F429434

General Info

Members Datasets Scaffolds Average Seq Length
382 170 764 265

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_470611_c1|nmdc:mga05p37_470611_c1_178_1119
Length 313
Sequence MSFRSRSTPYLKVGPGNRSSGATDAGRRHPGSAHLAQTFIDRSGQVMETSGMLRADRVSFGYVDFELRDVSVDIPRGSFTGLLGPNGCGKTTLLRLMSGVLHPRDGDVRLEGEPIGRIARRPLARRIAVVPQETHPAFDYTVMEMVLMGRHPHLGPFALEGPADLAIAHNALAATGTAHLADRAYMTLSGGEKQRVIIASALTQSPELLLLDEPTASLDLGYQLEIATLLGTLNRDRGVTLVLATHDLNLAASLCSDLVLLREGRVLAQGPTSEVLTASMVRRLYGVEADVRFHAGAGHLTVIPVRRAEGDGR

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_470611_c1 3300050507 Bacteria 1450
2 JGI25406J46586_10000120 3300003203 Bacteria 34396
3 JGI25406J46586_10002349 3300003203 Bacteria 8944
4 Ga0065707_10002879 3300005295 Bacteria 9391
5 Ga0065707_10153849 3300005295 Bacteria 1629
6 Ga0070676_10162093 3300005328 Bacteria 1440
7 Ga0070690_100072122 3300005330 Bacteria 2245
8 Ga0070690_100190475 3300005330 Bacteria 1422
9 Ga0070670_100241391 3300005331 Bacteria 1573
10 Ga0070670_100613693 3300005331 Bacteria 974
11 Ga0068869_100079710 3300005334 Bacteria 2441
12 Ga0070666_10018272 3300005335 Bacteria 4505
13 Ga0070689_100060395 3300005340 Bacteria 2947
14 Ga0070689_100098735 3300005340 Bacteria 2310
15 Ga0070689_100124201 3300005340 Bacteria 2064
16 Ga0070687_100002090 3300005343 Bacteria 7356
17 Ga0070687_100181622 3300005343 Bacteria 1261
18 Ga0070661_100145959 3300005344 Bacteria 1786
19 Ga0070692_10017106 3300005345 Bacteria 3461
20 Ga0070692_10101661 3300005345 Bacteria 1577
21 Ga0070692_10238881 3300005345 Bacteria 1082
22 Ga0070692_10417024 3300005345 Bacteria 851
23 Ga0070669_100009871 3300005353 Bacteria 6800
24 Ga0070669_100122813 3300005353 Bacteria 1984
25 Ga0070669_100277823 3300005353 Bacteria 1341
26 Ga0070669_100617155 3300005353 Bacteria 910
27 Ga0070675_100000785 3300005354 Bacteria 22225
28 Ga0070675_100002595 3300005354 Bacteria 13547
29 Ga0070675_100006317 3300005354 Bacteria 9097
30 Ga0070675_100024453 3300005354 Bacteria 4837
31 Ga0070675_100039445 3300005354 Bacteria 3854
32 Ga0070675_100237923 3300005354 Bacteria 1590
33 Ga0070675_100258745 3300005354 Bacteria 1525
34 Ga0070675_100394336 3300005354 Bacteria 1234
35 Ga0070671_100002655 3300005355 Bacteria 13847
36 Ga0070674_100022120 3300005356 Bacteria 4097
37 Ga0070673_100014378 3300005364 Bacteria 5509
38 Ga0070673_100082847 3300005364 Bacteria 2604
39 Ga0070673_100511572 3300005364 Bacteria 1087
40 Ga0070688_100019442 3300005365 Bacteria 3935
41 Ga0070688_100036161 3300005365 Bacteria 3002
42 Ga0070688_100106538 3300005365 Bacteria 1857
43 Ga0070688_100139002 3300005365 Bacteria 1648
44 Ga0070659_100136512 3300005366 Bacteria 1995
45 Ga0070713_100110409 3300005436 Bacteria 2397
46 Ga0070701_10015293 3300005438 Bacteria 3540
47 Ga0070701_10047649 3300005438 Bacteria 2208
48 Ga0070705_100001204 3300005440 Bacteria 14089
49 Ga0070705_100027814 3300005440 Bacteria 3090
50 Ga0070705_100044787 3300005440 Bacteria 2543
51 Ga0070700_100009052 3300005441 Bacteria 5455
52 Ga0070700_100146899 3300005441 Bacteria 1608
53 Ga0070694_100000199 3300005444 Bacteria 31924
54 Ga0070694_100001846 3300005444 Bacteria 12549
55 Ga0070663_100014487 3300005455 Bacteria 5063
56 Ga0070678_100289698 3300005456 Bacteria 1387
57 Ga0070678_100510286 3300005456 Bacteria 1062
58 Ga0070662_100392986 3300005457 Bacteria 1143
59 Ga0068867_100001191 3300005459 Bacteria 17832
60 Ga0070685_10122953 3300005466 Bacteria 1614
61 Ga0070706_100512670 3300005467 Bacteria 1115
62 Ga0070707_100025906 3300005468 Bacteria 5567
63 Ga0070707_100302932 3300005468 Bacteria 1553
64 Ga0070707_100663067 3300005468 Bacteria 1006
65 Ga0070698_100003898 3300005471 Bacteria 16406
66 Ga0070698_100004315 3300005471 Bacteria 15640
