F429252

General Info

Members Datasets Scaffolds Average Seq Length
382 293 764 154

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10011672|Ga0111539_100116728
Length 184
Sequence MPQAAHHCQHGARPNRDLLRRRRLELTNRRNRMTAEEKLAELGLKLPAVPTPVANYVPFKRDGHVIYLSGQGPRKADGGFHLGKVGRDVSVEQAYEHAKLTGLGLLAAAKLAAGNLDKVEVLKVLGMVNGVPEFTDQPKVINGCSDLFVAVLGERGRHARSAVGMGSLPNGMTVEIEAVLRVVE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
181 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
191 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
259 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
260 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
268 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
277 2643221733 Bosea sp. Root381 Isolate Unclassified
278 2643221734 Bosea sp. Root670 Isolate Unclassified
279 2643221736 Bosea sp. Root483D1 Isolate Unclassified
280 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
281 2818991467 Bosea vestrisii 3192 Isolate Unclassified
282 2841760612 Bosea sp. Tri-49 Isolate Nodule
283 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
284 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
285 2842694124 Methylopila sp. R-72369 Isolate Unclassified
286 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
287 2844104063 Bosea sp. Tri-39 Isolate Nodule
288 2851182111 Bosea sp. Tri-44 Isolate Nodule
289 2851246043 Bosea sp. Tri-54 Isolate Nodule
290 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
291 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
292 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
293 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 0
Isolates 4.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 2.09
Rhizoplane 1.31
Rhizosphere 74.08
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10011672 3300009094 Bacteria 11019
2 SwRhRL2b_contig_1807289 2162886007 Bacteria 2431
3 JGI24742J22300_10015835 3300002244 Bacteria 1269
4 JGI24751J29686_10031669 3300002459 Bacteria 1096
5 JGI25159J45721_1002146 3300002987 Bacteria 7695
6 JGI25151J46595_10000022 3300003187 Bacteria 223477
7 JGI25151J46595_10000135 3300003187 Bacteria 98528
8 JGI25151J46595_10036468 3300003187 Bacteria 1855
9 JGI25406J46586_10033345 3300003203 Bacteria 1902
10 rootH1_10000352 3300003316 Bacteria 5866
11 Ga0055526_1000123 3300003771 Bacteria 68503
12 Ga0055524_1000023 3300003775 Bacteria 221408
13 Ga0055524_1018350 3300003775 Bacteria 2433
14 Ga0065165_1000362 3300005262 Bacteria 74503
15 Ga0065704_10076462 3300005289 Bacteria 5109
16 Ga0065707_10239891 3300005295 Bacteria 1159
17 Ga0070658_10016551 3300005327 Bacteria 5900
18 Ga0070676_10083133 3300005328 Bacteria 1947
19 Ga0070690_100115495 3300005330 Bacteria 1796
20 Ga0070677_10015609 3300005333 Bacteria 2691
21 Ga0070666_10303050 3300005335 Bacteria 1138
22 Ga0068868_101011228 3300005338 Bacteria 761
23 Ga0070660_100223476 3300005339 Bacteria 1531
24 Ga0070689_100036846 3300005340 Bacteria 3740
25 Ga0070689_100145504 3300005340 Bacteria 1909
26 Ga0070687_101040355 3300005343 Bacteria 596
27 Ga0070687_101111391 3300005343 Unclassified 579
28 Ga0070661_100187816 3300005344 Bacteria 1575
29 Ga0070669_100221368 3300005353 Bacteria 1496
30 Ga0070675_100246118 3300005354 Bacteria 1563
31 Ga0070675_100655138 3300005354 Bacteria 954
32 Ga0070671_100170624 3300005355 Bacteria 1840
33 Ga0070671_100450279 3300005355 Bacteria 1104
34 Ga0070671_100522765 3300005355 Bacteria 1022
35 Ga0070674_100038488 3300005356 Bacteria 3223
36 Ga0070673_100944041 3300005364 Bacteria 801
37 Ga0070673_101615445 3300005364 Bacteria 613
38 Ga0070688_100119579 3300005365 Bacteria 1763
39 Ga0070709_10030201 3300005434 Bacteria 3249
40 Ga0070714_100025144 3300005435 Bacteria 4912
41 Ga0070713_100582595 3300005436 Bacteria 1062
