F429204

General Info

Members Datasets Scaffolds Average Seq Length
382 164 764 116

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100000002|Ga0070706_10000000213
Length 136
Sequence VAEVSACRLLRLSAAEALMKRFLPLFALIAVVTVYAHQQKVTISAGFFTGKDYLDMTDTERRAYATGGINGMLVAPFFGAPEENVNWLKTCSAKMSDEQIAAILTRYIRDQPNQLDINLNVITFNAMRDACRKPNP

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
136 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
140 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
141 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
142 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
149 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
150 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
151 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
152 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
153 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.36
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 40.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100000002 3300005467 Bacteria 326510
2 SwRhRL2b_contig_179387 2162886007 Bacteria 1187
3 MBSR1b_contig_11671856 2162886012 Bacteria 820
4 CNBas_1000976 3300000531 Eukaryota 1431
5 JGI24749J21850_1004511 3300002076 Unclassified 1946
6 rootL2_10019355 3300003322 Bacteria 2157
7 Ga0065714_10002463 3300005288 Bacteria 17608
8 Ga0065714_10196450 3300005288 Unclassified 888
9 Ga0065712_10000246 3300005290 Bacteria 22122
10 Ga0065712_10007253 3300005290 Bacteria 2989
11 Ga0065712_10008834 3300005290 Bacteria 2143
12 Ga0065715_10005309 3300005293 Bacteria 5940
13 Ga0065715_10097920 3300005293 Unclassified 3577
14 Ga0065715_10099434 3300005293 Bacteria 3413
15 Ga0065715_10143864 3300005293 Bacteria 1811
16 Ga0065715_10219885 3300005293 Bacteria 1276
17 Ga0065715_10362382 3300005293 Unclassified 900
18 Ga0065715_10488679 3300005293 Bacteria 790
19 Ga0065707_10088039 3300005295 Bacteria 4798
20 Ga0065707_10850180 3300005295 Unclassified 582
21 Ga0065707_10997242 3300005295 Unclassified 540
22 Ga0068869_100136155 3300005334 Bacteria 1893
23 Ga0068869_100168712 3300005334 Bacteria 1708
24 Ga0070680_101696340 3300005336 Unclassified 548
25 Ga0070660_101567065 3300005339 Bacteria 560
26 Ga0070689_100000141 3300005340 Bacteria 41617
27 Ga0070689_100830009 3300005340 Bacteria 814
28 Ga0070689_101721456 3300005340 Unclassified 571
29 Ga0070687_100287020 3300005343 Bacteria 1038
30 Ga0070692_10036317 3300005345 Unclassified 2500
31 Ga0070692_10082431 3300005345 Bacteria 1734
32 Ga0070692_10290343 3300005345 Bacteria 995
33 Ga0070673_100159871 3300005364 Unclassified 1915
34 Ga0070673_100164902 3300005364 Unclassified 1887
35 Ga0070673_101950273 3300005364 Unclassified 557
36 Ga0070688_100679524 3300005365 Bacteria 795
37 Ga0070659_100892614 3300005366 Bacteria 776
38 Ga0070701_10015795 3300005438 Unclassified 3495
39 Ga0070705_100034180 3300005440 Unclassified 2840
40 Ga0070700_100268166 3300005441 Bacteria 1232
41 Ga0070694_100011486 3300005444 Bacteria 5486
42 Ga0070694_100087610 3300005444 Bacteria 2178
43 Ga0070694_100270199 3300005444 Bacteria 1293
44 Ga0070694_100615060 3300005444 Unclassified 876
45 Ga0070708_100201359 3300005445 Unclassified 1864
46 Ga0070662_101103154 3300005457 Unclassified 681
47 Ga0068867_100174209 3300005459 Bacteria 1706
48 Ga0068867_100596086 3300005459 Unclassified 963
49 Ga0068867_100965421 3300005459 Bacteria 771
50 Ga0070707_100388864 3300005468 Unclassified 1354
51 Ga0070699_100285230 3300005518 Unclassified 1479
52 Ga0070699_100422154 3300005518 Bacteria 1207
53 Ga0068853_100559751 3300005539 Bacteria 1084
54 Ga0070672_100524955 3300005543 Bacteria 1026
55 Ga0070695_100060009 3300005545 Bacteria 2464
56 Ga0070695_100065860 3300005545 Bacteria 2360
57 Ga0070695_100326944 3300005545 Bacteria 1142
