F429174

General Info

Members Datasets Scaffolds Average Seq Length
382 212 380 214

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100206139|Ga0070690_1002061392
Length 230
Sequence MRWRTRRSSATWSAPVLEIEKLSVSIASMQILRDVSLEVPTGSMTGLIGRNGAGKTTVMKTVMGLLKAGRGSVRFDSRDLLAVPTHARARLGIGYMPEDRRLIPDLTVEENVLVPAWAAGMPDAHARLQKVYEYIPEVKQFAPRKGLQLSGGQQKLAALARALMCGTRLLLLDEPFEGVAPALAQRLAEVIAGLKREGLSVLLSESDLQHSERLVDRVIAIDRGSIAAGQ

Samples

Sample ID Description Type Environment
1 2791355263 Rhizobium chutanense C5 Isolate Nodule
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.52
Rhizoplane 1.31
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10080614 3300003203 Bacteria 999
2 rootL2_10282764 3300003322 Bacteria 1589
3 Ga0065707_10093812 3300005295 Bacteria 3577
4 Ga0065707_10129608 3300005295 Bacteria 1944
5 Ga0070676_10109922 3300005328 Bacteria 1715
6 Ga0070683_100296177 3300005329 Bacteria 1539
7 Ga0070690_100206139 3300005330 Bacteria 1370
8 Ga0070690_100324979 3300005330 Bacteria 1110
9 Ga0070690_100482616 3300005330 Bacteria 924
10 Ga0068869_100016408 3300005334 Bacteria 4991
11 Ga0068869_100085623 3300005334 Bacteria 2361
12 Ga0068869_100403750 3300005334 Bacteria 1124
13 Ga0070666_10308287 3300005335 Bacteria 1128
14 Ga0070680_100259582 3300005336 Bacteria 1470
15 Ga0068868_100002421 3300005338 Bacteria 12924
16 Ga0068868_100010035 3300005338 Bacteria 6842
17 Ga0070689_100033013 3300005340 Bacteria 3941
18 Ga0070689_100200007 3300005340 Bacteria 1631
19 Ga0070689_100737362 3300005340 Bacteria 863
20 Ga0070689_100893209 3300005340 Bacteria 786
21 Ga0070687_100048792 3300005343 Bacteria 2178
22 Ga0070692_10002465 3300005345 Bacteria 7195
23 Ga0070692_10230248 3300005345 Bacteria 1100
24 Ga0070692_10267382 3300005345 Bacteria 1031
25 Ga0070668_100222473 3300005347 Bacteria 1557
26 Ga0070669_100003030 3300005353 Bacteria 12085
27 Ga0070675_100690097 3300005354 Unclassified 929
28 Ga0070674_100361329 3300005356 Bacteria 1176
29 Ga0070674_100362592 3300005356 Bacteria 1174
30 Ga0070673_100115740 3300005364 Bacteria 2230
31 Ga0070673_100378987 3300005364 Bacteria 1261
32 Ga0070673_100395217 3300005364 Bacteria 1235
33 Ga0070688_100529679 3300005365 Bacteria 893
34 Ga0070667_100299904 3300005367 Bacteria 1447
35 Ga0070703_10058703 3300005406 Bacteria 1253
36 Ga0070701_10035149 3300005438 Bacteria 2516
37 Ga0070711_100574800 3300005439 Bacteria 937
38 Ga0070705_100000352 3300005440 Bacteria 27160
39 Ga0070705_100019632 3300005440 Bacteria 3560
40 Ga0070700_100011434 3300005441 Bacteria 4917
41 Ga0070700_100286793 3300005441 Bacteria 1196
42 Ga0070700_100466912 3300005441 Bacteria 964
43 Ga0070694_100028998 3300005444 Bacteria 3608
44 Ga0070694_100191500 3300005444 Bacteria 1519
45 Ga0070694_100326263 3300005444 Bacteria 1183
46 Ga0070708_100331424 3300005445 Bacteria 1434
47 Ga0070663_100202416 3300005455 Bacteria 1550
48 Ga0070662_100191376 3300005457 Bacteria 1618
49 Ga0070681_10000228 3300005458 Bacteria 44234
50 Ga0068867_100000542 3300005459 Bacteria 24825
51 Ga0068867_100068402 3300005459 Bacteria 2650
52 Ga0068867_100457888 3300005459 Bacteria 1088
53 Ga0068867_100743038 3300005459 Bacteria 870
54 Ga0070707_100196946 3300005468 Bacteria 1964
55 Ga0070699_100005250 3300005518 Bacteria 11375
56 Ga0070699_100109264 3300005518 Bacteria 2427
57 Ga0070679_100050977 3300005530 Bacteria 4122
58 Ga0070679_100195439 3300005530 Bacteria 1991
59 Ga0070672_100364926 3300005543 Bacteria 1233
60 Ga0070686_100013015 3300005544 Bacteria 4750
61 Ga0070695_100000128 3300005545 Bacteria 34279
62 Ga0070695_100068745 3300005545 Bacteria 2314
63 Ga0070695_100090955 3300005545 Bacteria 2037
64 Ga0070696_100000102 3300005546 Bacteria 43346
65 Ga0070696_100023053 3300005546 Bacteria 4232
66 Ga0070696_100152013 3300005546 Bacteria 1700
67 Ga0070696_100376341 3300005546 Bacteria 1106
68 Ga0070693_100000047 3300005547 Bacteria 46631
69 Ga0070665_100037212 3300005548 Bacteria 4895
70 Ga0070665_100421251 3300005548 Bacteria 1344
71 Ga0070704_100004103 3300005549 Bacteria 8409
72 Ga0070704_100009148 3300005549 Bacteria 5975
73 Ga0070704_100427291 3300005549 Bacteria 1136
74 Ga0070704_100618275 3300005549 Bacteria 954
75 Ga0068855_100243810 3300005563 Bacteria 2007
76 Ga0068854_100059924 3300005578 Bacteria 2752
77 Ga0068854_100623253 3300005578 Bacteria 923
78 Ga0068856_100131814 3300005614 Bacteria 2504
79 Ga0070702_100027975 3300005615 Bacteria 3049
80 Ga0068859_100067271 3300005617 Bacteria 3617