42 Ga0070710_10652112 3300005437 Bacteria 738
43 Ga0070701_10678967 3300005438 Bacteria 690
44 Ga0070705_100517215 3300005440 Bacteria 909
45 Ga0070700_100049159 3300005441 Bacteria 2617
46 Ga0070694_101850710 3300005444 Bacteria 515
47 Ga0070678_100043246 3300005456 Bacteria 3207
48 Ga0070662_100059804 3300005457 Bacteria 2777
49 Ga0070662_101090557 3300005457 Bacteria 685
50 Ga0068867_100015589 3300005459 Bacteria 5392
51 Ga0070685_10224854 3300005466 Bacteria 1231
52 Ga0070685_11237116 3300005466 Bacteria 568
53 Ga0068853_102400646 3300005539 Bacteria 511
54 Ga0070672_100017954 3300005543 Bacteria 5103
55 Ga0070686_100712290 3300005544 Bacteria 802
56 Ga0070665_100257010 3300005548 Bacteria 1748
57 Ga0070665_100612299 3300005548 Bacteria 1102
58 Ga0070665_100883787 3300005548 Bacteria 906
59 Ga0070664_100180320 3300005564 Bacteria 1877
60 Ga0070664_100582707 3300005564 Bacteria 1036
61 Ga0068857_101008644 3300005577 Bacteria 801
62 Ga0068854_100096944 3300005578 Bacteria 2204
63 Ga0070702_100111677 3300005615 Bacteria 1695
64 Ga0068852_100514238 3300005616 Bacteria 1194
65 Ga0068859_100122350 3300005617 Bacteria 2669
66 Ga0068859_100538370 3300005617 Bacteria 1262
67 Ga0068864_100278192 3300005618 Bacteria 1561
68 Ga0068866_10366422 3300005718 Bacteria 920
69 Ga0068861_100331520 3300005719 Bacteria 1328
70 Ga0068863_101402047 3300005841 Bacteria 706
71 Ga0068858_100586522 3300005842 Bacteria 1081
72 Ga0068860_101830777 3300005843 Bacteria 629
73 Ga0068862_100853454 3300005844 Bacteria 893
74 Ga0081539_10006438 3300005985 Bacteria 11265
75 Ga0081539_10143738 3300005985 Bacteria 1156
76 Ga0075365_10708969 3300006038 Bacteria 711
77 Ga0075365_10750845 3300006038 Bacteria 689
78 Ga0075363_100024984 3300006048 Bacteria 3042
79 Ga0075364_10009492 3300006051 Bacteria 5841
80 Ga0070715_10051395 3300006163 Bacteria 1773
81 Ga0070716_100287252 3300006173 Bacteria 1138
82 Ga0070712_101418660 3300006175 Bacteria 606
83 Ga0075362_10067930 3300006177 Bacteria 1623
84 Ga0075367_10024678 3300006178 Bacteria 3392
85 Ga0075370_10202267 3300006353 Bacteria 1172
86 Ga0075370_10968326 3300006353 Bacteria 521
87 Ga0068871_100220562 3300006358 Bacteria 1643
88 Ga0075428_100004819 3300006844 Bacteria 14967
89 Ga0075428_100149632 3300006844 Bacteria 2536
90 Ga0075430_100066171 3300006846 Bacteria 3035
91 Ga0075431_100003091 3300006847 Bacteria 16116
92 Ga0075431_100323361 3300006847 Bacteria 1555
93 Ga0075429_100010149 3300006880 Bacteria 8158
94 Ga0068865_100100595 3300006881 Bacteria 2116
95 Ga0068865_101691128 3300006881 Bacteria 570
96 Ga0097620_100122346 3300006931 Bacteria 2669
97 Ga0097620_100538392 3300006931 Bacteria 1262
98 Ga0105245_10053042 3300009098 Bacteria 3639
99 Ga0105245_10628605 3300009098 Bacteria 1102
100 Ga0105245_11622415 3300009098 Bacteria 699
101 Ga0105247_10067814 3300009101 Bacteria 2224
102 Ga0114129_10052917 3300009147 Bacteria 5697
103 Ga0105243_10247742 3300009148 Bacteria 1589
104 Ga0105243_10355720 3300009148 Bacteria 1346
105 Ga0105241_11332757 3300009174 Bacteria 685
106 Ga0105248_10718970 3300009177 Bacteria 1127
107 Ga0105248_11835896 3300009177 Unclassified 688
108 Ga0105238_10353900 3300009551 Bacteria 1458
109 Ga0105249_11105396 3300009553 Bacteria 863
110 Ga0105239_10470227 3300010375 Bacteria 1428
111 Ga0157371_10562675 3300013102 Bacteria 846
112 Ga0171462_1009 3300013250 Bacteria 344993
113 Ga0157378_10122963 3300013297 Bacteria 2394
114 Ga0157378_10213607 3300013297 Bacteria 1830
115 Ga0157378_11031400 3300013297 Bacteria 858
116 Ga0163162_11678573 3300013306 Bacteria 725
117 Ga0163163_10156327 3300014325 Bacteria 2325
118 Ga0157380_10055331 3300014326 Bacteria 3151
119 Ga0157380_10930540 3300014326 Bacteria 898
120 Ga0157380_11349527 3300014326 Bacteria 762