67 Ga0070699_100000172 3300005518 Bacteria 62043
68 Ga0070699_100016152 3300005518 Bacteria 6408
69 Ga0070699_100024068 3300005518 Bacteria 5248
70 Ga0070699_100025019 3300005518 Bacteria 5147
71 Ga0070699_100053834 3300005518 Bacteria 3483
72 Ga0070699_100147621 3300005518 Bacteria 2078
73 Ga0070679_100055350 3300005530 Unclassified 3950
74 Ga0070697_100024999 3300005536 Bacteria 4760
75 Ga0070672_100047558 3300005543 Bacteria 3329
76 Ga0070672_100096123 3300005543 Bacteria 2396
77 Ga0070672_100315822 3300005543 Bacteria 1327
78 Ga0070672_100446195 3300005543 Bacteria 1114
79 Ga0070686_100053925 3300005544 Bacteria 2570
80 Ga0070686_100066813 3300005544 Bacteria 2340
81 Ga0070695_100000002 3300005545 Bacteria 128335
82 Ga0070696_100000175 3300005546 Bacteria 36851
83 Ga0070696_100008650 3300005546 Bacteria 6810
84 Ga0070696_100016814 3300005546 Bacteria 4934
85 Ga0070665_100491743 3300005548 Bacteria 1238
86 Ga0070704_100000468 3300005549 Bacteria 19028
87 Ga0070704_100021150 3300005549 Bacteria 4212
88 Ga0070664_100072550 3300005564 Bacteria 2953
89 Ga0070664_100199849 3300005564 Bacteria 1784
90 Ga0068857_100054695 3300005577 Bacteria 3542
91 Ga0068857_100342176 3300005577 Bacteria 1384
92 Ga0070702_100065063 3300005615 Bacteria 2135
93 Ga0068859_100001189 3300005617 Bacteria 26592
94 Ga0068859_100006376 3300005617 Bacteria 11966
95 Ga0068859_100077305 3300005617 Bacteria 3369
96 Ga0068859_100281926 3300005617 Bacteria 1754
97 Ga0068864_100013421 3300005618 Bacteria 6791
98 Ga0068864_100034576 3300005618 Bacteria 4299
99 Ga0068864_100327929 3300005618 Bacteria 1439
100 Ga0068864_100331481 3300005618 Bacteria 1432
101 Ga0068861_100003348 3300005719 Bacteria 10619
102 Ga0068861_100125777 3300005719 Bacteria 2074
103 Ga0068851_10067629 3300005834 Bacteria 1843
104 Ga0068863_100037246 3300005841 Bacteria 4631
105 Ga0068863_100260631 3300005841 Bacteria 1676
106 Ga0068858_100026257 3300005842 Bacteria 5414
107 Ga0068860_100011339 3300005843 Bacteria 8783
108 Ga0068860_100099250 3300005843 Bacteria 2777
109 Ga0068860_100821828 3300005843 Bacteria 943
110 Ga0068862_100001812 3300005844 Bacteria 19342
111 Ga0068862_100583398 3300005844 Bacteria 1071
112 Ga0081539_10000024 3300005985 Bacteria 354702
113 Ga0081539_10000096 3300005985 Bacteria 204059
114 Ga0097621_100351213 3300006237 Bacteria 1311
115 Ga0068871_100278214 3300006358 Bacteria 1463
116 Ga0068871_100433197 3300006358 Bacteria 1176
117 Ga0075428_100019380 3300006844 Bacteria 7530
118 Ga0075428_100047842 3300006844 Bacteria 4696
119 Ga0075428_100247059 3300006844 Bacteria 1923
120 Ga0075428_100597656 3300006844 Bacteria 1179
121 Ga0075430_100077753 3300006846 Bacteria 2781
122 Ga0075431_100046590 3300006847 Bacteria 4471
123 Ga0075431_100057159 3300006847 Bacteria 4024
124 Ga0075431_100147866 3300006847 Bacteria 2420
125 Ga0075433_10000092 3300006852 Bacteria 42081
126 Ga0075433_10001342 3300006852 Bacteria 18018
127 Ga0075433_10018630 3300006852 Bacteria 5773
128 Ga0075433_10198353 3300006852 Bacteria 1785
129 Ga0075433_10239858 3300006852 Bacteria 1609
130 Ga0075433_10255173 3300006852 Bacteria 1555
131 Ga0075433_10272458 3300006852 Bacteria 1500
132 Ga0075434_100000213 3300006871 Bacteria 39624
133 Ga0075434_100002455 3300006871 Bacteria 16316
134 Ga0075434_100010194 3300006871 Bacteria 8800
135 Ga0075434_100159255 3300006871 Bacteria 2277
136 Ga0075434_100190755 3300006871 Bacteria 2070
137 Ga0075434_100291024 3300006871 Bacteria 1653
138 Ga0075429_100048146 3300006880 Bacteria 3708
139 Ga0075429_100309653 3300006880 Bacteria 1382
140 Ga0075429_100467582 3300006880 Bacteria 1105
141 Ga0068865_100572434 3300006881 Bacteria 951
142 Ga0097620_100001189 3300006931 Bacteria 26592
