 Bacteria 5019
116 Ga0105241_10143456 3300009174 Bacteria 1947
117 Ga0105242_10008138 3300009176 Bacteria 8069
118 Ga0105248_10017067 3300009177 Bacteria 7995
119 Ga0105248_10129574 3300009177 Unclassified 2846
120 Ga0105248_10241760 3300009177 Unclassified 2032
121 Ga0105237_10005549 3300009545 Bacteria 14226
122 Ga0105238_10003704 3300009551 Bacteria 15211
123 Ga0105238_10045158 3300009551 Bacteria 4451
124 Ga0099796_10000404 3300010159 Bacteria 7094
125 Ga0099796_10024552 3300010159 Bacteria 1893
126 Ga0099796_10034632 3300010159 Unclassified 1669
127 Ga0157370_10010530 3300013104 Bacteria 9738
128 Ga0157369_10124994 3300013105 Bacteria 2728
129 Ga0157374_10116708 3300013296 Bacteria 2572
130 Ga0157374_10166615 3300013296 Bacteria 2147
131 Ga0163162_10128549 3300013306 Unclassified 2641
132 Ga0163162_10223049 3300013306 Bacteria 2015
133 Ga0157372_10549522 3300013307 Bacteria 1346
134 Ga0157375_10019750 3300013308 Bacteria 6137
135 Ga0157375_10234977 3300013308 Bacteria 1992
136 Ga0163163_10051076 3300014325 Unclassified 4075
137 Ga0163163_10067767 3300014325 Bacteria 3549
138 Ga0157380_10036228 3300014326 Bacteria 3816
139 Ga0157380_10098683 3300014326 Bacteria 2427
140 Ga0157379_10008162 3300014968 Bacteria 9092
141 Ga0157379_10054773 3300014968 Bacteria 3563
142 Ga0157376_10085733 3300014969 Bacteria 2714
143 Ga0163161_10134710 3300017792 Unclassified 1866
144 Ga0213874_10002259 3300021377 Bacteria 4111
145 Ga0213874_10005084 3300021377 Bacteria 3045
146 Ga0213871_10019447 3300021441 Bacteria 1673
147 Ga0207682_10006683 3300025893 Bacteria 4634
148 Ga0207710_10032912 3300025900 Bacteria 2272
149 Ga0207680_10113409 3300025903 Unclassified 1762
150 Ga0207685_10018549 3300025905 Bacteria 2274
151 Ga0207685_10115415 3300025905 Bacteria 1170
152 Ga0207699_10023421 3300025906 Bacteria 3360
153 Ga0207643_10004621 3300025908 Bacteria 7396
154 Ga0207707_10000130 3300025912 Bacteria 77776
155 Ga0207707_10003612 3300025912 Bacteria 13713
156 Ga0207707_10005194 3300025912 Bacteria 11414
157 Ga0207707_10040906 3300025912 Bacteria 4048
158 Ga0207707_10046791 3300025912 Bacteria 3768
159 Ga0207695_10001173 3300025913 Bacteria 45173
160 Ga0207695_10005919 3300025913 Bacteria 16027
161 Ga0207695_10031464 3300025913 Bacteria 5819
162 Ga0207693_10000007 3300025915 Bacteria 173735
163 Ga0207693_10087645 3300025915 Bacteria 2439
164 Ga0207693_10157886 3300025915 Bacteria 1784
165 Ga0207663_10067846 3300025916 Bacteria 2289
166 Ga0207663_10275187 3300025916 Bacteria 1248
167 Ga0207660_10027434 3300025917 Bacteria 3886
168 Ga0207652_10002145 3300025921 Bacteria 16918
169 Ga0207652_10026511 3300025921 Bacteria 4828
170 Ga0207652_10052016 3300025921 Bacteria 3514
171 Ga0207652_10070049 3300025921 Bacteria 3045
172 Ga0207652_10236781 3300025921 Bacteria 1645
173 Ga0207681_10066651 3300025923 Unclassified 2493
174 Ga0207659_10166098 3300025926 Bacteria 1737
175 Ga0207700_10089633 3300025928 Bacteria 2425