121 Ga0182008_10203617 3300014497 Bacteria 1008
122 Ga0157377_10356968 3300014745 Bacteria 983
123 Ga0157376_12010910 3300014969 Bacteria 616
124 Ga0182006_1100476 3300015261 Bacteria 1027
125 Ga0213876_10011842 3300021384 Bacteria 4651
126 Ga0213875_10000033 3300021388 Bacteria 170944
127 Ga0209566_101333 3300025225 Bacteria 7881
128 Ga0209674_100646 3300025226 Bacteria 12599
129 Ga0209673_1044762 3300025273 Bacteria 1223
130 Ga0209130_1000226 3300025284 Bacteria 73970
131 Ga0209675_1001021 3300025291 Bacteria 17511
132 Ga0209676_1026553 3300025292 Bacteria 1837
133 Ga0209025_1000016 3300025294 Bacteria 770739
134 Ga0209025_1000696 3300025294 Bacteria 57362
135 Ga0209025_1015531 3300025294 Bacteria 4581
136 Ga0209025_1035017 3300025294 Bacteria 2278
137 Ga0209564_1000076 3300025295 Bacteria 283602
138 Ga0209256_1000083 3300025299 Bacteria 221460
139 Ga0209256_1000935 3300025299 Bacteria 35510
140 Ga0207426_1006679 3300025302 Bacteria 4956
141 Ga0209257_1065644 3300025304 Bacteria 973
142 Ga0207697_10161946 3300025315 Bacteria 976
143 Ga0207682_10005897 3300025893 Bacteria 4963
144 Ga0207682_10219794 3300025893 Bacteria 878
145 Ga0207642_10291601 3300025899 Bacteria 942
146 Ga0207688_10167348 3300025901 Bacteria 1306
147 Ga0207688_10184777 3300025901 Bacteria 1244
148 Ga0207688_10483099 3300025901 Bacteria 775
149 Ga0207680_10176334 3300025903 Bacteria 1443
150 Ga0207685_10174520 3300025905 Bacteria 992
151 Ga0207645_10296712 3300025907 Bacteria 1076
152 Ga0207643_10243388 3300025908 Bacteria 1106
153 Ga0207643_10254330 3300025908 Bacteria 1083
154 Ga0207705_10034882 3300025909 Bacteria 3598
155 Ga0207654_10742882 3300025911 Bacteria 707
156 Ga0207662_10055718 3300025918 Bacteria 2360
157 Ga0207657_10304152 3300025919 Bacteria 1263
158 Ga0207649_10769626 3300025920 Bacteria 750
159 Ga0207681_10136305 3300025923 Bacteria 1822
160 Ga0207694_10196967 3300025924 Bacteria 1638
161 Ga0207650_10768305 3300025925 Bacteria 816
162 Ga0207659_10131958 3300025926 Bacteria 1929
163 Ga0207659_11460232 3300025926 Bacteria 585
164 Ga0207687_10074165 3300025927 Bacteria 2438
165 Ga0207687_10474331 3300025927 Bacteria 1041
166 Ga0207700_11717381 3300025928 Bacteria 553
167 Ga0207664_10003996 3300025929 Bacteria 9937
168 Ga0207664_10092217 3300025929 Bacteria 2486
169 Ga0207644_10985758 3300025931 Bacteria 707
170 Ga0207690_10521786 3300025932 Bacteria 963
171 Ga0207706_10037141 3300025933 Bacteria 4326
172 Ga0207706_10545460 3300025933 Bacteria 998
173 Ga0207706_10903639 3300025933 Bacteria 746
174 Ga0207686_11191971 3300025934 Bacteria 623
175 Ga0207709_10642957 3300025935 Bacteria 844
176 Ga0207709_10735012 3300025935 Bacteria 792
177 Ga0207670_10200051 3300025936 Bacteria 1517
178 Ga0207670_10208911 3300025936 Bacteria 1487
179 Ga0207669_10005915 3300025937 Bacteria 5537
180 Ga0207704_10204621 3300025938 Bacteria 1448
181 Ga0207665_10268395 3300025939 Bacteria 1266
182 Ga0207665_10370610 3300025939 Bacteria 1085
183 Ga0207691_10002241 3300025940 Bacteria 18944
184 Ga0207711_10157005 3300025941 Bacteria 2057
185 Ga0207711_10166850 3300025941 Bacteria 1996
186 Ga0207711_11700203 3300025941 Bacteria 574
187 Ga0207689_10012551 3300025942 Bacteria 7239
188 Ga0207689_10941235 3300025942 Bacteria 729
189 Ga0207661_11173273 3300025944 Bacteria 707
190 Ga0207679_10093024 3300025945 Bacteria 2337
191 Ga0207651_10688510 3300025960 Bacteria 900
192 Ga0207651_10938211 3300025960 Bacteria 772
193 Ga0207712_10760527 3300025961 Bacteria 849
194 Ga0207712_10945897 3300025961 Bacteria 763
195 Ga0207658_10493990 3300025986 Bacteria 1089
196 Ga0207677_11661946 3300026023 Unclassified 592
197 Ga0207703_10922716 3300026035 Bacteria 836
198 Ga0207678_10728025 3300026067 Bacteria 874
