F429314

General Info

Members Datasets Scaffolds Average Seq Length
382 213 382 278

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10203640|Ga0307412_102036402
Length 314
Sequence VQGLLRLGPGLDGDQGLSVTAQPAVGRSAGRRSADLLHGHRRIQVSLLLAGPLGWLVVAYLGSLAVLFVAAFWQLDDFSGQIVHTYSLDNFKTLWEGDVYHEIVLRTVGIAAAVTLTDAILAFPIAFYMAKVATPRTRAILAVAILMPLWASYLVKVYAWRTILSDEGILNWALGPLGIDGPGYGMVATWLVFSYLWLPFMVLPIYAGLQRIPNSLLDASGDLGAGAGHTFRRVIVPLVFPAMVAGSIFTFSLTLGDYITPGLVSSTQFIGNVVYNNVGVANNLPLAAAFATVPVVVMVLYLLGARRLGAFEQL

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 11.52
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10001083 3300002077 Bacteria 5273
2 JGI25406J46586_10013622 3300003203 Bacteria 3485
3 Ga0070690_100069323 3300005330 Bacteria 2288
4 Ga0068869_100175278 3300005334 Bacteria 1678
5 Ga0070680_100014269 3300005336 Bacteria 6205
6 Ga0070682_100019983 3300005337 Bacteria 3935
7 Ga0068868_100118556 3300005338 Bacteria 2157
8 Ga0068868_100307552 3300005338 Bacteria 1348
9 Ga0070689_100015062 3300005340 Bacteria 5631
10 Ga0070689_100429534 3300005340 Bacteria 1121
11 Ga0070668_100057581 3300005347 Bacteria 3004
12 Ga0070669_100253792 3300005353 Bacteria 1401
13 Ga0070669_100432332 3300005353 Bacteria 1082
14 Ga0070674_100002235 3300005356 Bacteria 10649
15 Ga0070674_100011269 3300005356 Bacteria 5438
16 Ga0070688_100011167 3300005365 Bacteria 4986
17 Ga0070667_100147557 3300005367 Bacteria 2064
18 Ga0070714_100002178 3300005435 Bacteria 14396
19 Ga0070714_100055585 3300005435 Bacteria 3384
20 Ga0070714_100119909 3300005435 Bacteria 2339
21 Ga0070713_100065547 3300005436 Bacteria 3051
22 Ga0070701_10004998 3300005438 Bacteria 5434
23 Ga0070711_100008633 3300005439 Bacteria 6249
24 Ga0070711_100033319 3300005439 Bacteria 3430
25 Ga0070705_100260827 3300005440 Bacteria 1222
26 Ga0070700_100002344 3300005441 Bacteria 9640
27 Ga0070694_100082119 3300005444 Bacteria 2244
28 Ga0070663_100047380 3300005455 Bacteria 3044
29 Ga0070678_100000442 3300005456 Bacteria 19620
30 Ga0068867_100037240 3300005459 Bacteria 3536
31 Ga0070685_10029126 3300005466 Bacteria 3065
32 Ga0070698_100003022 3300005471 Bacteria 18539
33 Ga0070684_100019037 3300005535 Bacteria 5672
34 Ga0070684_100136545 3300005535 Bacteria 2215
35 Ga0068853_100008817 3300005539 Bacteria 8111
36 Ga0070686_100002207 3300005544 Bacteria 10761
37 Ga0070695_100063308 3300005545 Bacteria 2404
38 Ga0070696_100001559 3300005546 Bacteria 14991
39 Ga0068855_100161109 3300005563 Bacteria 2546
40 Ga0068855_100237460 3300005563 Bacteria 2038
41 Ga0070664_100382249 3300005564 Bacteria 1285
42 Ga0070664_100412592 3300005564 Bacteria 1236
43 Ga0068857_100073095 3300005577 Bacteria 3055
44 Ga0068857_100130898 3300005577 Bacteria 2263
45 Ga0068856_100005584 3300005614 Bacteria 12384
46 Ga0068856_100533288 3300005614 Bacteria 1195
47 Ga0070702_100046068 3300005615 Bacteria 2470
48 Ga0068852_100013729 3300005616 Bacteria 6208
49 Ga0068852_100239566 3300005616 Bacteria 1733
50 Ga0068866_10003564 3300005718 Bacteria 6373
51 Ga0068861_100406936 3300005719 Bacteria 1209
52 Ga0081455_10041996 3300005937 Bacteria 4017
53 Ga0081455_10051456 3300005937 Bacteria 3533
54 Ga0081538_10039106 3300005981 Bacteria 3047
55 Ga0081540_1016011 3300005983 Bacteria 4720
56 Ga0081539_10003259 3300005985 Bacteria 20371
57 Ga0081539_10007655 3300005985 Bacteria 9727
58 Ga0081539_10009480 3300005985 Bacteria 8122
59 Ga0081539_10032347 3300005985 Bacteria 3205
60 Ga0081539_10062213 3300005985 Bacteria 2041
61 Ga0081539_10114101 3300005985 Bacteria 1354
62 Ga0070717_10011406 3300006028 Bacteria 6747
63 Ga0070712_100008690 3300006175 Bacteria 6398
64 Ga0068871_100051941 3300006358 Bacteria 3318
65 Ga0075428_100017672 3300006844 Bacteria 7881
66 Ga0075428_100059365 3300006844 Bacteria 4189
67 Ga0075428_100164162 3300006844 Bacteria 2409
68 Ga0075428_100304979 3300006844 Bacteria 1712
69 Ga0075428_100311667 3300006844 Bacteria 1691
70 Ga0075428_100496637 3300006844 Bacteria 1306
71 Ga0075430_100010398 3300006846 Bacteria 7881
72 Ga0075430_100011923 3300006846 Bacteria 7400
73 Ga0075431_100005051 3300006847 Bacteria 12981
74 Ga0075431_100683477 3300006847 Bacteria 1005
75 Ga0075429_100028628 3300006880 Bacteria 4837
76 Ga0068865_100017941 3300006881 Bacteria 4560
77 Ga0068865_100507290 3300006881 Bacteria 1007
78 Ga0075435_100177918 3300007076 Bacteria 1797
79 Ga0111539_10046573 3300009094 Bacteria 5186
80 Ga0111539_10092076 3300009094 Bacteria 3562
81 Ga0111539_10431103 3300009094 Bacteria 1535
82 Ga0111539_10660676 3300009094 Bacteria 1217
83 Ga0105245_10087915 3300009098 Bacteria 2853
84 Ga0105245_10089446 3300009098 Bacteria 2830
85 Ga0105245_10261170 3300009098 Bacteria 1685
86 Ga0114129_10005080 3300009147 Bacteria 18523
87 Ga0114129_10012797 3300009147 Bacteria 11941
88 Ga0114129_10160366 3300009147 Bacteria 3073
89 Ga0105243_10009361 3300009148 Bacteria 7465
90 Ga0105243_10573053 3300009148 Bacteria 1082
91 Ga0105248_10050690 3300009177 Bacteria 4656
92 Ga0105248_10252804 3300009177 Bacteria 1984
93 Ga0105237_10167994 3300009545 Bacteria 2193
94 Ga0105238_10066546 3300009551 Bacteria 3604
95 Ga0105238_10337343 3300009551 Bacteria 1495
96 Ga0105249_10000948 3300009553 Bacteria 25660
97 Ga0105249_10067356 3300009553 Bacteria 3299
98 Ga0105239_10007386 3300010375 Bacteria 12615
99 Ga0105246_10021317 3300011119 Bacteria 4168
100 Ga0105246_10068712 3300011119 Bacteria 2486
101 Ga0105246_10562662 3300011119 Bacteria 979
102 Ga0157374_10193237 3300013296 Bacteria 1991