58 Ga0070696_100110070 3300005546 Bacteria 1983
59 Ga0070696_100364781 3300005546 Bacteria 1122
60 Ga0070696_101406210 3300005546 Unclassified 595
61 Ga0070693_100007998 3300005547 Bacteria 5190
62 Ga0070693_100072197 3300005547 Bacteria 2035
63 Ga0070693_100272767 3300005547 Unclassified 1130
64 Ga0070704_100153835 3300005549 Unclassified 1811
65 Ga0070704_100191160 3300005549 Unclassified 1646
66 Ga0070704_100248384 3300005549 Unclassified 1460
67 Ga0070704_100453205 3300005549 Bacteria 1105
68 Ga0068855_100244964 3300005563 Bacteria 2001
69 Ga0068855_101458866 3300005563 Unclassified 704
70 Ga0070664_100305967 3300005564 Bacteria 1437
71 Ga0070664_101325474 3300005564 Unclassified 680
72 Ga0068857_100114478 3300005577 Bacteria 2425
73 Ga0068857_100147992 3300005577 Bacteria 2126
74 Ga0068857_100282242 3300005577 Bacteria 1528
75 Ga0068854_100053232 3300005578 Bacteria 2906
76 Ga0068854_100621064 3300005578 Unclassified 925
77 Ga0070702_100001261 3300005615 Bacteria 10273
78 Ga0070702_100078143 3300005615 Bacteria 1975
79 Ga0070702_100709164 3300005615 Bacteria 768
80 Ga0070702_100795796 3300005615 Unclassified 731
81 Ga0070702_101021323 3300005615 Unclassified 656
82 Ga0068852_100108284 3300005616 Bacteria 2522
83 Ga0068852_101540719 3300005616 Bacteria 687
84 Ga0068859_100043813 3300005617 Unclassified 4497
85 Ga0068859_100048609 3300005617 Unclassified 4260
86 Ga0068859_100064455 3300005617 Unclassified 3696
87 Ga0068859_100108114 3300005617 Bacteria 2842
88 Ga0068859_100215922 3300005617 Bacteria 2005
89 Ga0068859_100508593 3300005617 Bacteria 1300
90 Ga0068859_100515043 3300005617 Bacteria 1291
91 Ga0068859_100968620 3300005617 Bacteria 933
92 Ga0068859_101601788 3300005617 Unclassified 719
93 Ga0068859_101621060 3300005617 Unclassified 715
94 Ga0068864_100008007 3300005618 Bacteria 8716
95 Ga0068864_100010529 3300005618 Bacteria 7642
96 Ga0068864_100101384 3300005618 Bacteria 2553
97 Ga0068864_100360980 3300005618 Unclassified 1373
98 Ga0068864_100439821 3300005618 Bacteria 1245
99 Ga0068864_101335712 3300005618 Unclassified 718
100 Ga0068861_100218164 3300005719 Unclassified 1610
101 Ga0068861_101239500 3300005719 Bacteria 723
102 Ga0068851_10003006 3300005834 Bacteria 7447
103 Ga0068870_10440326 3300005840 Bacteria 857
104 Ga0068870_10574351 3300005840 Bacteria 762
105 Ga0068863_100023456 3300005841 Bacteria 5892
106 Ga0068863_100256589 3300005841 Bacteria 1689
107 Ga0068863_100365919 3300005841 Bacteria 1406
108 Ga0068863_100372473 3300005841 Bacteria 1394
109 Ga0068863_100408583 3300005841 Bacteria 1329
110 Ga0068863_100608998 3300005841 Bacteria 1081
111 Ga0068863_100672622 3300005841 Bacteria 1028
112 Ga0068863_101190318 3300005841 Unclassified 768
113 Ga0068858_100141899 3300005842 Bacteria 2255
114 Ga0068858_100435869 3300005842 Bacteria 1262
115 Ga0068860_100010459 3300005843 Bacteria 9173
116 Ga0068860_100031812 3300005843 Bacteria 5072
117 Ga0068860_100611327 3300005843 Bacteria 1096
118 Ga0097621_100016293 3300006237 Bacteria 5615
119 Ga0097621_101291653 3300006237 Unclassified 689
120 Ga0097621_101500085 3300006237 Bacteria 640
121 Ga0097621_101651084 3300006237 Unclassified 610
122 Ga0068871_100004753 3300006358 Bacteria 9491
123 Ga0068871_101974431 3300006358 Unclassified 555
124 Ga0075428_100695661 3300006844 Bacteria 1083
125 Ga0075430_100042998 3300006846 Bacteria 3819
126 Ga0075430_100746854 3300006846 Unclassified 806
127 Ga0075431_100298052 3300006847 Bacteria 1629
128 Ga0075431_100442928 3300006847 Unclassified 1295
129 Ga0075431_100773411 3300006847 Unclassified 934
130 Ga0075433_10032937 3300006852 Bacteria 4440
131 Ga0075433_10036371 3300006852 Bacteria 4241
132 Ga0075433_10160733 3300006852 Bacteria 1999
133 Ga0075433_10200788 3300006852 Bacteria 1773
134 Ga0075433_10468773 3300006852 Bacteria 1109