199 Ga0207708_10162391 3300026075 Bacteria 1765
200 Ga0207641_10934917 3300026088 Bacteria 862
201 Ga0207641_11848643 3300026088 Bacteria 606
202 Ga0207648_10030884 3300026089 Bacteria 4740
203 Ga0207676_10054725 3300026095 Bacteria 3128
204 Ga0207674_10019507 3300026116 Bacteria 7343
205 Ga0207674_11471729 3300026116 Bacteria 650
206 Ga0207675_100447432 3300026118 Bacteria 1280
207 Ga0207675_100449038 3300026118 Bacteria 1277
208 Ga0207675_101160388 3300026118 Bacteria 793
209 Ga0207675_101500762 3300026118 Bacteria 695
210 Ga0207683_10002854 3300026121 Bacteria 15066
211 Ga0207683_10460248 3300026121 Bacteria 1173
212 Ga0207428_10067024 3300027907 Bacteria 2827
213 Ga0268266_10133883 3300028379 Bacteria 2219
214 Ga0268266_10574331 3300028379 Bacteria 1082
215 Ga0268266_10799825 3300028379 Bacteria 911
216 Ga0268265_10328981 3300028380 Bacteria 1387
217 Ga0268264_11134118 3300028381 Bacteria 791
218 Ga0265328_10035172 3300031239 Bacteria 1853
219 Ga0265320_10042306 3300031240 Bacteria 2260
220 Ga0265340_10146032 3300031247 Bacteria 1080
221 Ga0265340_10395050 3300031247 Bacteria 610
222 Ga0265331_10017119 3300031250 Bacteria 3788
223 Ga0265327_10032874 3300031251 Bacteria 2900
224 Ga0307513_10320843 3300031456 Bacteria 1307
225 Ga0307509_10711407 3300031507 Bacteria 671
226 Ga0307408_100935242 3300031548 Bacteria 795
227 Ga0265313_10037396 3300031595 Bacteria 2427
228 Ga0265313_10094601 3300031595 Bacteria 1335
229 Ga0265314_10308129 3300031711 Bacteria 886
230 Ga0265342_10067824 3300031712 Bacteria 2086
231 Ga0316576_10888383 3300031727 Bacteria 639
232 Ga0316578_10039857 3300031728 Bacteria 2714
233 Ga0307516_10004794 3300031730 Bacteria 16477
234 Ga0307406_10890281 3300031901 Bacteria 757
235 Ga0307416_100767816 3300032002 Bacteria 1058
236 Ga0373924_0444951 3300035410 Bacteria 581
237 Ga0316584_0039083 3300036712 Bacteria 3532
238 Ga0395900_0089922 3300037418 Bacteria 3156
239 Ga0395905_0145933 3300037471 Bacteria 2226
240 Ga0436364_0533612 3300037853 Bacteria 32668
241 Ga0237819_03570 3300038705 Bacteria 2728
242 Ga0237816_02640 3300039145 Bacteria 1355
243 Ga0436365_0290418 3300039437 Bacteria 2828
244 Ga0436365_0569217 3300039437 Bacteria 977
245 Ga0436365_0840335 3300039437 Bacteria 1374
246 Ga0436365_1326578 3300039437 Bacteria 587
247 Ga0436365_1790400 3300039437 Bacteria 2352
248 Ga0436363_0624761 3300039450 Bacteria 1253
249 Ga0436363_0677134 3300039450 Bacteria 618
250 Ga0436362_0319737 3300039453 Bacteria 550
251 Ga0439465_0206415 3300041413 Bacteria 717
252 Ga0439437_008724 3300042000 Bacteria 1143
253 Ga0439441_004266 3300042001 Bacteria 2157
254 Ga0439443_004978 3300042003 Bacteria 1758
255 Ga0439455_0174480 3300042012 Bacteria 618
256 Ga0450892_009874 3300042130 Bacteria 830
257 Ga0450905_064404 3300042142 Bacteria 617
258 Ga0439459_0062775 3300042438 Bacteria 843
259 Ga0439460_0132733 3300042461 Bacteria 822
260 Ga0466965_0000248 3300044683 Bacteria 17387
261 Ga0466966_0278544 3300044684 Bacteria 1006
262 Ga0466961_0000027 3300044693 Bacteria 89008
263 Ga0466963_0000853 3300044694 Bacteria 15386
264 Ga0466968_0023793 3300044735 Bacteria 2499
265 Ga0466957_0008500 3300044842 Bacteria 5841
266 Ga0466959_0012156 3300045049 Bacteria 6211
267 Ga0495638_0039638 3300046460 Bacteria 2990
268 Ga0495605_0017974 3300046474 Bacteria 3798
269 Ga0495606_0186183 3300046507 Bacteria 1193
270 Ga0495610_0018896 3300046512 Bacteria 3875
271 Ga0495620_0107309 3300046515 Bacteria 1109
272 Ga0495648_0095089 3300046524 Bacteria 1658
273 Ga0495625_0053488 3300046660 Bacteria 2887
274 Ga0495625_0230189 3300046660 Bacteria 1211
275 Ga0495661_0199148 3300046665 Bacteria 1050
276 Ga0495624_0291843 3300046690 Unclassified 984
277 Ga0495660_0148581 3300046810 Bacteria 1159
278 Ga0495683_0406081 3300047323 Unclassified 565