103 Ga0157374_10413201 3300013296 Bacteria 1347
104 Ga0157378_10004893 3300013297 Bacteria 11744
105 Ga0163162_10052689 3300013306 Bacteria 4087
106 Ga0163162_10396219 3300013306 Bacteria 1513
107 Ga0157372_10803380 3300013307 Bacteria 1093
108 Ga0157375_10462549 3300013308 Bacteria 1434
109 Ga0157375_10727299 3300013308 Bacteria 1145
110 Ga0157380_10009040 3300014326 Bacteria 7118
111 Ga0157380_10034922 3300014326 Bacteria 3880
112 Ga0157380_10085265 3300014326 Bacteria 2592
113 Ga0157380_10306771 3300014326 Bacteria 1465
114 Ga0157377_10146531 3300014745 Bacteria 1456
115 Ga0157379_10214942 3300014968 Bacteria 1741
116 Ga0157376_10128891 3300014969 Bacteria 2254
117 Ga0207653_10039211 3300025885 Bacteria 1550
118 Ga0207692_10039436 3300025898 Bacteria 2323
119 Ga0207642_10004054 3300025899 Bacteria 4690
120 Ga0207654_10017912 3300025911 Bacteria 3711
121 Ga0207693_10004453 3300025915 Bacteria 11836
122 Ga0207663_10034434 3300025916 Bacteria 3029
123 Ga0207663_10043411 3300025916 Bacteria 2752
124 Ga0207660_10035744 3300025917 Bacteria 3451
125 Ga0207662_10042681 3300025918 Bacteria 2674
126 Ga0207657_10026182 3300025919 Bacteria 5365
127 Ga0207681_10283516 3300025923 Bacteria 1305
128 Ga0207681_10381292 3300025923 Bacteria 1135
129 Ga0207687_10033479 3300025927 Bacteria 3486
130 Ga0207687_10279896 3300025927 Bacteria 1337
131 Ga0207687_10500911 3300025927 Bacteria 1014
132 Ga0207664_10037028 3300025929 Bacteria 3773
133 Ga0207664_10199721 3300025929 Bacteria 1725
134 Ga0207690_10096828 3300025932 Bacteria 2099
135 Ga0207706_10165849 3300025933 Bacteria 1941
136 Ga0207686_10015316 3300025934 Bacteria 4285
137 Ga0207686_10198952 3300025934 Bacteria 1434
138 Ga0207709_10002743 3300025935 Bacteria 10857
139 Ga0207709_10077319 3300025935 Bacteria 2133
140 Ga0207669_10015057 3300025937 Bacteria 3890
141 Ga0207669_10022185 3300025937 Bacteria 3367
142 Ga0207704_10015156 3300025938 Bacteria 3919
143 Ga0207704_10326570 3300025938 Bacteria 1186
144 Ga0207691_10071578 3300025940 Bacteria 3129
145 Ga0207691_10089876 3300025940 Bacteria 2753
146 Ga0207711_10043626 3300025941 Bacteria 3826
147 Ga0207689_10050110 3300025942 Bacteria 3444
148 Ga0207689_10103796 3300025942 Unclassified 2336
149 Ga0207661_10108848 3300025944 Bacteria 2340
150 Ga0207679_10169096 3300025945 Bacteria 1798
151 Ga0207679_10411822 3300025945 Bacteria 1191
152 Ga0207667_10304034 3300025949 Bacteria 1630
153 Ga0207712_10010539 3300025961 Bacteria 5868
154 Ga0207668_10005172 3300025972 Bacteria 7676
155 Ga0207668_10258044 3300025972 Bacteria 1419
156 Ga0207668_10329486 3300025972 Bacteria 1270
157 Ga0207640_10211095 3300025981 Bacteria 1479
158 Ga0207640_10285259 3300025981 Bacteria 1299
159 Ga0207658_10113159 3300025986 Bacteria 2150
160 Ga0207703_10575903 3300026035 Bacteria 1063
161 Ga0207639_10054189 3300026041 Bacteria 3064
162 Ga0207678_10014467 3300026067 Bacteria 6935
163 Ga0207708_10000564 3300026075 Bacteria 28643
164 Ga0207708_10003731 3300026075 Bacteria 11243
165 Ga0207708_10009644 3300026075 Bacteria 7160
166 Ga0207702_10041583 3300026078 Bacteria 3855
167 Ga0207702_10143149 3300026078 Bacteria 2166
168 Ga0207648_10001096 3300026089 Bacteria 30351
169 Ga0207648_10067233 3300026089 Bacteria 3125
170 Ga0207674_10060151 3300026116 Bacteria 3843
171 Ga0207674_10113468 3300026116 Bacteria 2683
172 Ga0207674_10132735 3300026116 Bacteria 2453
173 Ga0207675_100363153 3300026118 Bacteria 1421
174 Ga0207683_10000251 3300026121 Bacteria 47816
175 Ga0207683_10447238 3300026121 Bacteria 1191
176 Ga0207698_10039073 3300026142 Bacteria 3513
177 Ga0207698_10416126 3300026142 Bacteria 1289
178 Ga0209974_10010121 3300027876 Bacteria 3187
179 Ga0207428_10078022 3300027907 Bacteria 2592
180 Ga0207428_10175356 3300027907 Bacteria 1622
181 Ga0268264_10262502 3300028381 Bacteria 1609
182 Ga0307408_100088206 3300031548 Bacteria 2336
183 Ga0307408_100376770 3300031548 Bacteria 1212
184 Ga0307405_10006036 3300031731 Bacteria 5921
185 Ga0307405_10008377 3300031731 Bacteria 5236
186 Ga0307413_10007136 3300031824 Bacteria 5161
187 Ga0307413_10012775 3300031824 Bacteria 4192
188 Ga0307413_10081167 3300031824 Bacteria 2078
189 Ga0307410_10001770 3300031852 Bacteria 10000
190 Ga0307410_10012899 3300031852 Bacteria 4853
191 Ga0307410_10018187 3300031852 Bacteria 4242
192 Ga0307406_10006277 3300031901 Bacteria 6551
193 Ga0307406_10077857 3300031901 Bacteria 2195
194 Ga0307407_10001868 3300031903 Bacteria 7930
195 Ga0307412_10019577 3300031911 Bacteria 4103
196 Ga0307412_10203640 3300031911 Bacteria 1505
197 Ga0307412_10322467 3300031911 Bacteria 1230
198 Ga0307409_100022092 3300031995 Bacteria 4379
199 Ga0307409_100044759 3300031995 Bacteria 3336
200 Ga0307409_100550091 3300031995 Bacteria 1133
201 Ga0307416_100036238 3300032002 Bacteria 3780
202 Ga0307416_100038145 3300032002 Bacteria 3704
203 Ga0307416_100658959 3300032002 Bacteria 1132
204 Ga0307414_10060371 3300032004 Bacteria 2681
205 Ga0307411_10017553 3300032005 Bacteria 4082
206 Ga0307411_10018132 3300032005 Bacteria 4030
207 Ga0307411_10402173 3300032005 Bacteria 1132
208 Ga0307415_100007998 3300032126 Bacteria 5830
209 Ga0373943_0151122 3300035170 Bacteria 1258
210 Ga0316574_0076508 3300035398 Bacteria 2120
211 Ga0373947_0036120 3300035725 Bacteria 2929
212 Ga0395899_0016344 3300037312 Bacteria 5656
213 Ga0395899_0052975 3300037312 Bacteria 3006
214 Ga0395899_0177365 3300037312 Bacteria 1498
215 Ga0395900_0006416 3300037418 Bacteria 12257
216 Ga0395900_0014130 3300037418 Bacteria 8153