135 Ga0075433_11502786 3300006852 Unclassified 582
136 Ga0075434_100038740 3300006871 Bacteria 4722
137 Ga0075434_100127119 3300006871 Bacteria 2566
138 Ga0075434_100271601 3300006871 Unclassified 1715
139 Ga0075434_100602307 3300006871 Bacteria 1118
140 Ga0075429_100020828 3300006880 Bacteria 5690
141 Ga0075429_100198500 3300006880 Bacteria 1757
142 Ga0075429_100237480 3300006880 Bacteria 1596
143 Ga0075429_100690659 3300006880 Unclassified 894
144 Ga0097620_100043812 3300006931 Unclassified 4497
145 Ga0097620_100048607 3300006931 Unclassified 4260
146 Ga0097620_100064456 3300006931 Unclassified 3696
147 Ga0097620_100108115 3300006931 Bacteria 2842
148 Ga0097620_100215918 3300006931 Bacteria 2005
149 Ga0097620_100508585 3300006931 Bacteria 1300
150 Ga0097620_100515037 3300006931 Bacteria 1291
151 Ga0097620_100582097 3300006931 Bacteria 1213
152 Ga0097620_100968585 3300006931 Bacteria 933
153 Ga0097620_101601493 3300006931 Unclassified 719
154 Ga0097620_101621034 3300006931 Unclassified 715
155 Ga0075435_100012481 3300007076 Bacteria 6295
156 Ga0111539_10099490 3300009094 Unclassified 3415
157 Ga0111539_10438453 3300009094 Bacteria 1521
158 Ga0111539_11610026 3300009094 Unclassified 753
159 Ga0105245_11791914 3300009098 Unclassified 667
160 Ga0105245_11947925 3300009098 Unclassified 641
161 Ga0105247_10005479 3300009101 Bacteria 7994
162 Ga0105247_10064680 3300009101 Bacteria 2273
163 Ga0105247_10751825 3300009101 Bacteria 739
164 Ga0105247_11733950 3300009101 Unclassified 517
165 Ga0114129_10026128 3300009147 Bacteria 8268
166 Ga0114129_10192068 3300009147 Bacteria 2772
167 Ga0114129_10206234 3300009147 Bacteria 2659
168 Ga0114129_10206905 3300009147 Bacteria 2655
169 Ga0114129_10423064 3300009147 Unclassified 1752
170 Ga0114129_10560779 3300009147 Unclassified 1484
171 Ga0114129_11628223 3300009147 Unclassified 790
172 Ga0105243_10029801 3300009148 Bacteria 4199
173 Ga0105243_10866196 3300009148 Unclassified 896
174 Ga0105243_11699457 3300009148 Unclassified 660
175 Ga0105241_10114079 3300009174 Bacteria 2167
176 Ga0105241_10155784 3300009174 Bacteria 1873
177 Ga0105241_10791312 3300009174 Unclassified 873
178 Ga0105241_11090180 3300009174 Unclassified 751
179 Ga0105241_11902845 3300009174 Unclassified 583
180 Ga0105241_12114616 3300009174 Unclassified 556
181 Ga0105241_12439678 3300009174 Unclassified 523
182 Ga0105242_10950482 3300009176 Unclassified 863
183 Ga0105248_10091753 3300009177 Bacteria 3420
184 Ga0105248_10595901 3300009177 Bacteria 1247
185 Ga0105248_11337448 3300009177 Bacteria 810
186 Ga0105248_11457423 3300009177 Unclassified 775
187 Ga0105237_10001663 3300009545 Bacteria 28782
188 Ga0105237_10321053 3300009545 Unclassified 1552
189 Ga0105249_10198762 3300009553 Bacteria 1961
190 Ga0105249_11356468 3300009553 Bacteria 783
191 Ga0105239_10564108 3300010375 Bacteria 1297
192 Ga0105246_10026429 3300011119 Bacteria 3792
193 Ga0105246_10113831 3300011119 Bacteria 1992
194 Ga0105246_10309855 3300011119 Bacteria 1278
195 Ga0105246_10901773 3300011119 Unclassified 793
196 Ga0105246_11561504 3300011119 Unclassified 622
197 Ga0105246_12544481 3300011119 Unclassified 504
198 Ga0157373_11174720 3300013100 Unclassified 578
199 Ga0157371_11061714 3300013102 Bacteria 620
200 Ga0157378_10240364 3300013297 Bacteria 1729
201 Ga0157378_10342559 3300013297 Bacteria 1458
202 Ga0157378_10962633 3300013297 Unclassified 886
203 Ga0163162_10274762 3300013306 Unclassified 1817
204 Ga0163162_10379510 3300013306 Bacteria 1547
205 Ga0163162_10704168 3300013306 Unclassified 1131
206 Ga0163162_11159936 3300013306 Unclassified 876
207 Ga0163162_11671193 3300013306 Bacteria 727
208 Ga0163162_13360316 3300013306 Unclassified 511
209 Ga0157372_10422235 3300013307 Bacteria 1554
210 Ga0157375_10081492 3300013308 Bacteria 3276