279 Ga0495685_023558 3300047447 Bacteria 2120
280 Ga0495673_0118506 3300047469 Bacteria 1051
281 Ga0495673_0153597 3300047469 Unclassified 888
282 Ga0495615_0106220 3300048090 Bacteria 798
283 Ga0496108_1658610 3300048911 Bacteria 527
284 Ga0496110_0357482 3300048913 Bacteria 1331
285 Ga0496110_0874660 3300048913 Bacteria 804
286 Ga0496113_0382981 3300048916 Bacteria 1129
287 Ga0496117_0074756 3300048920 Bacteria 2254
288 Ga0496122_0050233 3300048925 Bacteria 3182
289 Ga0496122_0268947 3300048925 Bacteria 940
290 Ga0496123_0047615 3300048926 Bacteria 2894
291 Ga0496123_0063267 3300048926 Bacteria 2365
292 Ga0496123_0095806 3300048926 Bacteria 1744
293 Ga0496124_0000790 3300048927 Bacteria 51766
294 Ga0496124_0365149 3300048927 Bacteria 1016
295 Ga0496125_0105701 3300048928 Bacteria 2057
296 Ga0496126_0004304 3300048929 Bacteria 17095
297 Ga0495682_0011723 3300049460 Bacteria 3369
298 Ga0501032_0501296 3300049569 Bacteria 776
299 Ga0501034_0521735 3300049571 Bacteria 1100
300 Ga0501037_0035234 3300049573 Bacteria 3692
301 Ga0501038_0887555 3300049574 Bacteria 659
302 Ga0501039_0442982 3300049575 Bacteria 1020
303 Ga0501040_0212177 3300049576 Bacteria 1377
304 Ga0501040_0381659 3300049576 Bacteria 1011
305 Ga0501040_0744158 3300049576 Bacteria 709
306 Ga0501047_0434906 3300049581 Bacteria 1143
307 Ga0501048_0317492 3300049582 Bacteria 1110
308 Ga0501067_0352383 3300049583 Bacteria 821
309 Ga0501067_0556123 3300049583 Bacteria 643
310 Ga0501070_0378448 3300049586 Bacteria 1147
311 Ga0501072_0002152 3300049588 Bacteria 14714
312 Ga0501072_0169637 3300049588 Bacteria 1742
313 Ga0501072_0488161 3300049588 Bacteria 974
314 Ga0501074_0045320 3300049590 Bacteria 3182
315 Ga0501075_0027272 3300049591 Bacteria 4209
316 Ga0501075_0047514 3300049591 Bacteria 3225
317 Ga0501076_0015018 3300049592 Bacteria 5848
318 Ga0501076_0073302 3300049592 Bacteria 2741
319 Ga0501079_0006109 3300049741 Bacteria 9029
320 Ga0501079_0260495 3300049741 Bacteria 1355
321 Ga0501080_0034733 3300049742 Bacteria 4708
322 Ga0501081_0248902 3300049743 Bacteria 1297
323 Ga0501083_0008772 3300049744 Bacteria 7135
324 Ga0501044_0258790 3300049823 Bacteria 1679
325 Ga0501045_0013993 3300049824 Bacteria 5679
326 Ga0501045_0053435 3300049824 Bacteria 2952
327 nmdc:mga03683_42626_c1 3300050489 Bacteria 1868
328 nmdc:mga0yw44_763704_c1 3300050492 Bacteria 656
329 nmdc:mga0k408_55968_c1 3300050493 Bacteria 2288
330 nmdc:mga06z11_16925_c2 3300050494 Bacteria 2817
331 nmdc:mga05p37_51726_c1 3300050507 Bacteria 5051
332 nmdc:mga09592_173098_c1 3300050508 Bacteria 1867
333 nmdc:mga09592_559671_c1 3300050508 Bacteria 982
334 nmdc:mga0qj67_161254_c1 3300050509 Bacteria 852
335 nmdc:mga0qj67_97451_c1 3300050509 Bacteria 2368
336 nmdc:mga06r32_1925_c1 3300050510 Bacteria 18088
337 nmdc:mga08y16_201450_c1 3300050511 Bacteria 2063
338 nmdc:mga08y16_299888_c1 3300050511 Bacteria 1656
339 nmdc:mga0n895_1263410_c1 3300050512 Bacteria 710
340 nmdc:mga0sz30_131859_c1 3300050516 Bacteria 1101
341 Ga0495601_0457438 3300053077 Bacteria 825
342 Ga0495655_0125286 3300053083 Bacteria 786
343 Ga0500646_0113689 3300053090 Bacteria 863
344 Ga0500562_022794 3300053108 Bacteria 1633
345 Ga0500572_065459 3300053111 Unclassified 1113
346 Ga0500607_142166 3300053121 Bacteria 1127
347 Ga0500608_117679 3300053122 Unclassified 1209
348 Ga0500658_0320334 3300053134 Bacteria 713
349 Ga0500559_0039166 3300053136 Bacteria 2061
350 Ga0500564_369989 3300053138 Unclassified 527
351 Ga0500577_0338136 3300053142 Bacteria 658
352 Ga0500588_0379644 3300053146 Bacteria 538
353 Ga0500604_0119123 3300053151 Bacteria 882
354 Ga0500616_0167028 3300053153 Bacteria 1003
355 Ga0500619_115485 3300053154 Bacteria 914
356 Ga0500622_0082152 3300053156 Bacteria 1612