217 Ga0395900_0044306 3300037418 Bacteria 4585
218 Ga0395900_0058178 3300037418 Bacteria 3979
219 Ga0395900_0201645 3300037418 Bacteria 2012
220 Ga0395900_0346826 3300037418 Bacteria 1459
221 Ga0395900_0613100 3300037418 Bacteria 1028
222 Ga0395900_0798140 3300037418 Bacteria 872
223 Ga0395898_0006779 3300037466 Bacteria 12191
224 Ga0395898_0011166 3300037466 Bacteria 9353
225 Ga0395898_0065646 3300037466 Bacteria 3518
226 Ga0395898_0081976 3300037466 Bacteria 3110
227 Ga0395898_0142229 3300037466 Bacteria 2297
228 Ga0395898_0147196 3300037466 Bacteria 2254
229 Ga0395898_0185054 3300037466 Bacteria 1990
230 Ga0395898_0355290 3300037466 Bacteria 1397
231 Ga0395898_0366197 3300037466 Bacteria 1374
232 Ga0395905_0004411 3300037471 Bacteria 14636
233 Ga0395905_0012731 3300037471 Bacteria 8090
234 Ga0395905_0056496 3300037471 Bacteria 3671
235 Ga0395905_0214500 3300037471 Bacteria 1803
236 Ga0395905_0258907 3300037471 Bacteria 1624
237 Ga0395901_0038527 3300038443 Bacteria 4945
238 Ga0395901_0039766 3300038443 Bacteria 4867
239 Ga0395901_0048180 3300038443 Bacteria 4425
240 Ga0395901_0081761 3300038443 Bacteria 3374
241 Ga0395901_0113250 3300038443 Bacteria 2849
242 Ga0395901_0114975 3300038443 Bacteria 2826
243 Ga0395901_0180222 3300038443 Bacteria 2216
244 Ga0395901_0191976 3300038443 Bacteria 2141
245 Ga0395901_0211052 3300038443 Bacteria 2032
246 Ga0395901_0305415 3300038443 Bacteria 1649
247 Ga0395901_0362946 3300038443 Bacteria 1493
248 Ga0395901_0729913 3300038443 Bacteria 985
249 Ga0436365_0077150 3300039437 Bacteria 809
250 Ga0436362_0698933 3300039453 Bacteria 1119
251 Ga0439439_0000087 3300041406 Bacteria 12039
252 Ga0439431_0026876 3300041997 Bacteria 1412
253 Ga0439455_0051506 3300042012 Bacteria 1076
254 Ga0439446_0002187 3300042156 Bacteria 4658
255 Ga0450916_007529 3300042530 Bacteria 1310
256 Ga0439440_0010081 3300042993 Bacteria 1967
257 Ga0466961_0050870 3300044693 Bacteria 2646
258 Ga0466963_0038060 3300044694 Bacteria 3144
259 Ga0466964_0063368 3300044706 Bacteria 1544
260 Ga0466964_0070245 3300044706 Bacteria 1479
261 Ga0466964_0088938 3300044706 Bacteria 1341
262 Ga0466957_0006289 3300044842 Bacteria 6700
263 Ga0466957_0063491 3300044842 Bacteria 2270
264 Ga0466960_0044102 3300044901 Bacteria 2125
265 Ga0466967_0017504 3300045976 Bacteria 5693
266 Ga0466967_0051162 3300045976 Bacteria 3619
267 Ga0466967_0125063 3300045976 Bacteria 2381
268 Ga0495603_0221964 3300046455 Unclassified 1090
269 Ga0495582_0024080 3300046473 Bacteria 3329
270 Ga0495639_0039289 3300046475 Bacteria 2128
271 Ga0495584_0084360 3300046491 Bacteria 1600
272 Ga0495596_0106732 3300046500 Bacteria 1088
273 Ga0495618_0017170 3300046514 Bacteria 4436
274 Ga0495631_0042884 3300046518 Bacteria 1998
275 Ga0495644_0022440 3300046523 Bacteria 2406
276 Ga0495666_0094674 3300046526 Bacteria 1409
277 Ga0495642_0008506 3300046528 Bacteria 3927
278 Ga0495665_0053967 3300046531 Bacteria 2124
279 Ga0495656_0143936 3300046615 Bacteria 1146
280 Ga0495670_0070165 3300046691 Bacteria 1773
281 Ga0495589_0136135 3300046794 Bacteria 1178
282 Ga0495581_0028900 3300047315 Bacteria 3215
283 Ga0495581_0041631 3300047315 Bacteria 2659
284 Ga0495581_0058857 3300047315 Bacteria 2219
285 Ga0495676_0014280 3300047321 Bacteria 7107
286 Ga0495676_0044963 3300047321 Bacteria 3599
287 Ga0495676_0127876 3300047321 Bacteria 1839
288 Ga0495680_0007877 3300047322 Bacteria 9723
289 Ga0496100_0025846 3300048903 Bacteria 3593
290 Ga0496100_0032844 3300048903 Bacteria 3241
291 Ga0496101_0028710 3300048904 Bacteria 3886
292 Ga0496102_0007848 3300048905 Bacteria 9118
293 Ga0496102_0034776 3300048905 Bacteria 4534
294 Ga0496102_0203964 3300048905 Bacteria 1864
295 Ga0496103_0002837 3300048906 Bacteria 10781
296 Ga0496103_0193334 3300048906 Bacteria 1308
297 Ga0496104_0009213 3300048907 Bacteria 8775
298 Ga0496104_0052144 3300048907 Bacteria 3863
299 Ga0496104_0308071 3300048907 Bacteria 1496
300 Ga0496104_0553116 3300048907 Bacteria 1062
301 Ga0496105_0005643 3300048908 Bacteria 9525
302 Ga0496105_0020802 3300048908 Bacteria 5305
303 Ga0496105_0089869 3300048908 Bacteria 2537
304 Ga0496105_0243653 3300048908 Bacteria 1458
305 Ga0496106_0011498 3300048909 Bacteria 6546
306 Ga0496106_0027593 3300048909 Bacteria 4229
307 Ga0496107_0003309 3300048910 Bacteria 10769
308 Ga0496107_0036618 3300048910 Bacteria 3519
309 Ga0496108_0053686 3300048911 Bacteria 3380
310 Ga0496109_0003640 3300048912 Bacteria 12876
311 Ga0496109_0008696 3300048912 Bacteria 8643
312 Ga0496109_0027750 3300048912 Bacteria 5058
313 Ga0496109_0047693 3300048912 Bacteria 3895
314 Ga0496109_0113808 3300048912 Bacteria 2517
315 Ga0496109_0127807 3300048912 Bacteria 2370
316 Ga0496110_0016586 3300048913 Bacteria 6151
317 Ga0496110_0058984 3300048913 Bacteria 3381
318 Ga0496111_0001255 3300048914 Bacteria 14197
319 Ga0496111_0083920 3300048914 Bacteria 2328
320 Ga0496111_0357922 3300048914 Bacteria 1080
321 Ga0496112_0000516 3300048915 Bacteria 26268
322 Ga0496112_0007509 3300048915 Bacteria 9678
323 Ga0496112_0058683 3300048915 Bacteria 3790
324 Ga0496112_0062249 3300048915 Bacteria 3680
325 Ga0496112_0062816 3300048915 Bacteria 3664
326 Ga0496113_0065034 3300048916 Bacteria 2759
327 Ga0496113_0067445 3300048916 Bacteria 2713
328 Ga0496113_0139621 3300048916 Bacteria 1906
329 Ga0496114_0042155 3300048917 Bacteria 3782
330 Ga0496114_0069370 3300048917 Bacteria 2960
331 Ga0496115_0001245 3300048918 Bacteria 18279
332 Ga0496115_0003594 3300048918 Bacteria 11144