211 Ga0157375_10561531 3300013308 Bacteria 1302
212 Ga0157375_11349820 3300013308 Unclassified 839
213 Ga0157375_12368597 3300013308 Bacteria 633
214 Ga0157375_13309182 3300013308 Unclassified 537
215 Ga0163163_10005282 3300014325 Bacteria 11148
216 Ga0163163_10185355 3300014325 Bacteria 2129
217 Ga0163163_10721348 3300014325 Bacteria 1060
218 Ga0163163_10758149 3300014325 Bacteria 1034
219 Ga0163163_11563238 3300014325 Unclassified 721
220 Ga0157380_10729565 3300014326 Unclassified 1000
221 Ga0157380_10760982 3300014326 Unclassified 981
222 Ga0157379_10006138 3300014968 Bacteria 10346
223 Ga0157379_10048884 3300014968 Bacteria 3776
224 Ga0207656_10001886 3300025321 Bacteria 6977
225 Ga0207653_10005752 3300025885 Unclassified 3866
226 Ga0207710_10001188 3300025900 Bacteria 13212
227 Ga0207710_10356841 3300025900 Unclassified 745
228 Ga0207710_10433829 3300025900 Unclassified 677
229 Ga0207647_10006381 3300025904 Bacteria 8578
230 Ga0207647_10284691 3300025904 Unclassified 943
231 Ga0207647_10326173 3300025904 Bacteria 871
232 Ga0207645_10626186 3300025907 Unclassified 731
233 Ga0207643_10001319 3300025908 Bacteria 14392
234 Ga0207684_10000264 3300025910 Bacteria 77793
235 Ga0207654_10134198 3300025911 Bacteria 1570
236 Ga0207654_10358115 3300025911 Bacteria 1006
237 Ga0207671_10012235 3300025914 Bacteria 6914
238 Ga0207657_10202577 3300025919 Bacteria 1596
239 Ga0207646_10630486 3300025922 Unclassified 961
240 Ga0207650_10780859 3300025925 Unclassified 809
241 Ga0207650_11425530 3300025925 Unclassified 589
242 Ga0207687_11023242 3300025927 Unclassified 709
243 Ga0207690_10034358 3300025932 Bacteria 3267
244 Ga0207709_10019427 3300025935 Bacteria 3821
245 Ga0207709_10378325 3300025935 Bacteria 1077
246 Ga0207709_10567968 3300025935 Unclassified 894
247 Ga0207670_10002254 3300025936 Bacteria 10091
248 Ga0207670_10943742 3300025936 Bacteria 724
249 Ga0207704_11124390 3300025938 Unclassified 668
250 Ga0207711_10140918 3300025941 Bacteria 2169
251 Ga0207711_10766810 3300025941 Unclassified 899
252 Ga0207689_10307023 3300025942 Bacteria 1315
253 Ga0207689_10392827 3300025942 Bacteria 1156
254 Ga0207689_10486245 3300025942 Bacteria 1034
255 Ga0207679_10453087 3300025945 Bacteria 1138
256 Ga0207679_10649799 3300025945 Bacteria 954
257 Ga0207679_11052806 3300025945 Bacteria 746
258 Ga0207667_10202897 3300025949 Bacteria 2034
259 Ga0207651_10042285 3300025960 Unclassified 3032
260 Ga0207651_10791739 3300025960 Bacteria 840
261 Ga0207651_11131701 3300025960 Unclassified 702
262 Ga0207640_11073091 3300025981 Bacteria 711
263 Ga0207703_10236233 3300026035 Bacteria 1641
264 Ga0207703_10661925 3300026035 Unclassified 991
265 Ga0207703_11089142 3300026035 Unclassified 767
266 Ga0207708_10014713 3300026075 Bacteria 5856
267 Ga0207708_10046991 3300026075 Unclassified 3288
268 Ga0207641_10015674 3300026088 Bacteria 6210
269 Ga0207641_10261984 3300026088 Bacteria 1619
270 Ga0207641_10541080 3300026088 Bacteria 1135
271 Ga0207641_10840866 3300026088 Bacteria 909
272 Ga0207641_11017747 3300026088 Unclassified 825
273 Ga0207648_10198791 3300026089 Bacteria 1778
274 Ga0207648_11006771 3300026089 Unclassified 780
275 Ga0207648_11008902 3300026089 Bacteria 780
276 Ga0207676_10005013 3300026095 Bacteria 9380
277 Ga0207676_10006837 3300026095 Bacteria 8077
278 Ga0207676_10154419 3300026095 Bacteria 1981
279 Ga0207676_10319346 3300026095 Bacteria 1425
280 Ga0207676_11127974 3300026095 Unclassified 776
281 Ga0207674_10018488 3300026116 Bacteria 7575
282 Ga0207674_10044052 3300026116 Bacteria 4598
283 Ga0207674_10171697 3300026116 Bacteria 2121
284 Ga0207674_10507716 3300026116 Bacteria 1165
285 Ga0207674_10664673 3300026116 Unclassified 1006
286 Ga0207675_100235230 3300026118 Bacteria 1769
287 Ga0207675_101232579 3300026118 Unclassified 768
288 Ga0207698_10320773 3300026142 Unclassified 1451