143 Ga0097620_100006377 3300006931 Bacteria 11966
144 Ga0097620_100077306 3300006931 Bacteria 3369
145 Ga0097620_100281940 3300006931 Bacteria 1754
146 Ga0075435_100008933 3300007076 Bacteria 7224
147 Ga0075435_100016645 3300007076 Bacteria 5545
148 Ga0075435_100039463 3300007076 Bacteria 3768
149 Ga0075435_100083605 3300007076 Bacteria 2625
150 Ga0075435_100142496 3300007076 Bacteria 2011
151 Ga0111539_10002001 3300009094 Bacteria 27198
152 Ga0111539_10010325 3300009094 Bacteria 11757
153 Ga0111539_10026811 3300009094 Bacteria 7039
154 Ga0111539_10044160 3300009094 Bacteria 5340
155 Ga0111539_10145870 3300009094 Bacteria 2771
156 Ga0111539_10209326 3300009094 Bacteria 2272
157 Ga0111539_10364225 3300009094 Bacteria 1683
158 Ga0111539_10427793 3300009094 Bacteria 1542
159 Ga0105247_10150130 3300009101 Bacteria 1535
160 Ga0114129_10001136 3300009147 Bacteria 35167
161 Ga0114129_10017499 3300009147 Bacteria 10206
162 Ga0114129_10041426 3300009147 Bacteria 6489
163 Ga0114129_10056176 3300009147 Bacteria 5515
164 Ga0114129_10056776 3300009147 Bacteria 5481
165 Ga0114129_10087973 3300009147 Bacteria 4307
166 Ga0114129_10121134 3300009147 Bacteria 3601
167 Ga0114129_10175502 3300009147 Bacteria 2919
168 Ga0114129_10927532 3300009147 Bacteria 1101
169 Ga0105243_10009017 3300009148 Bacteria 7620
170 Ga0105238_10013992 3300009551 Bacteria 8114
171 Ga0105249_10213112 3300009553 Bacteria 1896
172 Ga0105249_10353432 3300009553 Bacteria 1489
173 Ga0163162_10050957 3300013306 Bacteria 4152
174 Ga0157375_10005001 3300013308 Bacteria 11526
175 Ga0157375_10050560 3300013308 Bacteria 4077
176 Ga0157375_10371720 3300013308 Bacteria 1596
177 Ga0163163_10026597 3300014325 Bacteria 5534
178 Ga0163163_10053041 3300014325 Bacteria 4002
179 Ga0163163_10090758 3300014325 Bacteria 3069
180 Ga0157380_10030009 3300014326 Bacteria 4161
181 Ga0157380_10032790 3300014326 Bacteria 3997
182 Ga0157380_10061982 3300014326 Bacteria 2994
183 Ga0157380_10069491 3300014326 Bacteria 2842
184 Ga0157377_10109628 3300014745 Bacteria 1657
185 Ga0157377_10254990 3300014745 Bacteria 1139
186 Ga0157376_10098737 3300014969 Bacteria 2546
187 Ga0157376_10180949 3300014969 Bacteria 1927
188 Ga0207697_10051925 3300025315 Bacteria 1695
189 Ga0207656_10013254 3300025321 Bacteria 3146
190 Ga0207642_10095911 3300025899 Bacteria 1477
191 Ga0207710_10076550 3300025900 Bacteria 1544
192 Ga0207688_10079179 3300025901 Bacteria 1874
193 Ga0207645_10006238 3300025907 Bacteria 8565
194 Ga0207643_10010086 3300025908 Bacteria 5079
195 Ga0207643_10063830 3300025908 Bacteria 2107
196 Ga0207643_10099625 3300025908 Bacteria 1703
197 Ga0207684_10308183 3300025910 Bacteria 1365
198 Ga0207662_10199368 3300025918 Bacteria 1295
199 Ga0207649_10055292 3300025920 Bacteria 2474
200 Ga0207646_10013245 3300025922 Bacteria 7890
201 Ga0207646_10316798 3300025922 Bacteria 1409
202 Ga0207646_10525748 3300025922 Bacteria 1065
203 Ga0207681_10005814 3300025923 Bacteria 7568
204 Ga0207681_10022889 3300025923 Bacteria 3990
205 Ga0207681_10093527 3300025923 Bacteria 2152
206 Ga0207681_10105629 3300025923 Bacteria 2039
207 Ga0207650_10016624 3300025925 Bacteria 5144
208 Ga0207650_10033373 3300025925 Bacteria 3727
209 Ga0207659_10000165 3300025926 Bacteria 39413
210 Ga0207659_10001508 3300025926 Bacteria 13858
211 Ga0207659_10017031 3300025926 Bacteria 4742
212 Ga0207659_10017103 3300025926 Bacteria 4732
213 Ga0207659_10061333 3300025926 Bacteria 2710
214 Ga0207659_10186213 3300025926 Bacteria 1648
215 Ga0207700_10009534 3300025928 Bacteria 6073
216 Ga0207644_10006449 3300025931 Bacteria 7646
217 Ga0207644_10020498 3300025931 Bacteria 4495
218 Ga0207706_10573034 3300025933 Bacteria 971