333 Ga0501031_0010577 3300049568 Bacteria 6007
334 Ga0501033_0031360 3300049570 Bacteria 3994
335 Ga0501036_0009805 3300049572 Bacteria 7887
336 Ga0501036_0068281 3300049572 Bacteria 3008
337 Ga0501038_0047775 3300049574 Bacteria 3707
338 Ga0501039_0016124 3300049575 Bacteria 5723
339 Ga0501039_0062993 3300049575 Bacteria 2874
340 Ga0501041_0002215 3300049577 Bacteria 10991
341 Ga0501042_0000569 3300049578 Bacteria 19487
342 Ga0501043_0025584 3300049579 Bacteria 4631
343 Ga0501046_0000847 3300049580 Bacteria 29730
344 Ga0501046_0136732 3300049580 Bacteria 1856
345 Ga0501048_0002895 3300049582 Bacteria 13099
346 Ga0501067_0079613 3300049583 Bacteria 1816
347 Ga0501068_0008656 3300049584 Bacteria 5673
348 Ga0501068_0159220 3300049584 Bacteria 1423
349 Ga0501071_0026589 3300049587 Bacteria 4063
350 Ga0501071_0176316 3300049587 Bacteria 1601
351 Ga0501072_0024168 3300049588 Bacteria 4725
352 Ga0501074_0003034 3300049590 Bacteria 11829
353 Ga0501075_0043489 3300049591 Bacteria 3369
354 Ga0501076_0002238 3300049592 Bacteria 13255
355 Ga0501077_0006514 3300049593 Bacteria 7166
356 Ga0501079_0000241 3300049741 Bacteria 33033
357 Ga0501081_0002090 3300049743 Bacteria 12466
358 Ga0501035_0016441 3300049822 Bacteria 6825
359 Ga0501045_0006655 3300049824 Bacteria 8008
360 nmdc:mga0yw44_240114_c1 3300050492 Bacteria 1204
361 nmdc:mga05p37_10303_c1 3300050507 Bacteria 11100
362 nmdc:mga05p37_19877_c1 3300050507 Bacteria 8124
363 nmdc:mga05p37_2287_c1 3300050507 Bacteria 22335
364 nmdc:mga05p37_696537_c1 3300050507 Bacteria 1129
365 nmdc:mga09592_15845_c1 3300050508 Bacteria 6159
366 nmdc:mga09592_2856_c1 3300050508 Bacteria 14014
367 nmdc:mga0qj67_225229_c1 3300050509 Bacteria 1522
368 nmdc:mga0qj67_33162_c1 3300050509 Bacteria 4029
369 nmdc:mga06r32_81354_c1 3300050510 Bacteria 3154
370 nmdc:mga06r32_84883_c1 3300050510 Bacteria 3087
371 nmdc:mga08y16_11103_c1 3300050511 Bacteria 9458
372 nmdc:mga08y16_16382_c1 3300050511 Bacteria 7793
373 nmdc:mga08y16_2071_c1 3300050511 Bacteria 20559
374 nmdc:mga08y16_258226_c1 3300050511 Bacteria 1800
375 nmdc:mga08y16_488911_c1 3300050511 Bacteria 1252
376 nmdc:mga0n895_281395_c1 3300050512 Bacteria 1687
377 nmdc:mga0rr50_264789_c1 3300050513 Bacteria 1431
378 nmdc:mga0a205_4724_c1 3300050515 Bacteria 12231
379 Ga0500588_0074777 3300053146 Bacteria 1120
380 Ga0501084_0007817 3300054114 Bacteria 8798
381 Ga0501082_0000855 3300060353 Bacteria 26884
382 Ga0466962_0031192 3300061719 Bacteria 2552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0009213 Ga0496104_0009213_2630_3529 209
2 3300048907 Ga0496104_0553116 Ga0496104_0553116_124_1023 209
3 3300048908 Ga0496105_0020802 Ga0496105_0020802_3692_4591 209
4 3300048912 Ga0496109_0047693 Ga0496109_0047693_1911_2810 209
5 3300048914 Ga0496111_0083920 Ga0496111_0083920_977_1876 209
6 3300048915 Ga0496112_0007509 Ga0496112_0007509_7105_8004 209
7 3300005564 Ga0070664_100412592 Ga0070664_1004125922 211
8 3300005435 Ga0070714_100002178 Ga0070714_10000217810 222
9 3300005436 Ga0070713_100065547 Ga0070713_1000655472 222
10 3300005439 Ga0070711_100033319 Ga0070711_1000333192 222
11 3300006028 Ga0070717_10011406 Ga0070717_100114066 222
12 3300025916 Ga0207663_10034434 Ga0207663_100344342 222
13 3300025929 Ga0207664_10037028 Ga0207664_100370283 222
14 3300048917 Ga0496114_0069370 Ga0496114_0069370_1559_2464 222
15 3300048918 Ga0496115_0003594 Ga0496115_0003594_6952_7857 222
16 3300005535 Ga0070684_100136545 Ga0070684_1001365452 224
17 3300014968 Ga0157379_10214942 Ga0157379_102149422 224
18 3300025918 Ga0207662_10042681 Ga0207662_100426814 224
19 3300025942 Ga0207689_10050110 Ga0207689_100501103 224
20 3300025945 Ga0207679_10411822 Ga0207679_104118222 224
21 3300026035 Ga0207703_10575903 Ga0207703_105759031 224
22 3300049584 Ga0501068_0159220 Ga0501068_0159220_160_1017 225
23 3300044842 Ga0466957_0006289 Ga0466957_0006289_4815_5726 234
24 3300048915 Ga0496112_0000516 Ga0496112_0000516_17498_18358 234
25 3300031852 Ga0307410_10001770 Ga0307410_100017703 236
26 3300032002 Ga0307416_100038145 Ga0307416_1000381453 236
27 3300037466 Ga0395898_0355290 Ga0395898_0355290_72_950 236
28 3300037471 Ga0395905_0214500 Ga0395905_0214500_28_906 236
29 3300038443 Ga0395901_0211052 Ga0395901_0211052_421_1299 236
30 3300046500 Ga0495596_0106732 Ga0495596_0106732_127_1005 236
31 3300045976 Ga0466967_0125063 Ga0466967_0125063_540_1397 237
32 3300042530 Ga0450916_007529 Ga0450916_007529_309_1202 242
33 3300005985 Ga0081539_10032347 Ga0081539_100323472 244
34 3300042012 Ga0439455_0051506 Ga0439455_0051506_186_1064 244
35 3300005937 Ga0081455_10051456 Ga0081455_100514562 245
36 3300009094 Ga0111539_10431103 Ga0111539_104311032 245
37 3300050511 nmdc:mga08y16_488911_c1 nmdc:mga08y16_488911_c1_136_1014 245
38 3300037466 Ga0395898_0081976 Ga0395898_0081976_1367_2227 246
39 3300038443 Ga0395901_0180222 Ga0395901_0180222_419_1279 246
40 3300005440 Ga0070705_100260827 Ga0070705_1002608272 248
41 3300005577 Ga0068857_100073095 Ga0068857_1000730952 248
42 3300009094 Ga0111539_10046573 Ga0111539_100465733 248
43 3300009094 Ga0111539_10660676 Ga0111539_106606762 248
44 3300009098 Ga0105245_10089446 Ga0105245_100894464 248
45 3300009553 Ga0105249_10067356 Ga0105249_100673563 248
46 3300014326 Ga0157380_10085265 Ga0157380_100852652 248
47 3300014326 Ga0157380_10306771 Ga0157380_103067711 248
48 3300014745 Ga0157377_10146531 Ga0157377_101465312 248
49 3300026075 Ga0207708_10009644 Ga0207708_100096446 248