289 Ga0207698_10866120 3300026142 Unclassified 909
290 Ga0207698_11414442 3300026142 Unclassified 711
291 Ga0207428_10007675 3300027907 Bacteria 9817
292 Ga0207428_10200701 3300027907 Unclassified 1501
293 Ga0268265_10343177 3300028380 Bacteria 1361
294 Ga0268264_10225002 3300028381 Unclassified 1729
295 Ga0268264_10770796 3300028381 Bacteria 959
296 Ga0268264_12621985 3300028381 Unclassified 508
297 Ga0316178_1115745 3300030735 Bacteria 1066
298 Ga0307405_10056966 3300031731 Bacteria 2453
299 Ga0307413_10183152 3300031824 Bacteria 1496
300 Ga0307406_10371050 3300031901 Bacteria 1125
301 Ga0373940_0182896 3300035088 Bacteria 682
302 Ga0373949_0063977 3300035090 Unclassified 952
303 Ga0373960_0093466 3300035121 Unclassified 965
304 Ga0395899_0804240 3300037312 Unclassified 581
305 Ga0395900_0105060 3300037418 Bacteria 2902
306 Ga0395900_0257426 3300037418 Bacteria 1744
307 Ga0395900_1714901 3300037418 Unclassified 539
308 Ga0395898_0865816 3300037466 Unclassified 842
309 Ga0395898_1039494 3300037466 Bacteria 754
310 Ga0395901_0045351 3300038443 Bacteria 4562
311 Ga0395901_0446235 3300038443 Unclassified 1324
312 Ga0242420_008371 3300038996 Bacteria 1676
313 Ga0439458_0008720 3300042157 Bacteria 2261
314 Ga0451576_0060319 3300045051 Unclassified 3958
315 Ga0451576_0499736 3300045051 Bacteria 1278
316 Ga0495672_0447624 3300047320 Unclassified 583
317 Ga0495672_0487898 3300047320 Unclassified 550
318 Ga0496102_1215145 3300048905 Unclassified 673
319 Ga0496104_1127795 3300048907 Bacteria 688
320 Ga0496106_0450377 3300048909 Unclassified 1034
321 Ga0496107_0031500 3300048910 Bacteria 3785
322 Ga0496107_1090443 3300048910 Unclassified 577
323 Ga0496110_0230651 3300048913 Bacteria 1684
324 Ga0496110_0690592 3300048913 Bacteria 922
325 Ga0496112_0268301 3300048915 Bacteria 1655
326 Ga0496112_1133837 3300048915 Unclassified 700
327 Ga0501291_146976 3300049514 Unclassified 530
328 Ga0501292_030959 3300049515 Unclassified 899
329 Ga0501072_0674177 3300049588 Bacteria 813
330 Ga0501077_0186455 3300049593 Unclassified 1318
331 Ga0501198_001990 3300049649 Bacteria 2716
332 Ga0501209_119359 3300049656 Unclassified 782
333 Ga0501216_116626 3300049660 Unclassified 605
334 Ga0501217_011722 3300049661 Bacteria 1943
335 Ga0501223_032974 3300049663 Bacteria 1007
336 Ga0501223_054086 3300049663 Bacteria 780
337 Ga0501224_012393 3300049664 Bacteria 1256
338 Ga0501227_073230 3300049665 Unclassified 891
339 Ga0501230_035574 3300049667 Unclassified 946
340 Ga0501230_144585 3300049667 Unclassified 537
341 Ga0501233_055915 3300049668 Unclassified 967
342 Ga0501243_066578 3300049675 Unclassified 677
343 Ga0501249_039216 3300049679 Unclassified 1071
344 Ga0501257_173833 3300049686 Unclassified 606
345 Ga0501259_035681 3300049688 Bacteria 959
346 Ga0501260_001652 3300049689 Unclassified 1855
347 Ga0501221_048992 3300049704 Unclassified 946
348 Ga0501225_0012820 3300049705 Bacteria 2351
349 Ga0501225_0331282 3300049705 Unclassified 522
350 Ga0501273_025335 3300049770 Unclassified 822
351 nmdc:mga05p37_239510_c1 3300050507 Unclassified 2182
352 nmdc:mga05p37_249249_c1 3300050507 Bacteria 2131
353 nmdc:mga05p37_463107_c1 3300050507 Unclassified 1464
354 nmdc:mga05p37_694098_c1 3300050507 Unclassified 1132
355 nmdc:mga09592_158710_c1 3300050508 Bacteria 1953
356 nmdc:mga09592_443868_c1 3300050508 Unclassified 1120
357 nmdc:mga09592_56742_c1 3300050508 Unclassified 3309
358 nmdc:mga09592_879497_c1 3300050508 Unclassified 754
359 nmdc:mga0qj67_384228_c1 3300050509 Bacteria 1134
360 nmdc:mga0qj67_548892_c1 3300050509 Unclassified 927
361 nmdc:mga0qj67_678577_c1 3300050509 Unclassified 821
362 nmdc:mga06r32_1079217_c1 3300050510 Unclassified 753
363 nmdc:mga06r32_71403_c1 3300050510 Bacteria 3359
364 nmdc:mga08y16_1068407_c1 3300050511 Unclassified 784