219 Ga0207686_10008189 3300025934 Bacteria 5641
220 Ga0207670_10042730 3300025936 Bacteria 2989
221 Ga0207670_10051501 3300025936 Bacteria 2765
222 Ga0207670_10119163 3300025936 Bacteria 1915
223 Ga0207670_10237802 3300025936 Bacteria 1402
224 Ga0207669_10029789 3300025937 Bacteria 3024
225 Ga0207669_10207015 3300025937 Bacteria 1429
226 Ga0207691_10010565 3300025940 Bacteria 8855
227 Ga0207691_10028311 3300025940 Bacteria 5248
228 Ga0207691_10041826 3300025940 Bacteria 4227
229 Ga0207691_10053486 3300025940 Bacteria 3686
230 Ga0207691_10145144 3300025940 Bacteria 2089
231 Ga0207689_10004370 3300025942 Bacteria 12862
232 Ga0207689_10046324 3300025942 Bacteria 3594
233 Ga0207689_10362559 3300025942 Bacteria 1205
234 Ga0207679_10015636 3300025945 Bacteria 5021
235 Ga0207679_10177878 3300025945 Bacteria 1757
236 Ga0207679_10339507 3300025945 Bacteria 1306
237 Ga0207651_10037235 3300025960 Bacteria 3185
238 Ga0207651_10065743 3300025960 Bacteria 2545
239 Ga0207651_10117958 3300025960 Bacteria 2006
240 Ga0207712_10268772 3300025961 Bacteria 1386
241 Ga0207668_10544649 3300025972 Bacteria 1004
242 Ga0207658_10508071 3300025986 Bacteria 1074
243 Ga0207703_10025387 3300026035 Bacteria 4660
244 Ga0207703_10038846 3300026035 Bacteria 3801
245 Ga0207703_10085042 3300026035 Bacteria 2646
246 Ga0207703_10122431 3300026035 Bacteria 2235
247 Ga0207678_10006118 3300026067 Bacteria 10703
248 Ga0207708_10016286 3300026075 Bacteria 5587
249 Ga0207708_10087324 3300026075 Bacteria 2401
250 Ga0207708_10217781 3300026075 Bacteria 1529
251 Ga0207708_10279591 3300026075 Bacteria 1352
252 Ga0207708_10294341 3300026075 Bacteria 1319
253 Ga0207641_10401719 3300026088 Bacteria 1316
254 Ga0207648_10001042 3300026089 Bacteria 31075
255 Ga0207648_10002155 3300026089 Bacteria 21410
256 Ga0207648_10193165 3300026089 Bacteria 1805
257 Ga0207648_10482160 3300026089 Unclassified 1133
258 Ga0207676_10004165 3300026095 Bacteria 10223
259 Ga0207676_10021713 3300026095 Bacteria 4711
260 Ga0207676_10054600 3300026095 Bacteria 3132
261 Ga0207676_10077932 3300026095 Bacteria 2682
262 Ga0207676_10317730 3300026095 Bacteria 1428
263 Ga0207674_10147974 3300026116 Bacteria 2306
264 Ga0207675_100004553 3300026118 Bacteria 13372
265 Ga0207675_100068512 3300026118 Bacteria 3316
266 Ga0207675_100532302 3300026118 Bacteria 1172
267 Ga0207683_10036563 3300026121 Bacteria 4277
268 Ga0207683_10278416 3300026121 Bacteria 1529
269 Ga0209971_1048736 3300027682 Bacteria 1023
270 Ga0209974_10032850 3300027876 Bacteria 1720
271 Ga0207428_10000527 3300027907 Bacteria 45656
272 Ga0207428_10016727 3300027907 Bacteria 6308
273 Ga0207428_10205274 3300027907 Bacteria 1482
274 Ga0268265_10552378 3300028380 Bacteria 1093
275 Ga0268264_10031582 3300028381 Bacteria 4341
276 Ga0268264_10099534 3300028381 Bacteria 2523
277 Ga0268264_10117976 3300028381 Bacteria 2335
278 Ga0307405_10049249 3300031731 Bacteria 2603
279 Ga0307413_10012859 3300031824 Bacteria 4181
280 Ga0307410_10116104 3300031852 Bacteria 1944
281 Ga0307407_10007807 3300031903 Bacteria 4869
282 Ga0307407_10230509 3300031903 Bacteria 1258
283 Ga0307412_10097984 3300031911 Bacteria 2067
284 Ga0307412_10158905 3300031911 Bacteria 1677
285 Ga0307409_100009739 3300031995 Bacteria 5925
286 Ga0307416_100025253 3300032002 Bacteria 4352
287 Ga0307416_100027408 3300032002 Bacteria 4218
288 Ga0307416_100081240 3300032002 Bacteria 2740
289 Ga0307416_100386210 3300032002 Bacteria 1432
290 Ga0307416_100682512 3300032002 Bacteria 1115
291 Ga0307414_10183607 3300032004 Bacteria 1685
292 Ga0307411_10003607 3300032005 Bacteria 7227
293 Ga0307411_10070071 3300032005 Bacteria 2371
294 Ga0373937_0043667 3300036401 Bacteria 4093
295 Ga0439453_0012951 3300041408 Bacteria 1412