176 Ga0207664_10003230 3300025929 Bacteria 10832
177 Ga0207664_10270608 3300025929 Bacteria 1488
178 Ga0207644_10002022 3300025931 Bacteria 13105
179 Ga0207644_10044584 3300025931 Bacteria 3151
180 Ga0207644_10310165 3300025931 Bacteria 1274
181 Ga0207669_10144972 3300025937 Bacteria 1654
182 Ga0207704_10027596 3300025938 Bacteria 3136
183 Ga0207704_10041507 3300025938 Bacteria 2699
184 Ga0207665_10002836 3300025939 Bacteria 11630
185 Ga0207691_10003322 3300025940 Bacteria 15662
186 Ga0207691_10005210 3300025940 Bacteria 12554
187 Ga0207691_10047934 3300025940 Bacteria 3918
188 Ga0207711_10083476 3300025941 Bacteria 2794
189 Ga0207711_10126615 3300025941 Unclassified 2286
190 Ga0207689_10071643 3300025942 Unclassified 2847
191 Ga0207689_10093002 3300025942 Bacteria 2477
192 Ga0207679_10097085 3300025945 Bacteria 2294
193 Ga0207667_10000637 3300025949 Bacteria 45399
194 Ga0207667_10061118 3300025949 Bacteria 3942
195 Ga0207651_10036690 3300025960 Unclassified 3203
196 Ga0207658_10008475 3300025986 Bacteria 6995
197 Ga0207677_10016386 3300026023 Bacteria 4389
198 Ga0207703_10001061 3300026035 Bacteria 26216
199 Ga0207708_10008756 3300026075 Bacteria 7487
200 Ga0207708_10018104 3300026075 Bacteria 5301
201 Ga0207702_10011921 3300026078 Bacteria 7233
202 Ga0207702_10038589 3300026078 Bacteria 4000
203 Ga0207641_10163149 3300026088 Unclassified 2027
204 Ga0207648_10097024 3300026089 Bacteria 2580
205 Ga0207648_10142262 3300026089 Unclassified 2115
206 Ga0207648_10161392 3300026089 Bacteria 1980
207 Ga0207675_100004737 3300026118 Bacteria 13097
208 Ga0207675_100029958 3300026118 Bacteria 5066
209 Ga0207675_100069228 3300026118 Bacteria 3298
210 Ga0207675_100082967 3300026118 Bacteria 3006
211 Ga0207683_10005241 3300026121 Bacteria 11131
212 Ga0207683_10035607 3300026121 Bacteria 4330
213 Ga0209179_1001322 3300027512 Unclassified 2995
214 Ga0207428_10144842 3300027907 Bacteria 1811
215 Ga0268266_10224369 3300028379 Bacteria 1728
216 Ga0268266_10262569 3300028379 Bacteria 1601
217 Ga0268265_10079041 3300028380 Bacteria 2589
218 Ga0268264_10020591 3300028381 Bacteria 5388
219 Ga0268264_10093003 3300028381 Bacteria 2604
220 Ga0268264_10529338 3300028381 Bacteria 1153
221 Ga0307511_10001312 3300030521 Bacteria 26412
222 Ga0307511_10032673 3300030521 Bacteria 4617
223 Ga0265760_10001100 3300031090 Bacteria 7861
224 Ga0265760_10066811 3300031090 Bacteria 1099
225 Ga0265328_10024126 3300031239 Bacteria 2300
226 Ga0265340_10007235 3300031247 Bacteria 6039
227 Ga0265340_10019024 3300031247 Unclassified 3538
228 Ga0265339_10089587 3300031249 Bacteria 1615
229 Ga0265339_10102160 3300031249 Bacteria 1491
230 Ga0265316_10052158 3300031344 Bacteria 3209
231 Ga0307513_10052433 3300031456 Bacteria 4393
232 Ga0307513_10054098 3300031456 Bacteria 4307
233 Ga0307513_10102448 3300031456 Bacteria 2881
234 Ga0307513_10318846 3300031456 Bacteria 1313
235 Ga0307509_10000025 3300031507 Bacteria 235550