81 Ga0068859_100080455 3300005617 Bacteria 3299
82 Ga0068859_100144519 3300005617 Bacteria 2453
83 Ga0068859_100192221 3300005617 Bacteria 2125
84 Ga0068864_100023782 3300005618 Bacteria 5147
85 Ga0068864_100860044 3300005618 Bacteria 894
86 Ga0068866_10008425 3300005718 Bacteria 4346
87 Ga0068866_10040998 3300005718 Bacteria 2295
88 Ga0068866_10587046 3300005718 Bacteria 750
89 Ga0068861_100003973 3300005719 Bacteria 9903
90 Ga0068861_100176017 3300005719 Bacteria 1777
91 Ga0068861_100210507 3300005719 Bacteria 1637
92 Ga0068870_10204896 3300005840 Bacteria 1198
93 Ga0068863_100042981 3300005841 Bacteria 4292
94 Ga0068858_100019140 3300005842 Bacteria 6405
95 Ga0068858_100540801 3300005842 Bacteria 1127
96 Ga0068860_100031320 3300005843 Bacteria 5112
97 Ga0068860_100324733 3300005843 Bacteria 1511
98 Ga0068862_100002340 3300005844 Bacteria 16881
99 Ga0068862_100018354 3300005844 Bacteria 5825
100 Ga0068862_100045766 3300005844 Bacteria 3733
101 Ga0068862_100084837 3300005844 Bacteria 2752
102 Ga0068862_100633300 3300005844 Bacteria 1030
103 Ga0081539_10002070 3300005985 Bacteria 30041
104 Ga0097621_100001735 3300006237 Bacteria 14922
105 Ga0097621_100701947 3300006237 Unclassified 931
106 Ga0068871_100003011 3300006358 Bacteria 11564
107 Ga0068871_100055711 3300006358 Bacteria 3211
108 Ga0075428_100002549 3300006844 Bacteria 19813
109 Ga0075428_100340535 3300006844 Bacteria 1610
110 Ga0075428_100957714 3300006844 Bacteria 907
111 Ga0075430_100003518 3300006846 Bacteria 13106
112 Ga0075433_10006513 3300006852 Bacteria 9239
113 Ga0075434_100000779 3300006871 Bacteria 25235
114 Ga0075434_100004244 3300006871 Bacteria 12848
115 Ga0075434_100032773 3300006871 Bacteria 5124
116 Ga0075429_100434890 3300006880 Bacteria 1150
117 Ga0068865_100115138 3300006881 Bacteria 1989
118 Ga0068865_100223663 3300006881 Bacteria 1473
119 Ga0068865_100271165 3300006881 Bacteria 1347
120 Ga0075436_100000464 3300006914 Bacteria 26279
121 Ga0075436_100003752 3300006914 Bacteria 10410
122 Ga0075436_100237500 3300006914 Bacteria 1296
123 Ga0097620_100067272 3300006931 Bacteria 3617
124 Ga0097620_100080457 3300006931 Bacteria 3299
125 Ga0097620_100144519 3300006931 Bacteria 2453
126 Ga0097620_100192205 3300006931 Bacteria 2125
127 Ga0075435_100000515 3300007076 Bacteria 23637
128 Ga0075435_100004009 3300007076 Bacteria 10066
129 Ga0075435_100215013 3300007076 Bacteria 1631
130 Ga0075435_100298088 3300007076 Bacteria 1378
131 Ga0111539_10019365 3300009094 Bacteria 8401
132 Ga0111539_10026571 3300009094 Bacteria 7078
133 Ga0111539_10033070 3300009094 Bacteria 6279
134 Ga0111539_10470332 3300009094 Bacteria 1464
135 Ga0111539_10595602 3300009094 Bacteria 1287
136 Ga0111539_10813267 3300009094 Bacteria 1087
137 Ga0111539_11337089 3300009094 Bacteria 831
138 Ga0105245_10006762 3300009098 Bacteria 10057
139 Ga0105247_10059608 3300009101 Bacteria 2363
140 Ga0114129_10001579 3300009147 Bacteria 30947
141 Ga0114129_10146824 3300009147 Bacteria 3230
142 Ga0114129_10433058 3300009147 Bacteria 1728
143 Ga0114129_10895746 3300009147 Bacteria 1125
144 Ga0105243_10007499 3300009148 Bacteria 8382
145 Ga0105243_10326408 3300009148 Bacteria 1400
146 Ga0105242_10005621 3300009176 Bacteria 9676
147 Ga0105242_10080654 3300009176 Bacteria 2720
148 Ga0105248_10159572 3300009177 Bacteria 2544
149 Ga0105248_10480705 3300009177 Bacteria 1400
150 Ga0105249_10008774 3300009553 Bacteria 8824
151 Ga0105249_10284850 3300009553 Bacteria 1652
152 Ga0105239_10051923 3300010375 Bacteria 4494
153 Ga0105239_10228845 3300010375 Bacteria 2086
154 Ga0105239_10887034 3300010375 Bacteria 1023
155 Ga0105246_11042468 3300011119 Unclassified 743
156 Ga0157374_10581793 3300013296 Bacteria 1129
157 Ga0157378_10009721 3300013297 Bacteria 8378
158 Ga0157378_10075838 3300013297 Bacteria 3028
159 Ga0157378_10333240 3300013297 Bacteria 1477
160 Ga0163162_10343815 3300013306 Bacteria 1624
161 Ga0163162_10360640 3300013306 Bacteria 1586
162 Ga0157375_10140633 3300013308 Bacteria 2541
163 Ga0157375_10553434 3300013308 Bacteria 1312
164 Ga0157380_10032040 3300014326 Bacteria 4040
165 Ga0157380_10035078 3300014326 Bacteria 3873
166 Ga0157379_10157765 3300014968 Bacteria 2047
167 Ga0157376_10079461 3300014969 Bacteria 2812
168 Ga0207642_10012093 3300025899 Bacteria 3104
169 Ga0207647_10032371 3300025904 Bacteria 3360
170 Ga0207645_10130761 3300025907 Bacteria 1634
171 Ga0207654_10118974 3300025911 Bacteria 1656
172 Ga0207707_10002679 3300025912 Bacteria 15913