296 Ga0450923_031537 3300042125 Bacteria 1083
297 Ga0439435_0036277 3300042436 Bacteria 1362
298 Ga0439444_0016491 3300042437 Bacteria 1259
299 Ga0451576_0022287 3300045051 Bacteria 6870
300 Ga0451576_0034579 3300045051 Bacteria 5366
301 Ga0451576_0076533 3300045051 Bacteria 3482
302 Ga0451576_0106399 3300045051 Bacteria 2919
303 Ga0451576_0312136 3300045051 Bacteria 1645
304 Ga0451576_0804461 3300045051 Bacteria 987
305 Ga0466967_0682955 3300045976 Bacteria 1016
306 Ga0495603_0072249 3300046455 Bacteria 2027
307 Ga0495580_0175389 3300046472 Bacteria 1481
308 Ga0495584_0102159 3300046491 Bacteria 1449
309 Ga0495585_0081082 3300046492 Bacteria 1758
310 Ga0495594_0077523 3300046499 Bacteria 1854
311 Ga0495643_0016395 3300046522 Bacteria 4351
312 Ga0495663_0056795 3300046525 Bacteria 1223
313 Ga0495598_0004850 3300046537 Bacteria 2942
314 Ga0495598_0005531 3300046537 Bacteria 2807
315 Ga0495609_0100395 3300046538 Bacteria 1254
316 Ga0495621_0001607 3300046539 Bacteria 5897
317 Ga0495621_0015648 3300046539 Bacteria 2422
318 Ga0495621_0058741 3300046539 Bacteria 1392
319 Ga0495659_0004181 3300046664 Bacteria 4554
320 Ga0495659_0004693 3300046664 Unclassified 4302
321 Ga0495659_0008159 3300046664 Bacteria 3329
322 Ga0495588_0006430 3300046674 Bacteria 5291
323 Ga0495636_0007780 3300047318 Bacteria 4218
324 Ga0495677_0089163 3300047445 Bacteria 1161
325 Ga0501039_0017437 3300049575 Bacteria 5508
326 Ga0501040_0015284 3300049576 Bacteria 5074
327 Ga0501041_0010554 3300049577 Bacteria 5446
328 Ga0501042_0011488 3300049578 Bacteria 5979
329 Ga0501067_0010307 3300049583 Bacteria 5173
330 Ga0501072_0165896 3300049588 Bacteria 1762
331 Ga0501075_0018266 3300049591 Bacteria 5073
332 Ga0501076_0088447 3300049592 Bacteria 2489
333 Ga0501079_0041747 3300049741 Bacteria 3542
334 Ga0501080_0507538 3300049742 Bacteria 1077
335 Ga0501081_0063479 3300049743 Bacteria 2563
336 Ga0501081_0287215 3300049743 Bacteria 1205
337 nmdc:mga05p37_106700_c1 3300050507 Bacteria 3446
338 nmdc:mga05p37_109540_c1 3300050507 Bacteria 3397
339 nmdc:mga05p37_159324_c1 3300050507 Bacteria 2757
340 nmdc:mga05p37_235342_c1 3300050507 Bacteria 2205
341 nmdc:mga05p37_45960_c1 3300050507 Bacteria 5370
342 nmdc:mga05p37_95505_c1 3300050507 Bacteria 3662
343 nmdc:mga09592_190985_c1 3300050508 Bacteria 1773
344 nmdc:mga09592_268786_c1 3300050508 Bacteria 1479
345 nmdc:mga09592_70202_c1 3300050508 Bacteria 2972
346 nmdc:mga0qj67_117234_c1 3300050509 Bacteria 2152
347 nmdc:mga06r32_120648_c1 3300050510 Bacteria 2586
348 nmdc:mga06r32_33124_c1 3300050510 Bacteria 4865
349 nmdc:mga06r32_350442_c1 3300050510 Bacteria 1461
350 nmdc:mga08y16_102006_c1 3300050511 Bacteria 2987
351 nmdc:mga08y16_10582_c1 3300050511 Bacteria 9678
352 nmdc:mga08y16_116740_c1 3300050511 Bacteria 2778
353 nmdc:mga08y16_169787_c1 3300050511 Bacteria 2265
354 nmdc:mga08y16_34722_c1 3300050511 Bacteria 5299
355 nmdc:mga08y16_349_c1 3300050511 Bacteria 41563
356 nmdc:mga08y16_43166_c1 3300050511 Bacteria 4724
357 nmdc:mga08y16_44422_c1 3300050511 Bacteria 4655
358 nmdc:mga08y16_561954_c1 3300050511 Bacteria 1154
359 nmdc:mga0n895_10215_c1 3300050512 Bacteria 8270
360 nmdc:mga0n895_15005_c1 3300050512 Bacteria 7058
361 nmdc:mga0n895_188726_c1 3300050512 Bacteria 2092
362 nmdc:mga0n895_33981_c1 3300050512 Bacteria 4905
363 nmdc:mga0n895_422021_c1 3300050512 Bacteria 1348
364 nmdc:mga0n895_7906_c1 3300050512 Bacteria 9168
365 nmdc:mga0rr50_147456_c1 3300050513 Bacteria 1898
366 nmdc:mga0rr50_25214_c1 3300050513 Bacteria 4130
367 nmdc:mga0rr50_303083_c1 3300050513 Bacteria 1337
368 nmdc:mga0rr50_4121_c1 3300050513 Bacteria 8496
369 nmdc:mga08x19_233491_c1 3300050514 Unclassified 1266
370 nmdc:mga0a205_119_c1 3300050515 Bacteria 47408