236 Ga0307509_10000554 3300031507 Bacteria 63868
237 Ga0307509_10006926 3300031507 Bacteria 15040
238 Ga0307408_100040001 3300031548 Bacteria 3318
239 Ga0307508_10170473 3300031616 Bacteria 1780
240 Ga0307516_10000090 3300031730 Bacteria 101690
241 Ga0307516_10000949 3300031730 Bacteria 39979
242 Ga0307413_10001802 3300031824 Bacteria 8404
243 Ga0307413_10004620 3300031824 Bacteria 6019
244 Ga0307410_10113339 3300031852 Unclassified 1965
245 Ga0307406_10020856 3300031901 Bacteria 3867
246 Ga0307406_10182862 3300031901 Bacteria 1528
247 Ga0307407_10026400 3300031903 Bacteria 3074
248 Ga0307412_10151650 3300031911 Bacteria 1711
249 Ga0307409_100004649 3300031995 Bacteria 7757
250 Ga0307409_100031896 3300031995 Bacteria 3811
251 Ga0307409_100042631 3300031995 Bacteria 3400
252 Ga0307416_100211982 3300032002 Unclassified 1849
253 Ga0307411_10005246 3300032005 Bacteria 6341
254 Ga0307411_10007777 3300032005 Bacteria 5496
255 Ga0307411_10042816 3300032005 Unclassified 2893
256 Ga0307415_100021647 3300032126 Bacteria 3957
257 Ga0307415_100192033 3300032126 Bacteria 1612
258 Ga0307510_10000002 3300033180 Bacteria 801565
259 Ga0307510_10128490 3300033180 Unclassified 2215
260 Ga0373934_0071099 3300035086 Bacteria 1392
261 Ga0373954_0074126 3300035118 Bacteria 1620
262 Ga0373954_0123147 3300035118 Bacteria 1260
263 Ga0373956_0027884 3300035119 Bacteria 2455
264 Ga0373955_0061835 3300035172 Bacteria 2069
265 Ga0373955_0115320 3300035172 Bacteria 1557
266 Ga0373955_0255148 3300035172 Bacteria 1052
267 Ga0373924_0042196 3300035410 Bacteria 1871
268 Ga0373935_0270008 3300035692 Bacteria 1195
269 Ga0373933_0004716 3300035724 Bacteria 7458
270 Ga0373933_0089001 3300035724 Bacteria 1903
271 Ga0373947_0057708 3300035725 Bacteria 2350
272 Ga0373937_0046599 3300036401 Bacteria 3965
273 Ga0373937_0063604 3300036401 Bacteria 3394
274 Ga0373937_0088849 3300036401 Bacteria 2861
275 Ga0373925_0060027 3300037068 Bacteria 2855
276 Ga0395898_0006746 3300037466 Bacteria 12232
277 Ga0436365_0484696 3300039437 Bacteria 3647
278 Ga0436360_0334744 3300039438 Bacteria 7543
279 Ga0436360_0574893 3300039438 Bacteria 1730
280 Ga0436363_0238315 3300039450 Bacteria 9197
281 Ga0436363_1607857 3300039450 Bacteria 11006
282 Ga0436362_0047155 3300039453 Bacteria 1150
283 Ga0451787_141385 3300041441 Unclassified 1606
284 Ga0451787_221000 3300041441 Unclassified 1178
285 Ga0451791_0239565 3300041451 Bacteria 2866
286 Ga0451793_0014858 3300041452 Unclassified 1427
287 Ga0451797_0352115 3300041453 Bacteria 1199
288 Ga0451802_2122939 3300041460 Bacteria 1716
289 Ga0451807_0774848 3300041486 Bacteria 4306
290 Ga0451807_1848174 3300041486 Unclassified 1176
291 Ga0451837_1300497 3300041494 Bacteria 3088
292 Ga0451853_3096096 3300041512 Unclassified 1140
293 Ga0466969_0006427 3300044656 Bacteria 6256
294 Ga0466969_0119310 3300044656 Bacteria 1229
295 Ga0466966_0010066 3300044684 Bacteria 6270
296 Ga0466966_0087033 3300044684 Bacteria 1942