173 Ga0207707_10089172 3300025912 Bacteria 2695
174 Ga0207663_10299438 3300025916 Bacteria 1201
175 Ga0207660_10226612 3300025917 Bacteria 1468
176 Ga0207660_10679026 3300025917 Bacteria 840
177 Ga0207662_10122765 3300025918 Bacteria 1630
178 Ga0207662_10424565 3300025918 Bacteria 905
179 Ga0207652_10016948 3300025921 Bacteria 5959
180 Ga0207681_10089401 3300025923 Bacteria 2195
181 Ga0207681_10829895 3300025923 Bacteria 773
182 Ga0207694_10386612 3300025924 Bacteria 1162
183 Ga0207687_10391161 3300025927 Bacteria 1141
184 Ga0207664_10300651 3300025929 Bacteria 1412
185 Ga0207709_10020196 3300025935 Bacteria 3755
186 Ga0207670_10030388 3300025936 Bacteria 3452
187 Ga0207670_10203205 3300025936 Bacteria 1507
188 Ga0207670_10245180 3300025936 Bacteria 1382
189 Ga0207670_10549272 3300025936 Bacteria 943
190 Ga0207670_10582211 3300025936 Bacteria 917
191 Ga0207670_10621225 3300025936 Bacteria 889
192 Ga0207669_10041616 3300025937 Bacteria 2676
193 Ga0207669_10047872 3300025937 Bacteria 2536
194 Ga0207704_10003363 3300025938 Bacteria 7258
195 Ga0207704_10179712 3300025938 Bacteria 1528
196 Ga0207665_10301388 3300025939 Bacteria 1198
197 Ga0207691_10365012 3300025940 Bacteria 1234
198 Ga0207711_10022078 3300025941 Bacteria 5320
199 Ga0207711_10129563 3300025941 Bacteria 2261
200 Ga0207689_10011395 3300025942 Bacteria 7619
201 Ga0207689_10028017 3300025942 Bacteria 4712
202 Ga0207651_10315009 3300025960 Bacteria 1306
203 Ga0207651_10337549 3300025960 Bacteria 1265
204 Ga0207640_10047272 3300025981 Bacteria 2774
205 Ga0207640_11038548 3300025981 Bacteria 722
206 Ga0207677_10013514 3300026023 Bacteria 4735
207 Ga0207677_10400423 3300026023 Bacteria 1164
208 Ga0207678_10229471 3300026067 Bacteria 1589
209 Ga0207708_10000761 3300026075 Bacteria 24206
210 Ga0207708_10009122 3300026075 Bacteria 7341
211 Ga0207708_10135954 3300026075 Bacteria 1925
212 Ga0207708_10312417 3300026075 Bacteria 1281
213 Ga0207708_10521267 3300026075 Bacteria 999
214 Ga0207648_10009552 3300026089 Bacteria 9278
215 Ga0207648_10017847 3300026089 Bacteria 6440
216 Ga0207648_10282966 3300026089 Bacteria 1483
217 Ga0207676_10305364 3300026095 Bacteria 1454
218 Ga0207675_100125210 3300026118 Bacteria 2434
219 Ga0207675_100270264 3300026118 Bacteria 1650
220 Ga0207675_100285634 3300026118 Bacteria 1604
221 Ga0207683_10253718 3300026121 Bacteria 1605
222 Ga0207683_10656720 3300026121 Bacteria 971
223 Ga0209981_1002786 3300027378 Bacteria 2242
224 Ga0209996_1003797 3300027395 Bacteria 1910
225 Ga0207428_10002048 3300027907 Bacteria 20344
226 Ga0207428_10026532 3300027907 Bacteria 4836
227 Ga0207428_10223283 3300027907 Bacteria 1411
228 Ga0207428_10357557 3300027907 Bacteria 1074
229 Ga0268266_10040643 3300028379 Bacteria 3965
230 Ga0268266_10089172 3300028379 Bacteria 2700
231 Ga0268265_10006677 3300028380 Bacteria 7811
232 Ga0268265_10107343 3300028380 Bacteria 2270
233 Ga0268265_10116501 3300028380 Bacteria 2192
234 Ga0268265_11154247 3300028380 Bacteria 771
235 Ga0268264_10833026 3300028381 Bacteria 923
236 Ga0265331_10233449 3300031250 Bacteria 826
237 Ga0307408_100433673 3300031548 Bacteria 1136
238 Ga0316575_10094374 3300031665 Bacteria 1213
239 Ga0307409_100543890 3300031995 Bacteria 1139
240 Ga0307409_100774999 3300031995 Bacteria 965
241 Ga0307416_100100650 3300032002 Bacteria 2514
242 Ga0307416_100699797 3300032002 Bacteria 1102
243 Ga0307416_100841781 3300032002 Bacteria 1015
244 Ga0307411_10014725 3300032005 Bacteria 4364
245 Ga0373950_0048794 3300034818 Bacteria 828
246 Ga0373958_0035091 3300034819 Bacteria 1003
247 Ga0373959_0028980 3300034820 Bacteria 1108
248 Ga0373938_0088558 3300034957 Bacteria 763
249 Ga0373926_0018166 3300035083 Bacteria 2417
250 Ga0373928_0018795 3300035084 Bacteria 1436
251 Ga0373929_0008000 3300035085 Bacteria 1944
252 Ga0373940_0016356 3300035088 Bacteria 1836
253 Ga0373944_0005567 3300035089 Bacteria 3319
254 Ga0373951_0081779 3300035091 Bacteria 837
255 Ga0373923_0159776 3300035111 Bacteria 1028
256 Ga0373932_0035709 3300035112 Bacteria 1407
257 Ga0373932_0056412 3300035112 Bacteria 1181
258 Ga0373932_0069518 3300035112 Bacteria 1089
259 Ga0373936_0057151 3300035113 Bacteria 1586
260 Ga0373936_0203877 3300035113 Bacteria 874
261 Ga0373939_0003379 3300035114 Bacteria 3744
262 Ga0373939_0026682 3300035114 Bacteria 1630
263 Ga0373939_0068877 3300035114 Bacteria 1147
264 Ga0373941_0037500 3300035115 Bacteria 1479
265 Ga0373941_0068064 3300035115 Bacteria 1175
266 Ga0373945_0002098 3300035116 Bacteria 6214