371 nmdc:mga0a205_155059_c1 3300050515 Bacteria 2189
372 nmdc:mga0a205_200141_c1 3300050515 Bacteria 1888
373 nmdc:mga0a205_520977_c1 3300050515 Bacteria 1045
374 nmdc:mga0a205_5643_c1 3300050515 Bacteria 11273
375 nmdc:mga0a205_70398_c1 3300050515 Bacteria 3377
376 nmdc:mga0a205_74593_c1 3300050515 Bacteria 3278
377 Ga0501084_0206292 3300054114 Bacteria 1658
378 Ga0590071_000197 3300059421 Bacteria 17607
379 Ga0590071_000436 3300059421 Bacteria 12086
380 Ga0590074_000809 3300059423 Bacteria 4828
381 Ga0590077_000297 3300059426 Bacteria 14069
382 Ga0590077_000431 3300059426 Bacteria 11762
383 nmdc:mga05p37_470611_c1
384 JGI25406J46586_10000120
385 JGI25406J46586_10002349
386 Ga0065707_10002879
387 Ga0065707_10153849
388 Ga0070676_10162093
389 Ga0070690_100072122
390 Ga0070690_100190475
391 Ga0070670_100241391
392 Ga0070670_100613693
393 Ga0068869_100079710
394 Ga0070666_10018272
395 Ga0070689_100060395
396 Ga0070689_100098735
397 Ga0070689_100124201
398 Ga0070687_100002090
399 Ga0070687_100181622
400 Ga0070661_100145959
401 Ga0070692_10017106
402 Ga0070692_10101661
403 Ga0070692_10238881
404 Ga0070692_10417024
405 Ga0070669_100009871
406 Ga0070669_100122813
407 Ga0070669_100277823
408 Ga0070669_100617155
409 Ga0070675_100000785
410 Ga0070675_100002595
411 Ga0070675_100006317
412 Ga0070675_100024453
413 Ga0070675_100039445
414 Ga0070675_100237923
415 Ga0070675_100258745
416 Ga0070675_100394336
417 Ga0070671_100002655
418 Ga0070674_100022120
419 Ga0070673_100014378
420 Ga0070673_100082847
421 Ga0070673_100511572
422 Ga0070688_100019442
423 Ga0070688_100036161
424 Ga0070688_100106538
425 Ga0070688_100139002
426 Ga0070659_100136512
427 Ga0070713_100110409
428 Ga0070701_10015293
429 Ga0070701_10047649
430 Ga0070705_100001204
431 Ga0070705_100027814
432 Ga0070705_100044787
433 Ga0070700_100009052
434 Ga0070700_100146899
435 Ga0070694_100000199
436 Ga0070694_100001846
437 Ga0070663_100014487
438 Ga0070678_100289698
439 Ga0070678_100510286
440 Ga0070662_100392986
441 Ga0068867_100001191
442 Ga0070685_10122953
443 Ga0070706_100512670
444 Ga0070707_100025906
445 Ga0070707_100302932
446 Ga0070707_100663067
447 Ga0070698_100003898
448 Ga0070698_100004315
449 Ga0070699_100000172
450 Ga0070699_100016152
451 Ga0070699_100024068
452 Ga0070699_100025019
453 Ga0070699_100053834
454 Ga0070699_100147621
455 Ga0070679_100055350
456 Ga0070697_100024999
457 Ga0070672_100047558
458 Ga0070672_100096123
459 Ga0070672_100315822
460 Ga0070672_100446195
461 Ga0070686_100053925
462 Ga0070686_100066813
463 Ga0070695_100000002
464 Ga0070696_100000175
465 Ga0070696_100008650
466 Ga0070696_100016814
467 Ga0070665_100491743
468 Ga0070704_100000468
469 Ga0070704_100021150
470 Ga0070664_100072550
471 Ga0070664_100199849
472 Ga0068857_100054695
473 Ga0068857_100342176
474 Ga0070702_100065063
475 Ga0068859_100001189
476 Ga0068859_100006376
477 Ga0068859_100077305
478 Ga0068859_100281926
479 Ga0068864_100013421
480 Ga0068864_100034576
481 Ga0068864_100327929
482 Ga0068864_100331481
483 Ga0068861_100003348
484 Ga0068861_100125777
485 Ga0068851_10067629
486 Ga0068863_100037246
487 Ga0068863_100260631
488 Ga0068858_100026257
489 Ga0068860_100011339
490 Ga0068860_100099250
491 Ga0068860_100821828
492 Ga0068862_100001812
493 Ga0068862_100583398
494 Ga0081539_10000024
495 Ga0081539_10000096
496 Ga0097621_100351213
497 Ga0068871_100278214
498 Ga0068871_100433197
499 Ga0075428_100019380
500 Ga0075428_100047842
501 Ga0075428_100247059
502 Ga0075428_100597656
503 Ga0075430_100077753
504 Ga0075431_100046590
505 Ga0075431_100057159
506 Ga0075431_100147866
507 Ga0075433_10000092
508 Ga0075433_10001342
509 Ga0075433_10018630
510 Ga0075433_10198353
511 Ga0075433_10239858