297 Ga0466961_0009762 3300044693 Bacteria 6109
298 Ga0466971_0003774 3300044719 Bacteria 6485
299 Ga0466957_0056032 3300044842 Bacteria 2410
300 Ga0466959_0008148 3300045049 Bacteria 7390
301 Ga0495590_0001570 3300046457 Bacteria 9782
302 Ga0495638_0034950 3300046460 Unclassified 3205
303 Ga0495638_0050890 3300046460 Bacteria 2586
304 Ga0495580_0006626 3300046472 Bacteria 9408
305 Ga0495580_0175907 3300046472 Bacteria 1478
306 Ga0495580_0190274 3300046472 Bacteria 1415
307 Ga0495639_0095075 3300046475 Bacteria 1402
308 Ga0495606_0074407 3300046507 Bacteria 2128
309 Ga0495616_0000669 3300046513 Bacteria 25410
310 Ga0495628_0138908 3300046516 Bacteria 1855
311 Ga0495611_0093348 3300046648 Bacteria 1392
312 Ga0495625_0031634 3300046660 Bacteria 3933
313 Ga0495625_0055575 3300046660 Unclassified 2823
314 Ga0495625_0069187 3300046660 Unclassified 2480
315 Ga0495657_0086248 3300046675 Bacteria 2023
316 Ga0495623_0169345 3300046679 Bacteria 1277
317 Ga0495647_0040303 3300046681 Bacteria 1774
318 Ga0495649_0002216 3300046694 Bacteria 13861
319 Ga0495589_0028248 3300046794 Unclassified 2832
320 Ga0495604_0092841 3300047317 Bacteria 2235
321 Ga0495604_0179871 3300047317 Bacteria 1480
322 Ga0495675_0103435 3300047444 Bacteria 1781
323 Ga0495686_0110721 3300047472 Unclassified 1647
324 Ga0496100_0072386 3300048903 Bacteria 2304
325 Ga0496101_0054909 3300048904 Bacteria 2875
326 Ga0496102_0006595 3300048905 Bacteria 9916
327 Ga0496102_0022304 3300048905 Bacteria 5610
328 Ga0496102_0195933 3300048905 Bacteria 1904
329 Ga0496102_0453458 3300048905 Unclassified 1203
330 Ga0496103_0198481 3300048906 Unclassified 1290
331 Ga0496104_0193166 3300048907 Bacteria 1948
332 Ga0496104_0200227 3300048907 Bacteria 1909
333 Ga0496105_0096948 3300048908 Bacteria 2435
334 Ga0496107_0010888 3300048910 Bacteria 6328
335 Ga0496107_0248944 3300048910 Unclassified 1322
336 Ga0496108_0026595 3300048911 Bacteria 4773
337 Ga0496112_0013419 3300048915 Bacteria 7562
338 Ga0496112_0157142 3300048915 Unclassified 2241
339 Ga0496114_0018411 3300048917 Bacteria 5646
340 Ga0496115_0047114 3300048918 Bacteria 3446
341 Ga0496115_0131783 3300048918 Bacteria 2060
342 Ga0496116_0033574 3300048919 Unclassified 3640
343 Ga0496117_0000054 3300048920 Bacteria 278013
344 Ga0496118_0000045 3300048921 Bacteria 275165
345 Ga0496118_0012947 3300048921 Bacteria 7942
346 Ga0496119_0000297 3300048922 Bacteria 69722
347 Ga0496119_0010682 3300048922 Bacteria 7694
348 Ga0496120_0000379 3300048923 Bacteria 71960
349 Ga0496120_0005174 3300048923 Bacteria 10534
350 Ga0496121_0001619 3300048924 Bacteria 37313
351 Ga0496121_0016580 3300048924 Bacteria 7595
352 Ga0496121_0184047 3300048924 Unclassified 1504
353 Ga0496125_0003830 3300048928 Bacteria 17855
354 Ga0496126_0510604 3300048929 Unclassified 959
355 Ga0501042_0055308 3300049578 Bacteria 2832
356 Ga0501042_0213999 3300049578 Bacteria 1390
357 Ga0501067_0202810 3300049583 Unclassified 1104