50 3300026116 Ga0207674_10132735 Ga0207674_101327352 248
51 3300027876 Ga0209974_10010121 Ga0209974_100101213 248
52 3300027907 Ga0207428_10078022 Ga0207428_100780222 248
53 3300035398 Ga0316574_0076508 Ga0316574_0076508_688_1623 248
54 3300048914 Ga0496111_0357922 Ga0496111_0357922_30_818 248
55 3300050511 nmdc:mga08y16_258226_c1 nmdc:mga08y16_258226_c1_767_1666 248
56 3300003203 JGI25406J46586_10013622 JGI25406J46586_100136222 249
57 3300005338 Ga0068868_100307552 Ga0068868_1003075522 249
58 3300005340 Ga0070689_100429534 Ga0070689_1004295341 249
59 3300005353 Ga0070669_100253792 Ga0070669_1002537922 249
60 3300005356 Ga0070674_100011269 Ga0070674_1000112695 249
61 3300005564 Ga0070664_100382249 Ga0070664_1003822492 249
62 3300005616 Ga0068852_100239566 Ga0068852_1002395662 249
63 3300005719 Ga0068861_100406936 Ga0068861_1004069362 249
64 3300005937 Ga0081455_10041996 Ga0081455_100419962 249
65 3300005981 Ga0081538_10039106 Ga0081538_100391062 249
66 3300005985 Ga0081539_10009480 Ga0081539_100094807 249
67 3300005985 Ga0081539_10062213 Ga0081539_100622132 249
68 3300006844 Ga0075428_100059365 Ga0075428_1000593652 249
69 3300006844 Ga0075428_100164162 Ga0075428_1001641623 249
70 3300006844 Ga0075428_100304979 Ga0075428_1003049792 249
71 3300006844 Ga0075428_100311667 Ga0075428_1003116672 249
72 3300006844 Ga0075428_100496637 Ga0075428_1004966372 249
73 3300006846 Ga0075430_100011923 Ga0075430_1000119234 249
74 3300006847 Ga0075431_100683477 Ga0075431_1006834772 249
75 3300006881 Ga0068865_100507290 Ga0068865_1005072902 249
76 3300009094 Ga0111539_10092076 Ga0111539_100920764 249
77 3300009147 Ga0114129_10005080 Ga0114129_1000508016 249
78 3300009147 Ga0114129_10012797 Ga0114129_100127979 249
79 3300009148 Ga0105243_10573053 Ga0105243_105730532 249
80 3300009177 Ga0105248_10252804 Ga0105248_102528042 249
81 3300009551 Ga0105238_10337343 Ga0105238_103373431 249
82 3300011119 Ga0105246_10021317 Ga0105246_100213174 249
83 3300011119 Ga0105246_10562662 Ga0105246_105626621 249
84 3300013306 Ga0163162_10396219 Ga0163162_103962192 249
85 3300014326 Ga0157380_10034922 Ga0157380_100349224 249
86 3300025923 Ga0207681_10381292 Ga0207681_103812921 249
87 3300025927 Ga0207687_10279896 Ga0207687_102798962 249
88 3300025927 Ga0207687_10500911 Ga0207687_105009112 249
89 3300025932 Ga0207690_10096828 Ga0207690_100968282 249
90 3300025934 Ga0207686_10198952 Ga0207686_101989522 249
91 3300025935 Ga0207709_10077319 Ga0207709_100773192 249
92 3300025937 Ga0207669_10022185 Ga0207669_100221853 249
93 3300025940 Ga0207691_10089876 Ga0207691_100898763 249
94 3300025945 Ga0207679_10169096 Ga0207679_101690962 249
95 3300025972 Ga0207668_10258044 Ga0207668_102580441 249
96 3300025972 Ga0207668_10329486 Ga0207668_103294862 249
97 3300026075 Ga0207708_10003731 Ga0207708_100037318 249
98 3300026089 Ga0207648_10067233 Ga0207648_100672332 249
99 3300026116 Ga0207674_10113468 Ga0207674_101134682 249
100 3300026118 Ga0207675_100363153 Ga0207675_1003631532 249
101 3300026142 Ga0207698_10416126 Ga0207698_104161262 249
102 3300027907 Ga0207428_10175356 Ga0207428_101753561 249
103 3300031548 Ga0307408_100088206 Ga0307408_1000882062 249
104 3300031548 Ga0307408_100376770 Ga0307408_1003767702 249
105 3300031731 Ga0307405_10006036 Ga0307405_100060362 249
106 3300031824 Ga0307413_10007136 Ga0307413_100071362 249
107 3300031824 Ga0307413_10012775 Ga0307413_100127752 249
108 3300031824 Ga0307413_10081167 Ga0307413_100811672 249
109 3300031852 Ga0307410_10012899 Ga0307410_100128994 249
110 3300031852 Ga0307410_10018187 Ga0307410_100181874 249
111 3300031901 Ga0307406_10006277 Ga0307406_100062774 249
112 3300031901 Ga0307406_10077857 Ga0307406_100778573 249
113 3300031903 Ga0307407_10001868 Ga0307407_100018683 249
114 3300031911 Ga0307412_10019577 Ga0307412_100195773 249
115 3300031911 Ga0307412_10203640 Ga0307412_102036402 249
116 3300031911 Ga0307412_10322467 Ga0307412_103224672 249
117 3300031995 Ga0307409_100022092 Ga0307409_1000220923 249
118 3300031995 Ga0307409_100044759 Ga0307409_1000447592 249
119 3300032002 Ga0307416_100036238 Ga0307416_1000362382 249
120 3300032002 Ga0307416_100658959 Ga0307416_1006589592 249
121 3300032004 Ga0307414_10060371 Ga0307414_100603713 249
122 3300032005 Ga0307411_10017553 Ga0307411_100175533 249
123 3300032005 Ga0307411_10018132 Ga0307411_100181324 249
124 3300032005 Ga0307411_10402173 Ga0307411_104021731 249
125 3300032126 Ga0307415_100007998 Ga0307415_1000079983 249
126 3300035170 Ga0373943_0151122 Ga0373943_0151122_131_937 249
127 3300035725 Ga0373947_0036120 Ga0373947_0036120_551_1357 249
128 3300037418 Ga0395900_0346826 Ga0395900_0346826_134_997 249
129 3300037466 Ga0395898_0142229 Ga0395898_0142229_499_1359 249
130 3300037466 Ga0395898_0147196 Ga0395898_0147196_1290_2150 249
131 3300037466 Ga0395898_0185054 Ga0395898_0185054_488_1351 249
132 3300038443 Ga0395901_0038527 Ga0395901_0038527_232_1092 249
133 3300038443 Ga0395901_0113250 Ga0395901_0113250_1601_2467 249
134 3300038443 Ga0395901_0114975 Ga0395901_0114975_1115_2017 249
135 3300038443 Ga0395901_0305415 Ga0395901_0305415_29_892 249
136 3300039437 Ga0436365_0077150 Ga0436365_0077150_19_798 249
137 3300042156 Ga0439446_0002187 Ga0439446_0002187_2252_3154 249
138 3300044693 Ga0466961_0050870 Ga0466961_0050870_1516_2409 249
139 3300044706 Ga0466964_0063368 Ga0466964_0063368_642_1529 249
140 3300044706 Ga0466964_0088938 Ga0466964_0088938_44_832 249
141 3300045976 Ga0466967_0017504 Ga0466967_0017504_4426_5214 249