512 Ga0075433_10255173
513 Ga0075433_10272458
514 Ga0075434_100000213
515 Ga0075434_100002455
516 Ga0075434_100010194
517 Ga0075434_100159255
518 Ga0075434_100190755
519 Ga0075434_100291024
520 Ga0075429_100048146
521 Ga0075429_100309653
522 Ga0075429_100467582
523 Ga0068865_100572434
524 Ga0097620_100001189
525 Ga0097620_100006377
526 Ga0097620_100077306
527 Ga0097620_100281940
528 Ga0075435_100008933
529 Ga0075435_100016645
530 Ga0075435_100039463
531 Ga0075435_100083605
532 Ga0075435_100142496
533 Ga0111539_10002001
534 Ga0111539_10010325
535 Ga0111539_10026811
536 Ga0111539_10044160
537 Ga0111539_10145870
538 Ga0111539_10209326
539 Ga0111539_10364225
540 Ga0111539_10427793
541 Ga0105247_10150130
542 Ga0114129_10001136
543 Ga0114129_10017499
544 Ga0114129_10041426
545 Ga0114129_10056176
546 Ga0114129_10056776
547 Ga0114129_10087973
548 Ga0114129_10121134
549 Ga0114129_10175502
550 Ga0114129_10927532
551 Ga0105243_10009017
552 Ga0105238_10013992
553 Ga0105249_10213112
554 Ga0105249_10353432
555 Ga0163162_10050957
556 Ga0157375_10005001
557 Ga0157375_10050560
558 Ga0157375_10371720
559 Ga0163163_10026597
560 Ga0163163_10053041
561 Ga0163163_10090758
562 Ga0157380_10030009
563 Ga0157380_10032790
564 Ga0157380_10061982
565 Ga0157380_10069491
566 Ga0157377_10109628
567 Ga0157377_10254990
568 Ga0157376_10098737
569 Ga0157376_10180949
570 Ga0207697_10051925
571 Ga0207656_10013254
572 Ga0207642_10095911
573 Ga0207710_10076550
574 Ga0207688_10079179
575 Ga0207645_10006238
576 Ga0207643_10010086
577 Ga0207643_10063830
578 Ga0207643_10099625
579 Ga0207684_10308183
580 Ga0207662_10199368
581 Ga0207649_10055292
582 Ga0207646_10013245
583 Ga0207646_10316798
584 Ga0207646_10525748
585 Ga0207681_10005814
586 Ga0207681_10022889
587 Ga0207681_10093527
588 Ga0207681_10105629
589 Ga0207650_10016624
590 Ga0207650_10033373
591 Ga0207659_10000165
592 Ga0207659_10001508
593 Ga0207659_10017031
594 Ga0207659_10017103
595 Ga0207659_10061333
596 Ga0207659_10186213
597 Ga0207700_10009534
598 Ga0207644_10006449
599 Ga0207644_10020498
600 Ga0207706_10573034
601 Ga0207686_10008189
602 Ga0207670_10042730
603 Ga0207670_10051501
604 Ga0207670_10119163
605 Ga0207670_10237802
606 Ga0207669_10029789
607 Ga0207669_10207015
608 Ga0207691_10010565
609 Ga0207691_10028311
610 Ga0207691_10041826
611 Ga0207691_10053486
612 Ga0207691_10145144
613 Ga0207689_10004370
614 Ga0207689_10046324
615 Ga0207689_10362559
616 Ga0207679_10015636
617 Ga0207679_10177878
618 Ga0207679_10339507
619 Ga0207651_10037235
620 Ga0207651_10065743
621 Ga0207651_10117958
622 Ga0207712_10268772
623 Ga0207668_10544649
624 Ga0207658_10508071
625 Ga0207703_10025387
626 Ga0207703_10038846
627 Ga0207703_10085042
628 Ga0207703_10122431
629 Ga0207678_10006118
630 Ga0207708_10016286
631 Ga0207708_10087324
632 Ga0207708_10217781
633 Ga0207708_10279591
634 Ga0207708_10294341
635 Ga0207641_10401719
636 Ga0207648_10001042
637 Ga0207648_10002155
638 Ga0207648_10193165
639 Ga0207648_10482160
640 Ga0207676_10004165
641 Ga0207676_10021713
642 Ga0207676_10054600
643 Ga0207676_10077932
644 Ga0207676_10317730
645 Ga0207674_10147974
646 Ga0207675_100004553
647 Ga0207675_100068512
648 Ga0207675_100532302
649 Ga0207683_10036563
650 Ga0207683_10278416
651 Ga0209971_1048736
652 Ga0209974_10032850
653 Ga0207428_10000527
654 Ga0207428_10016727
655 Ga0207428_10205274
656 Ga0268265_10552378
657 Ga0268264_10031582
658 Ga0268264_10099534
659 Ga0268264_10117976
660 Ga0307405_10049249
661 Ga0307413_10012859
662 Ga0307410_10116104
663 Ga0307407_10007807
664 Ga0307407_10230509
665 Ga0307412_10097984
666 Ga0307412_10158905
667 Ga0307409_100009739
668 Ga0307416_100025253
669 Ga0307416_100027408
670 Ga0307416_100081240
671 Ga0307416_100386210