365 nmdc:mga08y16_120418_c1 3300050511 Bacteria 2731
366 nmdc:mga08y16_15222_c1 3300050511 Bacteria 8091
367 nmdc:mga08y16_1915047_c1 3300050511 Unclassified 543
368 nmdc:mga0n895_1114410_c1 3300050512 Bacteria 766
369 nmdc:mga0n895_113815_c1 3300050512 Bacteria 2723
370 nmdc:mga0n895_140899_c1 3300050512 Bacteria 2440
371 nmdc:mga0n895_182795_c1 3300050512 Bacteria 2128
372 nmdc:mga0n895_397207_c1 3300050512 Bacteria 1394
373 nmdc:mga0n895_408114_c1 3300050512 Bacteria 1374
374 nmdc:mga0rr50_24616_c1 3300050513 Bacteria 4172
375 nmdc:mga0a205_1106835_c1 3300050515 Unclassified 639
376 nmdc:mga0a205_199966_c1 3300050515 Unclassified 1889
377 nmdc:mga0a205_28519_c1 3300050515 Bacteria 5338
378 nmdc:mga0a205_364813_c1 3300050515 Bacteria 1311
379 nmdc:mga0a205_45618_c1 3300050515 Bacteria 4227
380 nmdc:mga0a205_61337_c1 3300050515 Bacteria 3632
381 nmdc:mga0a205_8701_c1 3300050515 Bacteria 9243
382 Ga0530510_0030233 3300061734 Bacteria 3890
383 Ga0070706_100000002
384 SwRhRL2b_contig_179387
385 MBSR1b_contig_11671856
386 CNBas_1000976
387 JGI24749J21850_1004511
388 rootL2_10019355
389 Ga0065714_10002463
390 Ga0065714_10196450
391 Ga0065712_10000246
392 Ga0065712_10007253
393 Ga0065712_10008834
394 Ga0065715_10005309
395 Ga0065715_10097920
396 Ga0065715_10099434
397 Ga0065715_10143864
398 Ga0065715_10219885
399 Ga0065715_10362382
400 Ga0065715_10488679
401 Ga0065707_10088039
402 Ga0065707_10850180
403 Ga0065707_10997242
404 Ga0068869_100136155
405 Ga0068869_100168712
406 Ga0070680_101696340
407 Ga0070660_101567065
408 Ga0070689_100000141
409 Ga0070689_100830009
410 Ga0070689_101721456
411 Ga0070687_100287020
412 Ga0070692_10036317
413 Ga0070692_10082431
414 Ga0070692_10290343
415 Ga0070673_100159871
416 Ga0070673_100164902
417 Ga0070673_101950273
418 Ga0070688_100679524
419 Ga0070659_100892614
420 Ga0070701_10015795
421 Ga0070705_100034180
422 Ga0070700_100268166
423 Ga0070694_100011486
424 Ga0070694_100087610
425 Ga0070694_100270199
426 Ga0070694_100615060
427 Ga0070708_100201359
428 Ga0070662_101103154
429 Ga0068867_100174209
430 Ga0068867_100596086
431 Ga0068867_100965421
432 Ga0070707_100388864
433 Ga0070699_100285230
434 Ga0070699_100422154
435 Ga0068853_100559751
436 Ga0070672_100524955
437 Ga0070695_100060009
438 Ga0070695_100065860
439 Ga0070695_100326944
440 Ga0070696_100110070
441 Ga0070696_100364781
442 Ga0070696_101406210
443 Ga0070693_100007998
444 Ga0070693_100072197
445 Ga0070693_100272767
446 Ga0070704_100153835
447 Ga0070704_100191160
448 Ga0070704_100248384
449 Ga0070704_100453205
450 Ga0068855_100244964
451 Ga0068855_101458866
452 Ga0070664_100305967
453 Ga0070664_101325474
454 Ga0068857_100114478
455 Ga0068857_100147992
456 Ga0068857_100282242
457 Ga0068854_100053232
458 Ga0068854_100621064
459 Ga0070702_100001261
460 Ga0070702_100078143
461 Ga0070702_100709164
462 Ga0070702_100795796
463 Ga0070702_101021323
464 Ga0068852_100108284
465 Ga0068852_101540719
466 Ga0068859_100043813
467 Ga0068859_100048609
468 Ga0068859_100064455
469 Ga0068859_100108114
470 Ga0068859_100215922
471 Ga0068859_100508593
472 Ga0068859_100515043
473 Ga0068859_100968620
474 Ga0068859_101601788
475 Ga0068859_101621060
476 Ga0068864_100008007
477 Ga0068864_100010529
478 Ga0068864_100101384
479 Ga0068864_100360980
480 Ga0068864_100439821
481 Ga0068864_101335712
482 Ga0068861_100218164
483 Ga0068861_101239500
484 Ga0068851_10003006
485 Ga0068870_10440326
486 Ga0068870_10574351
487 Ga0068863_100023456
488 Ga0068863_100256589
489 Ga0068863_100365919
490 Ga0068863_100372473
491 Ga0068863_100408583
492 Ga0068863_100608998
493 Ga0068863_100672622
494 Ga0068863_101190318
495 Ga0068858_100141899
496 Ga0068858_100435869
497 Ga0068860_100010459
498 Ga0068860_100031812
499 Ga0068860_100611327
500 Ga0097621_100016293
501 Ga0097621_101291653