142 3300046518 Ga0495631_0042884 Ga0495631_0042884_408_1214 249
143 3300046523 Ga0495644_0022440 Ga0495644_0022440_1272_2108 249
144 3300046794 Ga0495589_0136135 Ga0495589_0136135_116_934 249
145 3300047315 Ga0495581_0041631 Ga0495581_0041631_81_887 249
146 3300047321 Ga0495676_0044963 Ga0495676_0044963_203_1009 249
147 3300048905 Ga0496102_0034776 Ga0496102_0034776_2041_2937 249
148 3300048906 Ga0496103_0193334 Ga0496103_0193334_71_967 249
149 3300048907 Ga0496104_0052144 Ga0496104_0052144_415_1203 249
150 3300048908 Ga0496105_0005643 Ga0496105_0005643_7526_8314 249
151 3300048908 Ga0496105_0243653 Ga0496105_0243653_232_1128 249
152 3300048910 Ga0496107_0036618 Ga0496107_0036618_1978_2838 249
153 3300048912 Ga0496109_0003640 Ga0496109_0003640_1940_2836 249
154 3300048912 Ga0496109_0027750 Ga0496109_0027750_4048_4908 249
155 3300048912 Ga0496109_0127807 Ga0496109_0127807_833_1693 249
156 3300048914 Ga0496111_0001255 Ga0496111_0001255_9034_9930 249
157 3300048915 Ga0496112_0058683 Ga0496112_0058683_1422_2282 249
158 3300048915 Ga0496112_0062249 Ga0496112_0062249_2164_3024 249
159 3300048916 Ga0496113_0139621 Ga0496113_0139621_475_1263 249
160 3300049572 Ga0501036_0068281 Ga0501036_0068281_1093_1899 249
161 3300049575 Ga0501039_0062993 Ga0501039_0062993_1387_2193 249
162 3300049580 Ga0501046_0136732 Ga0501046_0136732_311_1117 249
163 3300049583 Ga0501067_0079613 Ga0501067_0079613_178_1035 249
164 3300049587 Ga0501071_0176316 Ga0501071_0176316_262_1068 249
165 3300050492 nmdc:mga0yw44_240114_c1 nmdc:mga0yw44_240114_c1_309_1169 249
166 3300050507 nmdc:mga05p37_10303_c1 nmdc:mga05p37_10303_c1_3030_3836 249
167 3300050507 nmdc:mga05p37_19877_c1 nmdc:mga05p37_19877_c1_6163_6969 249
168 3300050508 nmdc:mga09592_15845_c1 nmdc:mga09592_15845_c1_610_1416 249
169 3300050509 nmdc:mga0qj67_225229_c1 nmdc:mga0qj67_225229_c1_306_1106 249
170 3300050509 nmdc:mga0qj67_33162_c1 nmdc:mga0qj67_33162_c1_486_1286 249
171 3300050510 nmdc:mga06r32_81354_c1 nmdc:mga06r32_81354_c1_967_1767 249
172 3300050510 nmdc:mga06r32_84883_c1 nmdc:mga06r32_84883_c1_2064_2921 249
173 3300050511 nmdc:mga08y16_11103_c1 nmdc:mga08y16_11103_c1_2592_3398 249
174 3300050511 nmdc:mga08y16_16382_c1 nmdc:mga08y16_16382_c1_5136_6014 249
175 3300053146 Ga0500588_0074777 Ga0500588_0074777_132_983 249
176 3300061719 Ga0466962_0031192 Ga0466962_0031192_1279_2166 249
177 3300005983 Ga0081540_1016011 Ga0081540_10160112 250
178 3300005985 Ga0081539_10003259 Ga0081539_100032593 250
179 3300005985 Ga0081539_10007655 Ga0081539_100076556 250
180 3300005985 Ga0081539_10114101 Ga0081539_101141012 250
181 3300006844 Ga0075428_100017672 Ga0075428_1000176725 250
182 3300006846 Ga0075430_100010398 Ga0075430_1000103985 250
183 3300006847 Ga0075431_100005051 Ga0075431_1000050516 250
184 3300006880 Ga0075429_100028628 Ga0075429_1000286283 250
185 3300007076 Ga0075435_100177918 Ga0075435_1001779181 250
186 3300009147 Ga0114129_10160366 Ga0114129_101603663 250
187 3300013307 Ga0157372_10803380 Ga0157372_108033801 250
188 3300025981 Ga0207640_10285259 Ga0207640_102852592 250
189 3300026121 Ga0207683_10447238 Ga0207683_104472381 250
190 3300031731 Ga0307405_10008377 Ga0307405_100083775 250
191 3300037312 Ga0395899_0016344 Ga0395899_0016344_2311_3132 250
192 3300037312 Ga0395899_0177365 Ga0395899_0177365_730_1482 250
193 3300037418 Ga0395900_0006416 Ga0395900_0006416_5260_6165 250
194 3300037418 Ga0395900_0014130 Ga0395900_0014130_1569_2390 250
195 3300037418 Ga0395900_0044306 Ga0395900_0044306_1211_2074 250
196 3300037418 Ga0395900_0613100 Ga0395900_0613100_106_1014 250
197 3300037466 Ga0395898_0011166 Ga0395898_0011166_2923_3828 250
198 3300037466 Ga0395898_0065646 Ga0395898_0065646_2135_2956 250
199 3300037466 Ga0395898_0366197 Ga0395898_0366197_27_869 250
200 3300037471 Ga0395905_0004411 Ga0395905_0004411_7145_8050 250
201 3300037471 Ga0395905_0258907 Ga0395905_0258907_738_1559 250
202 3300038443 Ga0395901_0039766 Ga0395901_0039766_1009_1914 250
203 3300038443 Ga0395901_0081761 Ga0395901_0081761_757_1578 250
204 3300038443 Ga0395901_0362946 Ga0395901_0362946_164_1042 250
205 3300041406 Ga0439439_0000087 Ga0439439_0000087_7803_8711 250
206 3300041997 Ga0439431_0026876 Ga0439431_0026876_507_1289 250
207 3300042993 Ga0439440_0010081 Ga0439440_0010081_947_1825 250
208 3300049568 Ga0501031_0010577 Ga0501031_0010577_1732_2610 250
209 3300049570 Ga0501033_0031360 Ga0501033_0031360_1681_2559 250
210 3300049572 Ga0501036_0009805 Ga0501036_0009805_1436_2314 250
211 3300049574 Ga0501038_0047775 Ga0501038_0047775_1483_2361 250
212 3300049575 Ga0501039_0016124 Ga0501039_0016124_3364_4242 250
213 3300049577 Ga0501041_0002215 Ga0501041_0002215_4538_5416 250
214 3300049578 Ga0501042_0000569 Ga0501042_0000569_12055_12933 250
215 3300049579 Ga0501043_0025584 Ga0501043_0025584_2430_3308 250
216 3300049580 Ga0501046_0000847 Ga0501046_0000847_23256_24134 250
217 3300049582 Ga0501048_0002895 Ga0501048_0002895_192_1070 250
218 3300049584 Ga0501068_0008656 Ga0501068_0008656_387_1265 250
219 3300049587 Ga0501071_0026589 Ga0501071_0026589_1471_2349 250
220 3300049588 Ga0501072_0024168 Ga0501072_0024168_990_1868 250
221 3300049590 Ga0501074_0003034 Ga0501074_0003034_5374_6252 250
222 3300049591 Ga0501075_0043489 Ga0501075_0043489_107_985 250
223 3300049592 Ga0501076_0002238 Ga0501076_0002238_4136_5014 250
224 3300049593 Ga0501077_0006514 Ga0501077_0006514_1584_2462 250
225 3300049741 Ga0501079_0000241 Ga0501079_0000241_12002_12880 250
226 3300049743 Ga0501081_0002090 Ga0501081_0002090_3900_4778 250