267 Ga0373960_0026544 3300035121 Bacteria 1583
268 Ga0373960_0039531 3300035121 Bacteria 1357
269 Ga0373961_0003172 3300035241 Bacteria 4101
270 Ga0373962_0004519 3300035242 Bacteria 3365
271 Ga0373962_0074392 3300035242 Bacteria 1021
272 Ga0316574_0008034 3300035398 Bacteria 5832
273 Ga0373924_0088624 3300035410 Bacteria 1322
274 Ga0373931_0000717 3300035691 Bacteria 13738
275 Ga0373931_0000741 3300035691 Bacteria 13600
276 Ga0373931_0058957 3300035691 Bacteria 2063
277 Ga0373935_0201455 3300035692 Bacteria 1375
278 Ga0373927_0017359 3300035695 Bacteria 4737
279 Ga0373933_0094758 3300035724 Bacteria 1846
280 Ga0439453_0004586 3300041408 Bacteria 2060
281 Ga0439441_003316 3300042001 Bacteria 2364
282 Ga0450913_002852 3300042117 Bacteria 1095
283 Ga0439435_0016000 3300042436 Bacteria 1874
284 Ga0439444_0001626 3300042437 Bacteria 2963
285 Ga0439460_0048948 3300042461 Bacteria 1262
286 Ga0451577_0036589 3300042876 Bacteria 4418
287 Ga0451577_0246936 3300042876 Bacteria 1615
288 Ga0451577_0256899 3300042876 Bacteria 1582
289 Ga0466965_0194795 3300044683 Bacteria 1073
290 Ga0453684_0433550 3300044712 Bacteria 1466
291 Ga0466957_0552530 3300044842 Bacteria 802
292 Ga0451576_0000756 3300045051 Bacteria 64364
293 Ga0451576_0045877 3300045051 Bacteria 4601
294 Ga0451576_0273885 3300045051 Bacteria 1764
295 Ga0451576_0365381 3300045051 Bacteria 1512
296 Ga0451576_0770564 3300045051 Bacteria 1010
297 Ga0451576_1590619 3300045051 Bacteria 678
298 Ga0495651_0158700 3300046462 Bacteria 1623
299 Ga0495582_0069727 3300046473 Bacteria 1944
300 Ga0495639_0004956 3300046475 Bacteria 5708
301 Ga0495663_0131318 3300046525 Bacteria 845
302 Ga0495666_0030451 3300046526 Bacteria 2648
303 Ga0495642_0055473 3300046528 Bacteria 1636
304 Ga0495665_0016268 3300046531 Bacteria 4008
305 Ga0495586_0014364 3300046535 Bacteria 4207
306 Ga0495598_0002062 3300046537 Bacteria 4094
307 Ga0495588_0027725 3300046674 Bacteria 2832
308 Ga0495647_0000667 3300046681 Bacteria 10202
309 Ga0495658_0020309 3300046683 Bacteria 3483
310 Ga0495669_0102033 3300046684 Bacteria 1333
311 Ga0495669_0274497 3300046684 Bacteria 811
312 Ga0495600_0244775 3300046809 Bacteria 1142
313 Ga0495604_0302905 3300047317 Bacteria 1073
314 Ga0495636_0124504 3300047318 Bacteria 1143
315 Ga0495676_0071188 3300047321 Bacteria 2674
316 Ga0496102_0456729 3300048905 Bacteria 1198
317 Ga0496108_0093201 3300048911 Bacteria 2562
318 Ga0496109_0924802 3300048912 Bacteria 810
319 Ga0496111_0195947 3300048914 Bacteria 1502
320 Ga0496113_0201612 3300048916 Bacteria 1582
321 Ga0501031_0103636 3300049568 Bacteria 1857
322 Ga0501031_0150296 3300049568 Bacteria 1522
323 Ga0501039_0147033 3300049575 Bacteria 1852
324 Ga0501039_0434885 3300049575 Bacteria 1030
325 Ga0501040_0022022 3300049576 Bacteria 4262
326 Ga0501041_0325688 3300049577 Bacteria 969
327 Ga0501042_0105006 3300049578 Bacteria 2033
328 Ga0501046_0269367 3300049580 Bacteria 1249
329 Ga0501048_0077197 3300049582 Bacteria 2351
330 Ga0501067_0054106 3300049583 Bacteria 2224
331 Ga0501069_0186146 3300049585 Bacteria 1201
332 Ga0501069_0308059 3300049585 Bacteria 929
333 Ga0501071_0041833 3300049587 Bacteria 3282
334 Ga0501072_0075339 3300049588 Bacteria 2669
335 Ga0501072_0324622 3300049588 Bacteria 1223
336 Ga0501072_0865157 3300049588 Bacteria 707
337 Ga0501075_0084651 3300049591 Bacteria 2402
338 Ga0501076_0126858 3300049592 Bacteria 2068
339 Ga0501076_0976540 3300049592 Bacteria 698
340 Ga0501233_061672 3300049668 Bacteria 932
341 Ga0501081_0187831 3300049743 Bacteria 1496
342 Ga0501081_0197722 3300049743 Bacteria 1458
343 Ga0501081_0356109 3300049743 Bacteria 1079
344 Ga0501045_0043305 3300049824 Bacteria 3278
345 nmdc:mga05p37_1127697_c1 3300050507 Bacteria 818
346 nmdc:mga05p37_2350_c1 3300050507 Bacteria 22007
347 nmdc:mga05p37_800370_c1 3300050507 Bacteria 1031
348 nmdc:mga05p37_845683_c1 3300050507 Bacteria 994
349 nmdc:mga09592_156754_c1 3300050508 Bacteria 1966
350 nmdc:mga09592_584679_c1 3300050508 Bacteria 958
351 nmdc:mga09592_80122_c1 3300050508 Bacteria 2780
352 nmdc:mga0qj67_8294_c1 3300050509 Bacteria 7703
353 nmdc:mga06r32_110623_c1 3300050510 Bacteria 2703
354 nmdc:mga06r32_304394_c1 3300050510 Bacteria 1580
355 nmdc:mga06r32_508580_c1 3300050510 Bacteria 1181
356 nmdc:mga08y16_28485_c1 3300050511 Bacteria 5889
357 nmdc:mga08y16_394645_c1 3300050511 Bacteria 1417
358 nmdc:mga08y16_429041_c1 3300050511 Bacteria 1350
359 nmdc:mga08y16_438388_c1 3300050511 Bacteria 1334