502 Ga0097621_101500085
503 Ga0097621_101651084
504 Ga0068871_100004753
505 Ga0068871_101974431
506 Ga0075428_100695661
507 Ga0075430_100042998
508 Ga0075430_100746854
509 Ga0075431_100298052
510 Ga0075431_100442928
511 Ga0075431_100773411
512 Ga0075433_10032937
513 Ga0075433_10036371
514 Ga0075433_10160733
515 Ga0075433_10200788
516 Ga0075433_10468773
517 Ga0075433_11502786
518 Ga0075434_100038740
519 Ga0075434_100127119
520 Ga0075434_100271601
521 Ga0075434_100602307
522 Ga0075429_100020828
523 Ga0075429_100198500
524 Ga0075429_100237480
525 Ga0075429_100690659
526 Ga0097620_100043812
527 Ga0097620_100048607
528 Ga0097620_100064456
529 Ga0097620_100108115
530 Ga0097620_100215918
531 Ga0097620_100508585
532 Ga0097620_100515037
533 Ga0097620_100582097
534 Ga0097620_100968585
535 Ga0097620_101601493
536 Ga0097620_101621034
537 Ga0075435_100012481
538 Ga0111539_10099490
539 Ga0111539_10438453
540 Ga0111539_11610026
541 Ga0105245_11791914
542 Ga0105245_11947925
543 Ga0105247_10005479
544 Ga0105247_10064680
545 Ga0105247_10751825
546 Ga0105247_11733950
547 Ga0114129_10026128
548 Ga0114129_10192068
549 Ga0114129_10206234
550 Ga0114129_10206905
551 Ga0114129_10423064
552 Ga0114129_10560779
553 Ga0114129_11628223
554 Ga0105243_10029801
555 Ga0105243_10866196
556 Ga0105243_11699457
557 Ga0105241_10114079
558 Ga0105241_10155784
559 Ga0105241_10791312
560 Ga0105241_11090180
561 Ga0105241_11902845
562 Ga0105241_12114616
563 Ga0105241_12439678
564 Ga0105242_10950482
565 Ga0105248_10091753
566 Ga0105248_10595901
567 Ga0105248_11337448
568 Ga0105248_11457423
569 Ga0105237_10001663
570 Ga0105237_10321053
571 Ga0105249_10198762
572 Ga0105249_11356468
573 Ga0105239_10564108
574 Ga0105246_10026429
575 Ga0105246_10113831
576 Ga0105246_10309855
577 Ga0105246_10901773
578 Ga0105246_11561504
579 Ga0105246_12544481
580 Ga0157373_11174720
581 Ga0157371_11061714
582 Ga0157378_10240364
583 Ga0157378_10342559
584 Ga0157378_10962633
585 Ga0163162_10274762
586 Ga0163162_10379510
587 Ga0163162_10704168
588 Ga0163162_11159936
589 Ga0163162_11671193
590 Ga0163162_13360316
591 Ga0157372_10422235
592 Ga0157375_10081492
593 Ga0157375_10561531
594 Ga0157375_11349820
595 Ga0157375_12368597
596 Ga0157375_13309182
597 Ga0163163_10005282
598 Ga0163163_10185355
599 Ga0163163_10721348
600 Ga0163163_10758149
601 Ga0163163_11563238
602 Ga0157380_10729565
603 Ga0157380_10760982
604 Ga0157379_10006138
605 Ga0157379_10048884
606 Ga0207656_10001886
607 Ga0207653_10005752
608 Ga0207710_10001188
609 Ga0207710_10356841
610 Ga0207710_10433829
611 Ga0207647_10006381
612 Ga0207647_10284691
613 Ga0207647_10326173
614 Ga0207645_10626186
615 Ga0207643_10001319
616 Ga0207684_10000264
617 Ga0207654_10134198
618 Ga0207654_10358115
619 Ga0207671_10012235
620 Ga0207657_10202577
621 Ga0207646_10630486
622 Ga0207650_10780859
623 Ga0207650_11425530
624 Ga0207687_11023242
625 Ga0207690_10034358
626 Ga0207709_10019427
627 Ga0207709_10378325
628 Ga0207709_10567968
629 Ga0207670_10002254
630 Ga0207670_10943742
631 Ga0207704_11124390
632 Ga0207711_10140918
633 Ga0207711_10766810
634 Ga0207689_10307023
635 Ga0207689_10392827
636 Ga0207689_10486245
637 Ga0207679_10453087
638 Ga0207679_10649799
639 Ga0207679_11052806
640 Ga0207667_10202897
641 Ga0207651_10042285
642 Ga0207651_10791739
643 Ga0207651_11131701
644 Ga0207640_11073091
645 Ga0207703_10236233
646 Ga0207703_10661925
647 Ga0207703_11089142
648 Ga0207708_10014713
649 Ga0207708_10046991
650 Ga0207641_10015674
651 Ga0207641_10261984
652 Ga0207641_10541080
653 Ga0207641_10840866
654 Ga0207641_11017747
655 Ga0207648_10198791
656 Ga0207648_11006771
657 Ga0207648_11008902
658 Ga0207676_10005013
659 Ga0207676_10006837
660 Ga0207676_10154419
661 Ga0207676_10319346
662 Ga0207676_11127974
663 Ga0207674_10018488
664 Ga0207674_10044052
665 Ga0207674_10171697