358 Ga0501068_0000141 3300049584 Bacteria 33019
359 Ga0501068_0191557 3300049584 Bacteria 1295
360 Ga0501070_0005553 3300049586 Bacteria 10754
361 Ga0501071_0022636 3300049587 Bacteria 4382
362 Ga0501073_0001384 3300049589 Bacteria 17881
363 Ga0501074_0000994 3300049590 Bacteria 18432
364 Ga0501076_0020779 3300049592 Bacteria 5027
365 Ga0501077_0009441 3300049593 Bacteria 6062
366 Ga0501079_0000033 3300049741 Bacteria 59060
367 Ga0501080_0001783 3300049742 Bacteria 18446
368 Ga0501083_0242353 3300049744 Bacteria 1174
369 nmdc:mga0qj67_354446_c1 3300050509 Bacteria 1186
370 nmdc:mga0rr50_16915_c1 3300050513 Bacteria 4856
371 nmdc:mga08x19_26392_c1 3300050514 Bacteria 3624
372 Ga0500583_0003650 3300053092 Bacteria 4887
373 Ga0500641_0123678 3300053096 Bacteria 1115
374 Ga0500617_090779 3300053124 Unclassified 1307
375 Ga0500642_0041472 3300053130 Unclassified 1991
376 Ga0500604_0043960 3300053151 Bacteria 1359
377 Ga0500616_0000018 3300053153 Bacteria 610976
378 Ga0500622_0003268 3300053156 Bacteria 10991
379 Ga0500637_0012114 3300053178 Bacteria 4486
380 Ga0500637_0129621 3300053178 Bacteria 1462
381 Ga0500656_004616 3300053732 Bacteria 1335
382 Ga0501084_0015581 3300054114 Bacteria 6305
383 Ga0466962_0007442 3300061719 Bacteria 5255
384 Ga0070680_100036965
385 Ga0065707_10083925
386 Ga0070690_100037038
387 Ga0070690_100063454
388 Ga0070670_100076212
389 Ga0070666_10034670
390 Ga0070666_10044184
391 Ga0070680_100029683
392 Ga0070680_100413017
393 Ga0070682_100009192
394 Ga0068868_100019625
395 Ga0070689_100013431
396 Ga0070689_100199318
397 Ga0070675_100023435
398 Ga0070675_100166541
399 Ga0070675_100188001
400 Ga0070671_100003426
401 Ga0070671_100037228
402 Ga0070674_100134099
403 Ga0070673_100039162
404 Ga0070688_100041270
405 Ga0070667_100009121
406 Ga0070667_100076010
407 Ga0070709_10005821
408 Ga0070714_100003114
409 Ga0070714_100015668
410 Ga0070713_100004970
411 Ga0070713_100006151
412 Ga0070713_100064871
413 Ga0070713_100568502
414 Ga0070710_10009661
415 Ga0070711_100004452
416 Ga0070711_100070127
417 Ga0070705_100018274
418 Ga0070700_100004161
419 Ga0070700_100110461
420 Ga0070694_100150864
421 Ga0070678_100001784
422 Ga0070678_100029161
423 Ga0070662_100054705
424 Ga0070681_10001209
425 Ga0070681_10001824
426 Ga0070681_10003869
427 Ga0070681_10005070
428 Ga0070681_10010132
429 Ga0070681_10244887
430 Ga0068867_100125170
431 Ga0068867_100135941
432 Ga0070679_100033576
433 Ga0070679_100073739
434 Ga0070672_100166839
435 Ga0070686_100048051
436 Ga0070686_100086925
437 Ga0070695_100076011
438 Ga0070695_100110026
439 Ga0070696_100018118
440 Ga0070693_100114586
441 Ga0070665_100003982
442 Ga0070665_100222105
443 Ga0070665_100268180
444 Ga0068855_100002406
445 Ga0068855_100041504
446 Ga0070664_100058761
447 Ga0068856_100013665
448 Ga0068856_100221825
449 Ga0070702_100116706
450 Ga0068859_100000165
451 Ga0068859_100115501
452 Ga0068866_10019267
453 Ga0068861_100004081