360 nmdc:mga08y16_5615_c1 3300050511 Bacteria 13139
361 nmdc:mga08y16_738850_c1 3300050511 Bacteria 981
362 nmdc:mga0n895_11021_c1 3300050512 Bacteria 8037
363 nmdc:mga0n895_141701_c1 3300050512 Bacteria 2433
364 nmdc:mga0n895_186126_c1 3300050512 Bacteria 2107
365 nmdc:mga0n895_260_c1 3300050512 Bacteria 34195
366 nmdc:mga0n895_82840_c1 3300050512 Bacteria 3198
367 nmdc:mga0rr50_1143_c1 3300050513 Bacteria 14415
368 nmdc:mga0rr50_2307_c1 3300050513 Bacteria 10704
369 nmdc:mga0rr50_698683_c1 3300050513 Bacteria 866
370 nmdc:mga0rr50_811053_c1 3300050513 Bacteria 798
371 nmdc:mga08x19_1280_c1 3300050514 Bacteria 15609
372 nmdc:mga08x19_130282_c1 3300050514 Bacteria 1691
373 nmdc:mga08x19_2742_c1 3300050514 Bacteria 10638
374 nmdc:mga08x19_5996_c1 3300050514 Bacteria 7187
375 nmdc:mga08x19_65424_c1 3300050514 Bacteria 2361
376 nmdc:mga08x19_88222_c1 3300050514 Bacteria 2044
377 nmdc:mga0a205_208079_c1 3300050515 Bacteria 1845
378 nmdc:mga0a205_2190_c1 3300050515 Bacteria 17194
379 Ga0501084_0183176 3300054114 Bacteria 1768
380 Ga0590077_004181 3300059426 Bacteria 2975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_584679_c1 nmdc:mga09592_584679_c1_386_943 185
2 3300035692 Ga0373935_0201455 Ga0373935_0201455_793_1356 186
3 3300025923 Ga0207681_10829895 Ga0207681_108298951 194
4 3300044842 Ga0466957_0552530 Ga0466957_0552530_73_717 194
5 3300005844 Ga0068862_100045766 Ga0068862_1000457665 195
6 3300028380 Ga0268265_10116501 Ga0268265_101165012 195
7 3300034820 Ga0373959_0028980 Ga0373959_0028980_271_930 195
8 3300005356 Ga0070674_100362592 Ga0070674_1003625922 196
9 3300005546 Ga0070696_100376341 Ga0070696_1003763412 199
10 3300009147 Ga0114129_10895746 Ga0114129_108957462 199
11 3300005334 Ga0068869_100403750 Ga0068869_1004037502 201
12 3300005345 Ga0070692_10002465 Ga0070692_100024652 201
13 3300005440 Ga0070705_100000352 Ga0070705_1000003523 201
14 3300005441 Ga0070700_100011434 Ga0070700_1000114342 201
15 3300005459 Ga0068867_100000542 Ga0068867_10000054223 201
16 3300005530 Ga0070679_100050977 Ga0070679_1000509772 201
17 3300005545 Ga0070695_100000128 Ga0070695_10000012826 201
18 3300005546 Ga0070696_100000102 Ga0070696_10000010231 201
19 3300005547 Ga0070693_100000047 Ga0070693_10000004716 201
20 3300005549 Ga0070704_100009148 Ga0070704_1000091484 201
21 3300005615 Ga0070702_100027975 Ga0070702_1000279754 201
22 3300005719 Ga0068861_100003973 Ga0068861_1000039734 201
23 3300006358 Ga0068871_100003011 Ga0068871_1000030112 201
24 3300025912 Ga0207707_10089172 Ga0207707_100891723 201
25 3300025917 Ga0207660_10226612 Ga0207660_102266122 201
26 3300026075 Ga0207708_10000761 Ga0207708_100007612 201
27 3300026089 Ga0207648_10009552 Ga0207648_100095524 201
28 3300035242 Ga0373962_0004519 Ga0373962_0004519_2747_3355 201
29 3300005365 Ga0070688_100529679 Ga0070688_1005296791 206
30 3300009094 Ga0111539_10470332 Ga0111539_104703322 206
31 3300025918 Ga0207662_10424565 Ga0207662_104245651 206
32 3300025936 Ga0207670_10582211 Ga0207670_105822112 206
33 3300050511 nmdc:mga08y16_429041_c1 nmdc:mga08y16_429041_c1_130_750 206
34 iso_pu_bacteria 2791355263 2793341939 210
35 3300005549 Ga0070704_100618275 Ga0070704_1006182751 211
36 3300005345 Ga0070692_10267382 Ga0070692_102673822 212
37 3300005440 Ga0070705_100019632 Ga0070705_1000196323 212
38 3300005441 Ga0070700_100466912 Ga0070700_1004669121 212
39 3300005444 Ga0070694_100191500 Ga0070694_1001915002 212
40 3300005444 Ga0070694_100326263 Ga0070694_1003262632 212
41 3300005445 Ga0070708_100331424 Ga0070708_1003314243 212
42 3300005459 Ga0068867_100743038 Ga0068867_1007430382 212
43 3300005468 Ga0070707_100196946 Ga0070707_1001969462 212
44 3300005545 Ga0070695_100068745 Ga0070695_1000687452 212
45 3300005545 Ga0070695_100090955 Ga0070695_1000909553 212
46 3300005546 Ga0070696_100023053 Ga0070696_1000230532 212
47 3300005549 Ga0070704_100004103 Ga0070704_1000041039 212
48 3300006871 Ga0075434_100032773 Ga0075434_1000327735 212
49 3300007076 Ga0075435_100215013 Ga0075435_1002150132 212
50 3300026075 Ga0207708_10521267 Ga0207708_105212672 212
51 3300032002 Ga0307416_100100650 Ga0307416_1001006503 212
52 3300050507 nmdc:mga05p37_1127697_c1 nmdc:mga05p37_1127697_c1_16_657 212
53 3300050512 nmdc:mga0n895_141701_c1 nmdc:mga0n895_141701_c1_969_1607 212
54 3300050512 nmdc:mga0n895_82840_c1 nmdc:mga0n895_82840_c1_711_1349 212
55 3300050514 nmdc:mga08x19_130282_c1 nmdc:mga08x19_130282_c1_191_829 212
56 3300050514 nmdc:mga08x19_88222_c1 nmdc:mga08x19_88222_c1_558_1196 212