672 Ga0307416_100682512
673 Ga0307414_10183607
674 Ga0307411_10003607
675 Ga0307411_10070071
676 Ga0373937_0043667
677 Ga0439453_0012951
678 Ga0450923_031537
679 Ga0439435_0036277
680 Ga0439444_0016491
681 Ga0451576_0022287
682 Ga0451576_0034579
683 Ga0451576_0076533
684 Ga0451576_0106399
685 Ga0451576_0312136
686 Ga0451576_0804461
687 Ga0466967_0682955
688 Ga0495603_0072249
689 Ga0495580_0175389
690 Ga0495584_0102159
691 Ga0495585_0081082
692 Ga0495594_0077523
693 Ga0495643_0016395
694 Ga0495663_0056795
695 Ga0495598_0004850
696 Ga0495598_0005531
697 Ga0495609_0100395
698 Ga0495621_0001607
699 Ga0495621_0015648
700 Ga0495621_0058741
701 Ga0495659_0004181
702 Ga0495659_0004693
703 Ga0495659_0008159
704 Ga0495588_0006430
705 Ga0495636_0007780
706 Ga0495677_0089163
707 Ga0501039_0017437
708 Ga0501040_0015284
709 Ga0501041_0010554
710 Ga0501042_0011488
711 Ga0501067_0010307
712 Ga0501072_0165896
713 Ga0501075_0018266
714 Ga0501076_0088447
715 Ga0501079_0041747
716 Ga0501080_0507538
717 Ga0501081_0063479
718 Ga0501081_0287215
719 nmdc:mga05p37_106700_c1
720 nmdc:mga05p37_109540_c1
721 nmdc:mga05p37_159324_c1
722 nmdc:mga05p37_235342_c1
723 nmdc:mga05p37_45960_c1
724 nmdc:mga05p37_95505_c1
725 nmdc:mga09592_190985_c1
726 nmdc:mga09592_268786_c1
727 nmdc:mga09592_70202_c1
728 nmdc:mga0qj67_117234_c1
729 nmdc:mga06r32_120648_c1
730 nmdc:mga06r32_33124_c1
731 nmdc:mga06r32_350442_c1
732 nmdc:mga08y16_102006_c1
733 nmdc:mga08y16_10582_c1
734 nmdc:mga08y16_116740_c1
735 nmdc:mga08y16_169787_c1
736 nmdc:mga08y16_34722_c1
737 nmdc:mga08y16_349_c1
738 nmdc:mga08y16_43166_c1
739 nmdc:mga08y16_44422_c1
740 nmdc:mga08y16_561954_c1
741 nmdc:mga0n895_10215_c1
742 nmdc:mga0n895_15005_c1
743 nmdc:mga0n895_188726_c1
744 nmdc:mga0n895_33981_c1
745 nmdc:mga0n895_422021_c1
746 nmdc:mga0n895_7906_c1
747 nmdc:mga0rr50_147456_c1
748 nmdc:mga0rr50_25214_c1
749 nmdc:mga0rr50_303083_c1
750 nmdc:mga0rr50_4121_c1
751 nmdc:mga08x19_233491_c1
752 nmdc:mga0a205_119_c1
753 nmdc:mga0a205_155059_c1
754 nmdc:mga0a205_200141_c1
755 nmdc:mga0a205_520977_c1
756 nmdc:mga0a205_5643_c1
757 nmdc:mga0a205_70398_c1
758 nmdc:mga0a205_74593_c1
759 Ga0501084_0206292
760 Ga0590071_000197
761 Ga0590071_000436
762 Ga0590074_000809
763 Ga0590077_000297
764 Ga0590077_000431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

67

216

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

182

252

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9309 2 262
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9249 2 263
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9138 1 221
4g1u-assembly1.cif.gz_D x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9124 1 262
5x41-assembly1.cif.gz_A 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9104 2 240
ID Description Score Start End Superfamily
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9678 1 250 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9629 4 259 3.40.50.300
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9597 2 243 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9555 4 259 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9485 1 250 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1H5GCX7-F1-model_v4 Iron complex transport system ATP-binding protein 0.9698 2 261 GO:0005524
GO:0016887
AF-A0A2M9Q9S4-F1-model_v4 ABC transporter 0.969 1 262 GO:0005524
GO:0016887
AF-A0A366ID69-F1-model_v4 Iron complex transport system ATP-binding protein 0.9674 2 262 GO:0005524
GO:0016887
AF-S2YGC9-F1-model_v4 ABC transporter domain-containing protein 0.9659 1 263 GO:0005524
GO:0016887
AF-A0A485LW74-F1-model_v4 Putative siderophore transport system ATP-binding protein YusV 0.9648 2 264 GO:0005524
GO:0016887

Map