454 Ga0068861_100014884
455 Ga0068861_100014893
456 Ga0068861_100179654
457 Ga0068861_100253222
458 Ga0068851_10109846
459 Ga0068870_10003304
460 Ga0068863_100005295
461 Ga0068863_100052649
462 Ga0068858_100000531
463 Ga0068858_100013821
464 Ga0068860_100019574
465 Ga0068860_100044770
466 Ga0068860_100074751
467 Ga0068860_100114961
468 Ga0070717_10001281
469 Ga0070715_10006137
470 Ga0070715_10032083
471 Ga0070716_100000392
472 Ga0070712_100092509
473 Ga0097621_100082454
474 Ga0097621_100122461
475 Ga0097621_100172619
476 Ga0068871_100006862
477 Ga0068871_100132751
478 Ga0068871_100156792
479 Ga0068871_100302544
480 Ga0068865_100039316
481 Ga0068865_100053501
482 Ga0075436_100015502
483 Ga0097620_100000165
484 Ga0097620_100115506
485 Ga0075435_100141034
486 Ga0099794_10057928
487 Ga0099794_10123404
488 Ga0099795_10000339
489 Ga0099795_10008944
490 Ga0105250_10029311
491 Ga0105240_10003307
492 Ga0105240_10009387
493 Ga0105240_10027867
494 Ga0111539_10014515
495 Ga0111539_10827015
496 Ga0105245_10007021
497 Ga0105247_10000371
498 Ga0105243_10020445
499 Ga0105241_10143456
500 Ga0105242_10008138
501 Ga0105248_10017067
502 Ga0105248_10129574
503 Ga0105248_10241760
504 Ga0105237_10005549
505 Ga0105238_10003704
506 Ga0105238_10045158
507 Ga0099796_10000404
508 Ga0099796_10024552
509 Ga0099796_10034632
510 Ga0157370_10010530
511 Ga0157369_10124994
512 Ga0157374_10116708
513 Ga0157374_10166615
514 Ga0163162_10128549
515 Ga0163162_10223049
516 Ga0157372_10549522
517 Ga0157375_10019750
518 Ga0157375_10234977
519 Ga0163163_10051076
520 Ga0163163_10067767
521 Ga0157380_10036228
522 Ga0157380_10098683
523 Ga0157379_10008162
524 Ga0157379_10054773
525 Ga0157376_10085733
526 Ga0163161_10134710
527 Ga0213874_10002259
528 Ga0213874_10005084
529 Ga0213871_10019447
530 Ga0207682_10006683
531 Ga0207710_10032912
532 Ga0207680_10113409
533 Ga0207685_10018549
534 Ga0207685_10115415
535 Ga0207699_10023421
536 Ga0207643_10004621
537 Ga0207707_10000130
538 Ga0207707_10003612
539 Ga0207707_10005194
540 Ga0207707_10040906
541 Ga0207707_10046791
542 Ga0207695_10001173
543 Ga0207695_10005919
544 Ga0207695_10031464
545 Ga0207693_10000007
546 Ga0207693_10087645
547 Ga0207693_10157886
548 Ga0207663_10067846
549 Ga0207663_10275187
550 Ga0207660_10027434
551 Ga0207652_10002145
552 Ga0207652_10026511
553 Ga0207652_10052016
554 Ga0207652_10070049
555 Ga0207652_10236781
556 Ga0207681_10066651
557 Ga0207659_10166098
558 Ga0207700_10089633
559 Ga0207664_10003230
560 Ga0207664_10270608
561 Ga0207644_10002022
562 Ga0207644_10044584
563 Ga0207644_10310165
564 Ga0207669_10144972
565 Ga0207704_10027596
566 Ga0207704_10041507
567 Ga0207665_10002836
568 Ga0207691_10003322
569 Ga0207691_10005210
570 Ga0207691_10047934
571 Ga0207711_10083476
572 Ga0207711_10126615
573 Ga0207689_10071643
574 Ga0207689_10093002
575 Ga0207679_10097085
576 Ga0207667_10000637
577 Ga0207667_10061118
578 Ga0207651_10036690
579 Ga0207658_10008475