57 3300050515 nmdc:mga0a205_208079_c1 nmdc:mga0a205_208079_c1_302_940 212
58 3300059426 Ga0590077_004181 Ga0590077_004181_369_1007 212
59 3300003322 rootL2_10282764 rootL2_102827642 213
60 3300005295 Ga0065707_10129608 Ga0065707_101296082 213
61 3300005335 Ga0070666_10308287 Ga0070666_103082872 213
62 3300005340 Ga0070689_100737362 Ga0070689_1007373622 213
63 3300005340 Ga0070689_100893209 Ga0070689_1008932091 213
64 3300005345 Ga0070692_10230248 Ga0070692_102302481 213
65 3300005347 Ga0070668_100222473 Ga0070668_1002224732 213
66 3300005353 Ga0070669_100003030 Ga0070669_10000303010 213
67 3300005356 Ga0070674_100361329 Ga0070674_1003613291 213
68 3300005406 Ga0070703_10058703 Ga0070703_100587032 213
69 3300005459 Ga0068867_100457888 Ga0068867_1004578881 213
70 3300005718 Ga0068866_10040998 Ga0068866_100409982 213
71 3300005719 Ga0068861_100210507 Ga0068861_1002105072 213
72 3300005844 Ga0068862_100002340 Ga0068862_10000234018 213
73 3300006358 Ga0068871_100055711 Ga0068871_1000557113 213
74 3300006844 Ga0075428_100957714 Ga0075428_1009577141 213
75 3300006881 Ga0068865_100271165 Ga0068865_1002711652 213
76 3300006914 Ga0075436_100000464 Ga0075436_1000004643 213
77 3300007076 Ga0075435_100298088 Ga0075435_1002980882 213
78 3300009094 Ga0111539_10019365 Ga0111539_100193655 213
79 3300009147 Ga0114129_10433058 Ga0114129_104330581 213
80 3300009177 Ga0105248_10159572 Ga0105248_101595722 213
81 3300013306 Ga0163162_10343815 Ga0163162_103438152 213
82 3300014326 Ga0157380_10032040 Ga0157380_100320404 213
83 3300025899 Ga0207642_10012093 Ga0207642_100120935 213
84 3300025907 Ga0207645_10130761 Ga0207645_101307611 213
85 3300025923 Ga0207681_10089401 Ga0207681_100894012 213
86 3300025935 Ga0207709_10020196 Ga0207709_100201964 213
87 3300025936 Ga0207670_10621225 Ga0207670_106212252 213
88 3300025937 Ga0207669_10047872 Ga0207669_100478722 213
89 3300026075 Ga0207708_10009122 Ga0207708_1000912210 213
90 3300026075 Ga0207708_10135954 Ga0207708_101359542 213
91 3300026089 Ga0207648_10017847 Ga0207648_100178478 213
92 3300026089 Ga0207648_10282966 Ga0207648_102829662 213
93 3300026118 Ga0207675_100270264 Ga0207675_1002702642 213
94 3300026118 Ga0207675_100285634 Ga0207675_1002856342 213
95 3300026121 Ga0207683_10253718 Ga0207683_102537182 213
96 3300027907 Ga0207428_10026532 Ga0207428_100265324 213
97 3300027907 Ga0207428_10357557 Ga0207428_103575572 213
98 3300028380 Ga0268265_10006677 Ga0268265_100066772 213
99 3300035113 Ga0373936_0203877 Ga0373936_0203877_99_740 213
100 3300045051 Ga0451576_0770564 Ga0451576_0770564_64_705 213
101 3300046684 Ga0495669_0102033 Ga0495669_0102033_311_952 213
102 3300046809 Ga0495600_0244775 Ga0495600_0244775_170_811 213
103 3300049585 Ga0501069_0186146 Ga0501069_0186146_214_855 213
104 3300049668 Ga0501233_061672 Ga0501233_061672_25_666 213
105 3300050507 nmdc:mga05p37_845683_c1 nmdc:mga05p37_845683_c1_13_654 213
106 3300050508 nmdc:mga09592_80122_c1 nmdc:mga09592_80122_c1_128_769 213
107 3300050510 nmdc:mga06r32_304394_c1 nmdc:mga06r32_304394_c1_890_1531 213
108 3300050511 nmdc:mga08y16_28485_c1 nmdc:mga08y16_28485_c1_3437_4078 213
109 3300050513 nmdc:mga0rr50_698683_c1 nmdc:mga0rr50_698683_c1_155_796 213
110 3300050514 nmdc:mga08x19_2742_c1 nmdc:mga08x19_2742_c1_8821_9462 213
111 3300050514 nmdc:mga08x19_5996_c1 nmdc:mga08x19_5996_c1_2615_3256 213
112 3300050514 nmdc:mga08x19_65424_c1 nmdc:mga08x19_65424_c1_275_916 213
113 3300003203 JGI25406J46586_10080614 JGI25406J46586_100806141 214
114 3300005295 Ga0065707_10093812 Ga0065707_100938122 214
115 3300005328 Ga0070676_10109922 Ga0070676_101099222 214
116 3300005329 Ga0070683_100296177 Ga0070683_1002961772 214
117 3300005330 Ga0070690_100206139 Ga0070690_1002061392 214
118 3300005330 Ga0070690_100324979 Ga0070690_1003249791 214
119 3300005330 Ga0070690_100482616 Ga0070690_1004826161 214
120 3300005334 Ga0068869_100016408 Ga0068869_1000164083 214
121 3300005334 Ga0068869_100085623 Ga0068869_1000856231 214
122 3300005336 Ga0070680_100259582 Ga0070680_1002595822 214
123 3300005338 Ga0068868_100002421 Ga0068868_10000242110 214
124 3300005338 Ga0068868_100010035 Ga0068868_1000100354 214
125 3300005340 Ga0070689_100033013 Ga0070689_1000330133 214
126 3300005340 Ga0070689_100200007 Ga0070689_1002000072 214
127 3300005343 Ga0070687_100048792 Ga0070687_1000487923 214
128 3300005354 Ga0070675_100690097 Ga0070675_1006900971 214
129 3300005364 Ga0070673_100115740 Ga0070673_1001157402 214