666 Ga0207674_10507716
667 Ga0207674_10664673
668 Ga0207675_100235230
669 Ga0207675_101232579
670 Ga0207698_10320773
671 Ga0207698_10866120
672 Ga0207698_11414442
673 Ga0207428_10007675
674 Ga0207428_10200701
675 Ga0268265_10343177
676 Ga0268264_10225002
677 Ga0268264_10770796
678 Ga0268264_12621985
679 Ga0316178_1115745
680 Ga0307405_10056966
681 Ga0307413_10183152
682 Ga0307406_10371050
683 Ga0373940_0182896
684 Ga0373949_0063977
685 Ga0373960_0093466
686 Ga0395899_0804240
687 Ga0395900_0105060
688 Ga0395900_0257426
689 Ga0395900_1714901
690 Ga0395898_0865816
691 Ga0395898_1039494
692 Ga0395901_0045351
693 Ga0395901_0446235
694 Ga0242420_008371
695 Ga0439458_0008720
696 Ga0451576_0060319
697 Ga0451576_0499736
698 Ga0495672_0447624
699 Ga0495672_0487898
700 Ga0496102_1215145
701 Ga0496104_1127795
702 Ga0496106_0450377
703 Ga0496107_0031500
704 Ga0496107_1090443
705 Ga0496110_0230651
706 Ga0496110_0690592
707 Ga0496112_0268301
708 Ga0496112_1133837
709 Ga0501291_146976
710 Ga0501292_030959
711 Ga0501072_0674177
712 Ga0501077_0186455
713 Ga0501198_001990
714 Ga0501209_119359
715 Ga0501216_116626
716 Ga0501217_011722
717 Ga0501223_032974
718 Ga0501223_054086
719 Ga0501224_012393
720 Ga0501227_073230
721 Ga0501230_035574
722 Ga0501230_144585
723 Ga0501233_055915
724 Ga0501243_066578
725 Ga0501249_039216
726 Ga0501257_173833
727 Ga0501259_035681
728 Ga0501260_001652
729 Ga0501221_048992
730 Ga0501225_0012820
731 Ga0501225_0331282
732 Ga0501273_025335
733 nmdc:mga05p37_239510_c1
734 nmdc:mga05p37_249249_c1
735 nmdc:mga05p37_463107_c1
736 nmdc:mga05p37_694098_c1
737 nmdc:mga09592_158710_c1
738 nmdc:mga09592_443868_c1
739 nmdc:mga09592_56742_c1
740 nmdc:mga09592_879497_c1
741 nmdc:mga0qj67_384228_c1
742 nmdc:mga0qj67_548892_c1
743 nmdc:mga0qj67_678577_c1
744 nmdc:mga06r32_1079217_c1
745 nmdc:mga06r32_71403_c1
746 nmdc:mga08y16_1068407_c1
747 nmdc:mga08y16_120418_c1
748 nmdc:mga08y16_15222_c1
749 nmdc:mga08y16_1915047_c1
750 nmdc:mga0n895_1114410_c1
751 nmdc:mga0n895_113815_c1
752 nmdc:mga0n895_140899_c1
753 nmdc:mga0n895_182795_c1
754 nmdc:mga0n895_397207_c1
755 nmdc:mga0n895_408114_c1
756 nmdc:mga0rr50_24616_c1
757 nmdc:mga0a205_1106835_c1
758 nmdc:mga0a205_199966_c1
759 nmdc:mga0a205_28519_c1
760 nmdc:mga0a205_364813_c1
761 nmdc:mga0a205_45618_c1
762 nmdc:mga0a205_61337_c1
763 nmdc:mga0a205_8701_c1
764 Ga0530510_0030233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zcl-assembly2.cif.gz_B crystal structure of ospp2c50 i267l:ospyl/rcar3 with (+)-aba 0.5662 85 128
5gwp-assembly2.cif.gz_B crystal structure of rcar3:pp2c wild-type with (+)-aba 0.5425 85 128
5zcu-assembly2.cif.gz_B crystal structure of rcar3:pp2c wild-type with pyrabactin 0.5275 85 128
5zcl-assembly1.cif.gz_A crystal structure of ospp2c50 i267l:ospyl/rcar3 with (+)-aba 0.4758 85 128
5gwp-assembly1.cif.gz_A crystal structure of rcar3:pp2c wild-type with (+)-aba 0.4612 80 128
ID Description Score Start End Superfamily
af_Q80Z30_227_507_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.5407 85 124 3.60.40.10
2z46E00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Chaperonin-like RbcX 0.5209 52 126 1.10.1200.210
af_I1JU27_29_122_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5164 74 127 3.30.40.10
af_Q09332_440_692_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5083 73 127 3.40.30.10
af_P0AEM6_6_85_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5042 50 127 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A7U2V5W8-F1-model_v4 deleted 0.9394 89 124
AF-A0A7R6XFL3-F1-model_v4 deleted 0.9149 87 124
AF-A0A0Q5IJP9-F1-model_v4 Uncharacterized protein 0.9059 63 125
AF-A0A2N3EAH9-F1-model_v4 Rap1a immunity protein domain-containing protein 0.8944 89 124
AF-A0A1F2VM20-F1-model_v4 Rap1a immunity protein domain-containing protein 0.8867 41 125

Map