580 Ga0207677_10016386
581 Ga0207703_10001061
582 Ga0207708_10008756
583 Ga0207708_10018104
584 Ga0207702_10011921
585 Ga0207702_10038589
586 Ga0207641_10163149
587 Ga0207648_10097024
588 Ga0207648_10142262
589 Ga0207648_10161392
590 Ga0207675_100004737
591 Ga0207675_100029958
592 Ga0207675_100069228
593 Ga0207675_100082967
594 Ga0207683_10005241
595 Ga0207683_10035607
596 Ga0209179_1001322
597 Ga0207428_10144842
598 Ga0268266_10224369
599 Ga0268266_10262569
600 Ga0268265_10079041
601 Ga0268264_10020591
602 Ga0268264_10093003
603 Ga0268264_10529338
604 Ga0307511_10001312
605 Ga0307511_10032673
606 Ga0265760_10001100
607 Ga0265760_10066811
608 Ga0265328_10024126
609 Ga0265340_10007235
610 Ga0265340_10019024
611 Ga0265339_10089587
612 Ga0265339_10102160
613 Ga0265316_10052158
614 Ga0307513_10052433
615 Ga0307513_10054098
616 Ga0307513_10102448
617 Ga0307513_10318846
618 Ga0307509_10000025
619 Ga0307509_10000554
620 Ga0307509_10006926
621 Ga0307408_100040001
622 Ga0307508_10170473
623 Ga0307516_10000090
624 Ga0307516_10000949
625 Ga0307413_10001802
626 Ga0307413_10004620
627 Ga0307410_10113339
628 Ga0307406_10020856
629 Ga0307406_10182862
630 Ga0307407_10026400
631 Ga0307412_10151650
632 Ga0307409_100004649
633 Ga0307409_100031896
634 Ga0307409_100042631
635 Ga0307416_100211982
636 Ga0307411_10005246
637 Ga0307411_10007777
638 Ga0307411_10042816
639 Ga0307415_100021647
640 Ga0307415_100192033
641 Ga0307510_10000002
642 Ga0307510_10128490
643 Ga0373934_0071099
644 Ga0373954_0074126
645 Ga0373954_0123147
646 Ga0373956_0027884
647 Ga0373955_0061835
648 Ga0373955_0115320
649 Ga0373955_0255148
650 Ga0373924_0042196
651 Ga0373935_0270008
652 Ga0373933_0004716
653 Ga0373933_0089001
654 Ga0373947_0057708
655 Ga0373937_0046599
656 Ga0373937_0063604
657 Ga0373937_0088849
658 Ga0373925_0060027
659 Ga0395898_0006746
660 Ga0436365_0484696
661 Ga0436360_0334744
662 Ga0436360_0574893
663 Ga0436363_0238315
664 Ga0436363_1607857
665 Ga0436362_0047155
666 Ga0451787_141385
667 Ga0451787_221000
668 Ga0451791_0239565
669 Ga0451793_0014858
670 Ga0451797_0352115
671 Ga0451802_2122939
672 Ga0451807_0774848
673 Ga0451807_1848174
674 Ga0451837_1300497
675 Ga0451853_3096096
676 Ga0466969_0006427
677 Ga0466969_0119310
678 Ga0466966_0010066
679 Ga0466966_0087033
680 Ga0466961_0009762
681 Ga0466971_0003774
682 Ga0466957_0056032
683 Ga0466959_0008148
684 Ga0495590_0001570
685 Ga0495638_0034950
686 Ga0495638_0050890
687 Ga0495580_0006626
688 Ga0495580_0175907
689 Ga0495580_0190274
690 Ga0495639_0095075
691 Ga0495606_0074407
692 Ga0495616_0000669
693 Ga0495628_0138908
694 Ga0495611_0093348
695 Ga0495625_0031634
696 Ga0495625_0055575
697 Ga0495625_0069187
698 Ga0495657_0086248
699 Ga0495623_0169345
700 Ga0495647_0040303
701 Ga0495649_0002216
702 Ga0495589_0028248
703 Ga0495604_0092841
704 Ga0495604_0179871
705 Ga0495675_0103435
706 Ga0495686_0110721
707 Ga0496100_0072386
708 Ga0496101_0054909
709 Ga0496102_0006595