130 3300005364 Ga0070673_100378987 Ga0070673_1003789872 214
131 3300005364 Ga0070673_100395217 Ga0070673_1003952171 214
132 3300005367 Ga0070667_100299904 Ga0070667_1002999042 214
133 3300005438 Ga0070701_10035149 Ga0070701_100351492 214
134 3300005439 Ga0070711_100574800 Ga0070711_1005748002 214
135 3300005441 Ga0070700_100286793 Ga0070700_1002867932 214
136 3300005444 Ga0070694_100028998 Ga0070694_1000289983 214
137 3300005455 Ga0070663_100202416 Ga0070663_1002024162 214
138 3300005457 Ga0070662_100191376 Ga0070662_1001913762 214
139 3300005458 Ga0070681_10000228 Ga0070681_1000022825 214
140 3300005459 Ga0068867_100068402 Ga0068867_1000684022 214
141 3300005518 Ga0070699_100005250 Ga0070699_1000052502 214
142 3300005518 Ga0070699_100109264 Ga0070699_1001092643 214
143 3300005530 Ga0070679_100195439 Ga0070679_1001954392 214
144 3300005543 Ga0070672_100364926 Ga0070672_1003649262 214
145 3300005544 Ga0070686_100013015 Ga0070686_1000130156 214
146 3300005546 Ga0070696_100152013 Ga0070696_1001520134 214
147 3300005548 Ga0070665_100037212 Ga0070665_1000372124 214
148 3300005548 Ga0070665_100421251 Ga0070665_1004212512 214
149 3300005549 Ga0070704_100427291 Ga0070704_1004272912 214
150 3300005563 Ga0068855_100243810 Ga0068855_1002438102 214
151 3300005578 Ga0068854_100059924 Ga0068854_1000599242 214
152 3300005578 Ga0068854_100623253 Ga0068854_1006232532 214
153 3300005614 Ga0068856_100131814 Ga0068856_1001318142 214
154 3300005617 Ga0068859_100067271 Ga0068859_1000672712 214
155 3300005617 Ga0068859_100080455 Ga0068859_1000804553 214
156 3300005617 Ga0068859_100144519 Ga0068859_1001445191 214
157 3300005617 Ga0068859_100192221 Ga0068859_1001922212 214
158 3300005618 Ga0068864_100023782 Ga0068864_1000237823 214
159 3300005618 Ga0068864_100860044 Ga0068864_1008600442 214
160 3300005718 Ga0068866_10008425 Ga0068866_100084252 214
161 3300005718 Ga0068866_10587046 Ga0068866_105870461 214
162 3300005719 Ga0068861_100176017 Ga0068861_1001760172 214
163 3300005840 Ga0068870_10204896 Ga0068870_102048962 214
164 3300005841 Ga0068863_100042981 Ga0068863_1000429814 214
165 3300005842 Ga0068858_100019140 Ga0068858_1000191404 214
166 3300005842 Ga0068858_100540801 Ga0068858_1005408011 214
167 3300005843 Ga0068860_100031320 Ga0068860_1000313202 214
168 3300005843 Ga0068860_100324733 Ga0068860_1003247333 214
169 3300005844 Ga0068862_100018354 Ga0068862_1000183545 214
170 3300005844 Ga0068862_100084837 Ga0068862_1000848372 214
171 3300005844 Ga0068862_100633300 Ga0068862_1006333002 214
172 3300005985 Ga0081539_10002070 Ga0081539_1000207029 214
173 3300006237 Ga0097621_100001735 Ga0097621_1000017352 214
174 3300006237 Ga0097621_100701947 Ga0097621_1007019472 214
175 3300006844 Ga0075428_100002549 Ga0075428_1000025497 214
176 3300006844 Ga0075428_100340535 Ga0075428_1003405352 214
177 3300006846 Ga0075430_100003518 Ga0075430_1000035183 214
178 3300006852 Ga0075433_10006513 Ga0075433_100065137 214
179 3300006871 Ga0075434_100000779 Ga0075434_10000077916 214
180 3300006871 Ga0075434_100004244 Ga0075434_1000042442 214
181 3300006880 Ga0075429_100434890 Ga0075429_1004348902 214
182 3300006881 Ga0068865_100115138 Ga0068865_1001151382 214
183 3300006881 Ga0068865_100223663 Ga0068865_1002236632 214
184 3300006914 Ga0075436_100003752 Ga0075436_1000037528 214
185 3300006914 Ga0075436_100237500 Ga0075436_1002375002 214
186 3300006931 Ga0097620_100067272 Ga0097620_1000672722 214
187 3300006931 Ga0097620_100080457 Ga0097620_1000804573 214
188 3300006931 Ga0097620_100144519 Ga0097620_1001445193 214
189 3300006931 Ga0097620_100192205 Ga0097620_1001922052 214
190 3300007076 Ga0075435_100000515 Ga0075435_10000051511 214
191 3300007076 Ga0075435_100004009 Ga0075435_10000400910 214
192 3300009094 Ga0111539_10026571 Ga0111539_100265712 214
193 3300009094 Ga0111539_10033070 Ga0111539_100330702 214
194 3300009094 Ga0111539_10595602 Ga0111539_105956022 214
195 3300009094 Ga0111539_10813267 Ga0111539_108132671 214
196 3300009094 Ga0111539_11337089 Ga0111539_113370892 214
197 3300009098 Ga0105245_10006762 Ga0105245_100067622 214
198 3300009101 Ga0105247_10059608 Ga0105247_100596082 214
199 3300009147 Ga0114129_10001579 Ga0114129_1000157916 214
200 3300009147 Ga0114129_10146824 Ga0114129_101468242 214
201 3300009148 Ga0105243_10007499 Ga0105243_100074999 214
202 3300009148 Ga0105243_10326408 Ga0105243_103264082 214
203 3300009176 Ga0105242_10005621 Ga0105242_100056211 214
204 3300009176 Ga0105242_10080654 Ga0105242_100806542 214