227 3300049822 Ga0501035_0016441 Ga0501035_0016441_3815_4693 250
228 3300049824 Ga0501045_0006655 Ga0501045_0006655_1556_2434 250
229 3300050507 nmdc:mga05p37_2287_c1 nmdc:mga05p37_2287_c1_6908_7786 250
230 3300050508 nmdc:mga09592_2856_c1 nmdc:mga09592_2856_c1_9562_10440 250
231 3300050511 nmdc:mga08y16_2071_c1 nmdc:mga08y16_2071_c1_12246_13124 250
232 3300050512 nmdc:mga0n895_281395_c1 nmdc:mga0n895_281395_c1_759_1637 250
233 3300050513 nmdc:mga0rr50_264789_c1 nmdc:mga0rr50_264789_c1_87_965 250
234 3300050515 nmdc:mga0a205_4724_c1 nmdc:mga0a205_4724_c1_7456_8334 250
235 3300054114 Ga0501084_0007817 Ga0501084_0007817_4295_5173 250
236 3300060353 Ga0501082_0000855 Ga0501082_0000855_14061_14939 250
237 3300031995 Ga0307409_100550091 Ga0307409_1005500911 251
238 3300044901 Ga0466960_0044102 Ga0466960_0044102_77_988 251
239 3300046455 Ga0495603_0221964 Ga0495603_0221964_237_1049 251
240 3300046514 Ga0495618_0017170 Ga0495618_0017170_732_1577 251
241 3300047321 Ga0495676_0127876 Ga0495676_0127876_623_1522 251
242 3300025938 Ga0207704_10326570 Ga0207704_103265702 252
243 3300046528 Ga0495642_0008506 Ga0495642_0008506_808_1722 252
244 3300046615 Ga0495656_0143936 Ga0495656_0143936_13_927 252
245 3300046691 Ga0495670_0070165 Ga0495670_0070165_574_1488 252
246 3300005435 Ga0070714_100055585 Ga0070714_1000555851 253
247 3300005435 Ga0070714_100119909 Ga0070714_1001199091 253
248 3300005535 Ga0070684_100019037 Ga0070684_1000190371 253
249 3300005563 Ga0068855_100161109 Ga0068855_1001611092 253
250 3300005577 Ga0068857_100130898 Ga0068857_1001308982 253
251 3300005614 Ga0068856_100533288 Ga0068856_1005332882 253
252 3300025929 Ga0207664_10199721 Ga0207664_101997212 253
253 3300025944 Ga0207661_10108848 Ga0207661_101088482 253
254 3300026078 Ga0207702_10143149 Ga0207702_101431492 253
255 3300026116 Ga0207674_10060151 Ga0207674_100601513 253
256 3300038443 Ga0395901_0729913 Ga0395901_0729913_62_883 253
257 3300039453 Ga0436362_0698933 Ga0436362_0698933_231_1103 253
258 3300044694 Ga0466963_0038060 Ga0466963_0038060_220_1050 253
259 3300044706 Ga0466964_0070245 Ga0466964_0070245_195_1025 253
260 3300044842 Ga0466957_0063491 Ga0466957_0063491_654_1484 253
261 3300045976 Ga0466967_0051162 Ga0466967_0051162_408_1238 253
262 3300046473 Ga0495582_0024080 Ga0495582_0024080_1218_2042 253
263 3300047315 Ga0495581_0058857 Ga0495581_0058857_1203_2027 253
264 3300047321 Ga0495676_0014280 Ga0495676_0014280_3605_4429 253
265 3300047322 Ga0495680_0007877 Ga0495680_0007877_6600_7430 253
266 3300048903 Ga0496100_0032844 Ga0496100_0032844_867_1772 253
267 3300048905 Ga0496102_0203964 Ga0496102_0203964_422_1327 253
268 3300048907 Ga0496104_0308071 Ga0496104_0308071_44_949 253
269 3300048908 Ga0496105_0089869 Ga0496105_0089869_960_1865 253
270 3300048909 Ga0496106_0011498 Ga0496106_0011498_3143_4048 253
271 3300048912 Ga0496109_0113808 Ga0496109_0113808_371_1291 253
272 3300048913 Ga0496110_0016586 Ga0496110_0016586_1609_2514 253
273 3300048913 Ga0496110_0058984 Ga0496110_0058984_408_1328 253
274 3300048916 Ga0496113_0065034 Ga0496113_0065034_558_1463 253
275 3300048916 Ga0496113_0067445 Ga0496113_0067445_1049_1969 253
276 3300002077 JGI24744J21845_10001083 JGI24744J21845_100010834 254
277 3300005330 Ga0070690_100069323 Ga0070690_1000693232 254
278 3300005334 Ga0068869_100175278 Ga0068869_1001752781 254
279 3300005336 Ga0070680_100014269 Ga0070680_1000142694 254
280 3300005337 Ga0070682_100019983 Ga0070682_1000199833 254
281 3300005338 Ga0068868_100118556 Ga0068868_1001185562 254
282 3300005340 Ga0070689_100015062 Ga0070689_1000150625 254
283 3300005347 Ga0070668_100057581 Ga0070668_1000575812 254
284 3300005353 Ga0070669_100432332 Ga0070669_1004323321 254
285 3300005356 Ga0070674_100002235 Ga0070674_10000223512 254
286 3300005365 Ga0070688_100011167 Ga0070688_1000111674 254
287 3300005367 Ga0070667_100147557 Ga0070667_1001475572 254
288 3300005438 Ga0070701_10004998 Ga0070701_100049982 254
289 3300005439 Ga0070711_100008633 Ga0070711_1000086335 254
290 3300005441 Ga0070700_100002344 Ga0070700_1000023443 254
291 3300005444 Ga0070694_100082119 Ga0070694_1000821193 254
292 3300005455 Ga0070663_100047380 Ga0070663_1000473803 254
293 3300005456 Ga0070678_100000442 Ga0070678_1000004429 254
294 3300005459 Ga0068867_100037240 Ga0068867_1000372403 254
295 3300005466 Ga0070685_10029126 Ga0070685_100291262 254
296 3300005471 Ga0070698_100003022 Ga0070698_10000302217 254
297 3300005539 Ga0068853_100008817 Ga0068853_1000088173 254
298 3300005544 Ga0070686_100002207 Ga0070686_1000022076 254
299 3300005545 Ga0070695_100063308 Ga0070695_1000633082 254
300 3300005546 Ga0070696_100001559 Ga0070696_1000015597 254
301 3300005563 Ga0068855_100237460 Ga0068855_1002374602 254
302 3300005614 Ga0068856_100005584 Ga0068856_1000055844 254
303 3300005615 Ga0070702_100046068 Ga0070702_1000460683 254
304 3300005616 Ga0068852_100013729 Ga0068852_1000137294 254
305 3300005718 Ga0068866_10003564 Ga0068866_100035643 254
306 3300006175 Ga0070712_100008690 Ga0070712_1000086905 254
307 3300006358 Ga0068871_100051941 Ga0068871_1000519413 254
308 3300006881 Ga0068865_100017941 Ga0068865_1000179413 254
309 3300009098 Ga0105245_10087915 Ga0105245_100879153 254
310 3300009098 Ga0105245_10261170 Ga0105245_102611702 254
311 3300009148 Ga0105243_10009361 Ga0105243_100093616 254
312 3300009177 Ga0105248_10050690 Ga0105248_100506903 254
313 3300009545 Ga0105237_10167994 Ga0105237_101679942 254
314 3300009551 Ga0105238_10066546 Ga0105238_100665463 254