710 Ga0496102_0022304
711 Ga0496102_0195933
712 Ga0496102_0453458
713 Ga0496103_0198481
714 Ga0496104_0193166
715 Ga0496104_0200227
716 Ga0496105_0096948
717 Ga0496107_0010888
718 Ga0496107_0248944
719 Ga0496108_0026595
720 Ga0496112_0013419
721 Ga0496112_0157142
722 Ga0496114_0018411
723 Ga0496115_0047114
724 Ga0496115_0131783
725 Ga0496116_0033574
726 Ga0496117_0000054
727 Ga0496118_0000045
728 Ga0496118_0012947
729 Ga0496119_0000297
730 Ga0496119_0010682
731 Ga0496120_0000379
732 Ga0496120_0005174
733 Ga0496121_0001619
734 Ga0496121_0016580
735 Ga0496121_0184047
736 Ga0496125_0003830
737 Ga0496126_0510604
738 Ga0501042_0055308
739 Ga0501042_0213999
740 Ga0501067_0202810
741 Ga0501068_0000141
742 Ga0501068_0191557
743 Ga0501070_0005553
744 Ga0501071_0022636
745 Ga0501073_0001384
746 Ga0501074_0000994
747 Ga0501076_0020779
748 Ga0501077_0009441
749 Ga0501079_0000033
750 Ga0501080_0001783
751 Ga0501083_0242353
752 nmdc:mga0qj67_354446_c1
753 nmdc:mga0rr50_16915_c1
754 nmdc:mga08x19_26392_c1
755 Ga0500583_0003650
756 Ga0500641_0123678
757 Ga0500617_090779
758 Ga0500642_0041472
759 Ga0500604_0043960
760 Ga0500616_0000018
761 Ga0500622_0003268
762 Ga0500637_0012114
763 Ga0500637_0129621
764 Ga0500656_004616
765 Ga0501084_0015581
766 Ga0466962_0007442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

28

320

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8885 51 288
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8362 51 288
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.8186 18 288
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.8143 20 288
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7354 18 288
ID Description Score Start End Superfamily
af_Q552L6_15_227_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6271 46 88 3.40.630.30
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5986 113 231 3.40.1010.10
af_Q54EU4_95_228_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5957 118 231 3.40.50.620
af_I1N8X6_1177_1427_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5696 110 192 3.40.50.300
af_A0A1D6PA70_1207_1366_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5636 110 192 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N6CGC6-F1-model_v4 Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) 0.9743 4 301 GO:0005886
GO:0008913
GO:0009103
GO:0009245
GO:0036104
AF-A0A1H7H3B3-F1-model_v4 Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) 0.9734 14 301 GO:0005886
GO:0008913
GO:0009103
GO:0009245
GO:0036104
AF-A0A800CBX8-F1-model_v4 Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) 0.9732 5 302 GO:0005886
GO:0009103
GO:0009245
GO:0016746
GO:0036104
AF-A0A7C3CRR7-F1-model_v4 Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) 0.973 1 300 GO:0005886
GO:0008913
GO:0009103
GO:0009245
GO:0036104
AF-A0A1Z8RIE4-F1-model_v4 Kdo(2)-lipid IV(A) lauroyltransferase 0.9727 5 296 GO:0005886
GO:0009103
GO:0009245
GO:0016746

Map