357 Ga0500636_0029503 3300053177 Bacteria 3241
358 Ga0500636_0092046 3300053177 Bacteria 1735
359 Ga0501084_0004742 3300054114 Bacteria 11113
360 Ga0501082_0000032 3300060353 Bacteria 99261
361 Ga0501082_0009623 3300060353 Bacteria 8320
362 Ga0501082_0181229 3300060353 Bacteria 1832
363 Ga0501082_0579535 3300060353 Bacteria 982
364 Ga0530510_0149974 3300061734 Bacteria 1721
365 2599334605 2599185156 Bacteria 5403036
366 2644727779 2643221733 Bacteria 5690728
367 2644733582 2643221734 Bacteria 5365412
368 2644744493 2643221736 Bacteria 6608466
369 2792839156 2791355137 Bacteria 9654227
370 2819717159 2818991467 Bacteria 5893227
371 2841763296 2841760612 Bacteria 6454112
372 2841917218 2841911363 Bacteria 6173697
373 2841922839 2841917233 Bacteria 6173500
374 2842697930 2842694124 Bacteria 4063419
375 2842927335 2842922631 Bacteria 5824079
376 2844108834 2844104063 Bacteria 6440972
377 2851182542 2851182111 Bacteria 6047226
378 2851250941 2851246043 Bacteria 6439203
379 2870076394 2870068957 Bacteria 8925310
380 2917701355 2917699015 Bacteria 7043791
381 2932800839 2932794094 Bacteria 7915132
382 8057534779 8057529695 Bacteria 6306553
383 Ga0111539_10011672
384 SwRhRL2b_contig_1807289
385 JGI24742J22300_10015835
386 JGI24751J29686_10031669
387 JGI25159J45721_1002146
388 JGI25151J46595_10000022
389 JGI25151J46595_10000135
390 JGI25151J46595_10036468
391 JGI25406J46586_10033345
392 rootH1_10000352
393 Ga0055526_1000123
394 Ga0055524_1000023
395 Ga0055524_1018350
396 Ga0065165_1000362
397 Ga0065704_10076462
398 Ga0065707_10239891
399 Ga0070658_10016551
400 Ga0070676_10083133
401 Ga0070690_100115495
402 Ga0070677_10015609
403 Ga0070666_10303050
404 Ga0068868_101011228
405 Ga0070660_100223476
406 Ga0070689_100036846
407 Ga0070689_100145504
408 Ga0070687_101040355
409 Ga0070687_101111391
410 Ga0070661_100187816
411 Ga0070669_100221368
412 Ga0070675_100246118
413 Ga0070675_100655138
414 Ga0070671_100170624
415 Ga0070671_100450279
416 Ga0070671_100522765
417 Ga0070674_100038488
418 Ga0070673_100944041
419 Ga0070673_101615445
420 Ga0070688_100119579
421 Ga0070709_10030201
422 Ga0070714_100025144
423 Ga0070713_100582595
424 Ga0070710_10652112
425 Ga0070701_10678967
426 Ga0070705_100517215
427 Ga0070700_100049159
428 Ga0070694_101850710
429 Ga0070678_100043246
430 Ga0070662_100059804
431 Ga0070662_101090557
432 Ga0068867_100015589
433 Ga0070685_10224854
434 Ga0070685_11237116
435 Ga0068853_102400646
436 Ga0070672_100017954
437 Ga0070686_100712290
438 Ga0070665_100257010
439 Ga0070665_100612299
440 Ga0070665_100883787
441 Ga0070664_100180320
442 Ga0070664_100582707
443 Ga0068857_101008644
444 Ga0068854_100096944
445 Ga0070702_100111677
446 Ga0068852_100514238
447 Ga0068859_100122350
448 Ga0068859_100538370
449 Ga0068864_100278192
450 Ga0068866_10366422
451 Ga0068861_100331520
452 Ga0068863_101402047
453 Ga0068858_100586522
454 Ga0068860_101830777
455 Ga0068862_100853454
456 Ga0081539_10006438
457 Ga0081539_10143738
458 Ga0075365_10708969
459 Ga0075365_10750845
460 Ga0075363_100024984
461 Ga0075364_10009492
462 Ga0070715_10051395
463 Ga0070716_100287252
464 Ga0070712_101418660
465 Ga0075362_10067930
466 Ga0075367_10024678
467 Ga0075370_10202267
468 Ga0075370_10968326
469 Ga0068871_100220562
470 Ga0075428_100004819
471 Ga0075428_100149632
472 Ga0075430_100066171
473 Ga0075431_100003091
474 Ga0075431_100323361
475 Ga0075429_100010149
476 Ga0068865_100100595
477 Ga0068865_101691128
478 Ga0097620_100122346
479 Ga0097620_100538392
480 Ga0105245_10053042
481 Ga0105245_10628605
482 Ga0105245_11622415
483 Ga0105247_10067814
484 Ga0114129_10052917
485 Ga0105243_10247742
486 Ga0105243_10355720
487 Ga0105241_11332757
488 Ga0105248_10718970
489 Ga0105248_11835896
490 Ga0105238_10353900
491 Ga0105249_11105396