315 3300009553 Ga0105249_10000948 Ga0105249_1000094814 254
316 3300010375 Ga0105239_10007386 Ga0105239_100073863 254
317 3300011119 Ga0105246_10068712 Ga0105246_100687122 254
318 3300013296 Ga0157374_10193237 Ga0157374_101932373 254
319 3300013296 Ga0157374_10413201 Ga0157374_104132012 254
320 3300013297 Ga0157378_10004893 Ga0157378_1000489312 254
321 3300013306 Ga0163162_10052689 Ga0163162_100526893 254
322 3300013308 Ga0157375_10462549 Ga0157375_104625492 254
323 3300013308 Ga0157375_10727299 Ga0157375_107272992 254
324 3300014326 Ga0157380_10009040 Ga0157380_100090402 254
325 3300014969 Ga0157376_10128891 Ga0157376_101288912 254
326 3300025885 Ga0207653_10039211 Ga0207653_100392112 254
327 3300025898 Ga0207692_10039436 Ga0207692_100394363 254
328 3300025899 Ga0207642_10004054 Ga0207642_100040544 254
329 3300025911 Ga0207654_10017912 Ga0207654_100179123 254
330 3300025915 Ga0207693_10004453 Ga0207693_1000445310 254
331 3300025916 Ga0207663_10043411 Ga0207663_100434113 254
332 3300025917 Ga0207660_10035744 Ga0207660_100357443 254
333 3300025919 Ga0207657_10026182 Ga0207657_100261825 254
334 3300025923 Ga0207681_10283516 Ga0207681_102835162 254
335 3300025927 Ga0207687_10033479 Ga0207687_100334793 254
336 3300025933 Ga0207706_10165849 Ga0207706_101658492 254
337 3300025934 Ga0207686_10015316 Ga0207686_100153163 254
338 3300025935 Ga0207709_10002743 Ga0207709_100027436 254
339 3300025937 Ga0207669_10015057 Ga0207669_100150573 254
340 3300025938 Ga0207704_10015156 Ga0207704_100151563 254
341 3300025940 Ga0207691_10071578 Ga0207691_100715783 254
342 3300025941 Ga0207711_10043626 Ga0207711_100436262 254
343 3300025942 Ga0207689_10103796 Ga0207689_101037962 254
344 3300025949 Ga0207667_10304034 Ga0207667_103040342 254
345 3300025961 Ga0207712_10010539 Ga0207712_100105393 254
346 3300025972 Ga0207668_10005172 Ga0207668_100051725 254
347 3300025981 Ga0207640_10211095 Ga0207640_102110952 254
348 3300025986 Ga0207658_10113159 Ga0207658_101131592 254
349 3300026041 Ga0207639_10054189 Ga0207639_100541892 254
350 3300026067 Ga0207678_10014467 Ga0207678_100144672 254
351 3300026075 Ga0207708_10000564 Ga0207708_100005643 254
352 3300026078 Ga0207702_10041583 Ga0207702_100415833 254
353 3300026089 Ga0207648_10001096 Ga0207648_1000109617 254
354 3300026121 Ga0207683_10000251 Ga0207683_1000025136 254
355 3300026142 Ga0207698_10039073 Ga0207698_100390732 254
356 3300028381 Ga0268264_10262502 Ga0268264_102625022 254
357 3300037312 Ga0395899_0052975 Ga0395899_0052975_365_1228 254
358 3300037418 Ga0395900_0058178 Ga0395900_0058178_449_1312 254
359 3300037418 Ga0395900_0201645 Ga0395900_0201645_985_1926 254
360 3300037418 Ga0395900_0798140 Ga0395900_0798140_48_842 254
361 3300037466 Ga0395898_0006779 Ga0395898_0006779_4230_5093 254
362 3300037471 Ga0395905_0012731 Ga0395905_0012731_6136_6999 254
363 3300037471 Ga0395905_0056496 Ga0395905_0056496_1762_2703 254
364 3300038443 Ga0395901_0048180 Ga0395901_0048180_1162_2025 254
365 3300038443 Ga0395901_0191976 Ga0395901_0191976_985_1926 254
366 3300046475 Ga0495639_0039289 Ga0495639_0039289_594_1358 254
367 3300046491 Ga0495584_0084360 Ga0495584_0084360_371_1135 254
368 3300046526 Ga0495666_0094674 Ga0495666_0094674_28_792 254
369 3300046531 Ga0495665_0053967 Ga0495665_0053967_1217_1981 254
370 3300047315 Ga0495581_0028900 Ga0495581_0028900_952_1845 254
371 3300048903 Ga0496100_0025846 Ga0496100_0025846_1044_1808 254
372 3300048904 Ga0496101_0028710 Ga0496101_0028710_1240_2004 254
373 3300048905 Ga0496102_0007848 Ga0496102_0007848_6211_6975 254
374 3300048906 Ga0496103_0002837 Ga0496103_0002837_7357_8121 254
375 3300048909 Ga0496106_0027593 Ga0496106_0027593_2400_3164 254
376 3300048910 Ga0496107_0003309 Ga0496107_0003309_2764_3528 254
377 3300048911 Ga0496108_0053686 Ga0496108_0053686_227_1015 254
378 3300048912 Ga0496109_0008696 Ga0496109_0008696_3337_4125 254
379 3300048915 Ga0496112_0062816 Ga0496112_0062816_1730_2494 254
380 3300048917 Ga0496114_0042155 Ga0496114_0042155_1883_2647 254
381 3300048918 Ga0496115_0001245 Ga0496115_0001245_6161_6925 254
382 3300050507 nmdc:mga05p37_696537_c1 nmdc:mga05p37_696537_c1_64_1008 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

112

310

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8524 24 244
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8469 5 250
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8363 2 241
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8286 5 241
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.8277 17 241
ID Description Score Start End Superfamily
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9382 2 244 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9307 2 249 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9217 2 244 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9039 2 249 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8993 2 249 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4Q2RC22-F1-model_v4 ABC transporter permease 0.98 2 250 GO:0005886
GO:0055085
AF-A0A535L564-F1-model_v4 ABC transporter permease 0.9762 2 254 GO:0005886
GO:0055085
AF-A0A535PXZ4-F1-model_v4 ABC transporter permease 0.9762 2 215 GO:0005886
GO:0055085
AF-A0A538C588-F1-model_v4 ABC transporter permease 0.9759 2 254 GO:0005886
GO:0055085
AF-A0A535YR96-F1-model_v4 ABC transporter permease 0.9757 2 254 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
87.27 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map