492 Ga0105239_10470227
493 Ga0157371_10562675
494 Ga0171462_1009
495 Ga0157378_10122963
496 Ga0157378_10213607
497 Ga0157378_11031400
498 Ga0163162_11678573
499 Ga0163163_10156327
500 Ga0157380_10055331
501 Ga0157380_10930540
502 Ga0157380_11349527
503 Ga0182008_10203617
504 Ga0157377_10356968
505 Ga0157376_12010910
506 Ga0182006_1100476
507 Ga0213876_10011842
508 Ga0213875_10000033
509 Ga0209566_101333
510 Ga0209674_100646
511 Ga0209673_1044762
512 Ga0209130_1000226
513 Ga0209675_1001021
514 Ga0209676_1026553
515 Ga0209025_1000016
516 Ga0209025_1000696
517 Ga0209025_1015531
518 Ga0209025_1035017
519 Ga0209564_1000076
520 Ga0209256_1000083
521 Ga0209256_1000935
522 Ga0207426_1006679
523 Ga0209257_1065644
524 Ga0207697_10161946
525 Ga0207682_10005897
526 Ga0207682_10219794
527 Ga0207642_10291601
528 Ga0207688_10167348
529 Ga0207688_10184777
530 Ga0207688_10483099
531 Ga0207680_10176334
532 Ga0207685_10174520
533 Ga0207645_10296712
534 Ga0207643_10243388
535 Ga0207643_10254330
536 Ga0207705_10034882
537 Ga0207654_10742882
538 Ga0207662_10055718
539 Ga0207657_10304152
540 Ga0207649_10769626
541 Ga0207681_10136305
542 Ga0207694_10196967
543 Ga0207650_10768305
544 Ga0207659_10131958
545 Ga0207659_11460232
546 Ga0207687_10074165
547 Ga0207687_10474331
548 Ga0207700_11717381
549 Ga0207664_10003996
550 Ga0207664_10092217
551 Ga0207644_10985758
552 Ga0207690_10521786
553 Ga0207706_10037141
554 Ga0207706_10545460
555 Ga0207706_10903639
556 Ga0207686_11191971
557 Ga0207709_10642957
558 Ga0207709_10735012
559 Ga0207670_10200051
560 Ga0207670_10208911
561 Ga0207669_10005915
562 Ga0207704_10204621
563 Ga0207665_10268395
564 Ga0207665_10370610
565 Ga0207691_10002241
566 Ga0207711_10157005
567 Ga0207711_10166850
568 Ga0207711_11700203
569 Ga0207689_10012551
570 Ga0207689_10941235
571 Ga0207661_11173273
572 Ga0207679_10093024
573 Ga0207651_10688510
574 Ga0207651_10938211
575 Ga0207712_10760527
576 Ga0207712_10945897
577 Ga0207658_10493990
578 Ga0207677_11661946
579 Ga0207703_10922716
580 Ga0207678_10728025
581 Ga0207708_10162391
582 Ga0207641_10934917
583 Ga0207641_11848643
584 Ga0207648_10030884
585 Ga0207676_10054725
586 Ga0207674_10019507
587 Ga0207674_11471729
588 Ga0207675_100447432
589 Ga0207675_100449038
590 Ga0207675_101160388
591 Ga0207675_101500762
592 Ga0207683_10002854
593 Ga0207683_10460248
594 Ga0207428_10067024
595 Ga0268266_10133883
596 Ga0268266_10574331
597 Ga0268266_10799825
598 Ga0268265_10328981
599 Ga0268264_11134118
600 Ga0265328_10035172
601 Ga0265320_10042306
602 Ga0265340_10146032
603 Ga0265340_10395050
604 Ga0265331_10017119
605 Ga0265327_10032874
606 Ga0307513_10320843
607 Ga0307509_10711407
608 Ga0307408_100935242
609 Ga0265313_10037396
610 Ga0265313_10094601
611 Ga0265314_10308129
612 Ga0265342_10067824
613 Ga0316576_10888383
614 Ga0316578_10039857
615 Ga0307516_10004794
616 Ga0307406_10890281
617 Ga0307416_100767816
618 Ga0373924_0444951
619 Ga0316584_0039083
620 Ga0395900_0089922
621 Ga0395905_0145933
622 Ga0436364_0533612
623 Ga0237819_03570
624 Ga0237816_02640
625 Ga0436365_0290418
626 Ga0436365_0569217
627 Ga0436365_0840335
628 Ga0436365_1326578
629 Ga0436365_1790400
630 Ga0436363_0624761
631 Ga0436363_0677134
632 Ga0436362_0319737
633 Ga0439465_0206415
634 Ga0439437_008724
635 Ga0439441_004266
636 Ga0439443_004978
637 Ga0439455_0174480
638 Ga0450892_009874
639 Ga0450905_064404
640 Ga0439459_0062775
641 Ga0439460_0132733
642 Ga0466965_0000248
643 Ga0466966_0278544
644 Ga0466961_0000027
645 Ga0466963_0000853
646 Ga0466968_0023793
647 Ga0466957_0008500
648 Ga0466959_0012156
649 Ga0495638_0039638
650 Ga0495605_0017974
651 Ga0495606_0186183
652 Ga0495610_0018896
653 Ga0495620_0107309
654 Ga0495648_0095089
655 Ga0495625_0053488
656 Ga0495625_0230189
657 Ga0495661_0199148
658 Ga0495624_0291843
659 Ga0495660_0148581
660 Ga0495683_0406081
661 Ga0495685_023558
662 Ga0495673_0118506
663 Ga0495673_0153597
664 Ga0495615_0106220
665 Ga0496108_1658610
666 Ga0496110_0357482
667 Ga0496110_0874660
668 Ga0496113_0382981
669 Ga0496117_0074756
670 Ga0496122_0050233
671 Ga0496122_0268947
672 Ga0496123_0047615
673 Ga0496123_0063267
674 Ga0496123_0095806
675 Ga0496124_0000790
676 Ga0496124_0365149
677 Ga0496125_0105701
678 Ga0496126_0004304
679 Ga0495682_0011723
680 Ga0501032_0501296
681 Ga0501034_0521735
682 Ga0501037_0035234
683 Ga0501038_0887555
684 Ga0501039_0442982
685 Ga0501040_0212177
686 Ga0501040_0381659
687 Ga0501040_0744158
688 Ga0501047_0434906
689 Ga0501048_0317492
690 Ga0501067_0352383
691 Ga0501067_0556123
692 Ga0501070_0378448
693 Ga0501072_0002152
694 Ga0501072_0169637
695 Ga0501072_0488161
696 Ga0501074_0045320
697 Ga0501075_0027272
698 Ga0501075_0047514
699 Ga0501076_0015018
700 Ga0501076_0073302
701 Ga0501079_0006109
702 Ga0501079_0260495
703 Ga0501080_0034733
704 Ga0501081_0248902
705 Ga0501083_0008772
706 Ga0501044_0258790
707 Ga0501045_0013993
708 Ga0501045_0053435
709 nmdc:mga03683_42626_c1
710 nmdc:mga0yw44_763704_c1
711 nmdc:mga0k408_55968_c1
712 nmdc:mga06z11_16925_c2
713 nmdc:mga05p37_51726_c1
714 nmdc:mga09592_173098_c1
715 nmdc:mga09592_559671_c1
716 nmdc:mga0qj67_161254_c1
717 nmdc:mga0qj67_97451_c1
718 nmdc:mga06r32_1925_c1
719 nmdc:mga08y16_201450_c1
720 nmdc:mga08y16_299888_c1
721 nmdc:mga0n895_1263410_c1
722 nmdc:mga0sz30_131859_c1
723 Ga0495601_0457438
724 Ga0495655_0125286
725 Ga0500646_0113689
726 Ga0500562_022794
727 Ga0500572_065459
728 Ga0500607_142166
729 Ga0500608_117679
730 Ga0500658_0320334
731 Ga0500559_0039166
732 Ga0500564_369989
733 Ga0500577_0338136
734 Ga0500588_0379644
735 Ga0500604_0119123
736 Ga0500616_0167028
737 Ga0500619_115485
738 Ga0500622_0082152
739 Ga0500636_0029503
740 Ga0500636_0092046
741 Ga0501084_0004742
742 Ga0501082_0000032
743 Ga0501082_0009623
744 Ga0501082_0181229
745 Ga0501082_0579535
746 Ga0530510_0149974
747 2599334605
748 2644727779
749 2644733582
750 2644744493
751 2792839156
752 2819717159
753 2841763296
754 2841917218
755 2841922839
756 2842697930
757 2842927335
758 2844108834
759 2851182542
760 2851250941
761 2870076394
762 2917701355
763 2932800839
764 8057534779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14588

YjgF_endoribonc

YjgF/chorismate_mutase-like, putative endoribonuclease

36

174

0.93

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

47

182

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otm-assembly1.cif.gz_C crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution 0.9379 1 150
3d01-assembly1.cif.gz_K error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9268 2 153
2otm-assembly1.cif.gz_C crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution 0.926 1 150
3d01-assembly2.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9236 2 152
3d01-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9228 2 152
ID Description Score Start End Superfamily
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.95 1 150 3.30.1330.40
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.947 2 152 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9379 1 150 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.937 1 150 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.925 1 150 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A382K155-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 1.002 59 151
AF-A0A528AS19-F1-model_v4 RidA family protein 0.9984 59 153
AF-A0A4Q3I1J2-F1-model_v4 deleted 0.9962 59 152
AF-A0A847ZXD2-F1-model_v4 RidA family protein 0.9955 59 152
AF-X1SC61-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.995 60 153

Map