205 3300009177 Ga0105248_10480705 Ga0105248_104807052 214
206 3300009553 Ga0105249_10008774 Ga0105249_100087742 214
207 3300009553 Ga0105249_10284850 Ga0105249_102848502 214
208 3300010375 Ga0105239_10051923 Ga0105239_100519233 214
209 3300010375 Ga0105239_10228845 Ga0105239_102288452 214
210 3300010375 Ga0105239_10887034 Ga0105239_108870342 214
211 3300011119 Ga0105246_11042468 Ga0105246_110424681 214
212 3300013296 Ga0157374_10581793 Ga0157374_105817931 214
213 3300013297 Ga0157378_10009721 Ga0157378_100097212 214
214 3300013297 Ga0157378_10075838 Ga0157378_100758382 214
215 3300013297 Ga0157378_10333240 Ga0157378_103332402 214
216 3300013306 Ga0163162_10360640 Ga0163162_103606401 214
217 3300013308 Ga0157375_10140633 Ga0157375_101406332 214
218 3300013308 Ga0157375_10553434 Ga0157375_105534342 214
219 3300014326 Ga0157380_10035078 Ga0157380_100350782 214
220 3300014968 Ga0157379_10157765 Ga0157379_101577652 214
221 3300014969 Ga0157376_10079461 Ga0157376_100794613 214
222 3300025904 Ga0207647_10032371 Ga0207647_100323712 214
223 3300025911 Ga0207654_10118974 Ga0207654_101189742 214
224 3300025912 Ga0207707_10002679 Ga0207707_100026794 214
225 3300025916 Ga0207663_10299438 Ga0207663_102994382 214
226 3300025917 Ga0207660_10679026 Ga0207660_106790262 214
227 3300025918 Ga0207662_10122765 Ga0207662_101227652 214
228 3300025921 Ga0207652_10016948 Ga0207652_100169485 214
229 3300025924 Ga0207694_10386612 Ga0207694_103866122 214
230 3300025927 Ga0207687_10391161 Ga0207687_103911612 214
231 3300025929 Ga0207664_10300651 Ga0207664_103006512 214
232 3300025936 Ga0207670_10030388 Ga0207670_100303883 214
233 3300025936 Ga0207670_10203205 Ga0207670_102032052 214
234 3300025936 Ga0207670_10245180 Ga0207670_102451802 214
235 3300025936 Ga0207670_10549272 Ga0207670_105492722 214
236 3300025937 Ga0207669_10041616 Ga0207669_100416162 214
237 3300025938 Ga0207704_10003363 Ga0207704_100033637 214
238 3300025938 Ga0207704_10179712 Ga0207704_101797122 214
239 3300025939 Ga0207665_10301388 Ga0207665_103013882 214
240 3300025940 Ga0207691_10365012 Ga0207691_103650122 214
241 3300025941 Ga0207711_10022078 Ga0207711_100220784 214
242 3300025941 Ga0207711_10129563 Ga0207711_101295632 214
243 3300025942 Ga0207689_10011395 Ga0207689_100113952 214
244 3300025942 Ga0207689_10028017 Ga0207689_100280172 214
245 3300025960 Ga0207651_10315009 Ga0207651_103150092 214
246 3300025960 Ga0207651_10337549 Ga0207651_103375492 214
247 3300025981 Ga0207640_10047272 Ga0207640_100472724 214
248 3300025981 Ga0207640_11038548 Ga0207640_110385481 214
249 3300026023 Ga0207677_10013514 Ga0207677_100135142 214
250 3300026023 Ga0207677_10400423 Ga0207677_104004232 214
251 3300026067 Ga0207678_10229471 Ga0207678_102294712 214
252 3300026075 Ga0207708_10312417 Ga0207708_103124172 214
253 3300026095 Ga0207676_10305364 Ga0207676_103053642 214
254 3300026118 Ga0207675_100125210 Ga0207675_1001252102 214
255 3300026121 Ga0207683_10656720 Ga0207683_106567201 214
256 3300027378 Ga0209981_1002786 Ga0209981_10027862 214
257 3300027395 Ga0209996_1003797 Ga0209996_10037972 214
258 3300027907 Ga0207428_10002048 Ga0207428_100020485 214
259 3300027907 Ga0207428_10223283 Ga0207428_102232832 214
260 3300028379 Ga0268266_10040643 Ga0268266_100406432 214
261 3300028379 Ga0268266_10089172 Ga0268266_100891722 214
262 3300028380 Ga0268265_10107343 Ga0268265_101073432 214
263 3300028380 Ga0268265_11154247 Ga0268265_111542471 214
264 3300028381 Ga0268264_10833026 Ga0268264_108330262 214
265 3300031250 Ga0265331_10233449 Ga0265331_102334492 214
266 3300031548 Ga0307408_100433673 Ga0307408_1004336732 214
267 3300031665 Ga0316575_10094374 Ga0316575_100943742 214
268 3300031995 Ga0307409_100543890 Ga0307409_1005438901 214
269 3300031995 Ga0307409_100774999 Ga0307409_1007749992 214
270 3300032002 Ga0307416_100699797 Ga0307416_1006997972 214
271 3300032002 Ga0307416_100841781 Ga0307416_1008417812 214
272 3300032005 Ga0307411_10014725 Ga0307411_100147255 214
273 3300034818 Ga0373950_0048794 Ga0373950_0048794_135_782 214
274 3300034819 Ga0373958_0035091 Ga0373958_0035091_145_792 214
275 3300034957 Ga0373938_0088558 Ga0373938_0088558_107_751 214
276 3300035083 Ga0373926_0018166 Ga0373926_0018166_819_1466 214
277 3300035084 Ga0373928_0018795 Ga0373928_0018795_66_713 214
278 3300035085 Ga0373929_0008000 Ga0373929_0008000_672_1316 214
279 3300035088 Ga0373940_0016356 Ga0373940_0016356_134_781 214
280 3300035089 Ga0373944_0005567 Ga0373944_0005567_169_816 214
281 3300035091 Ga0373951_0081779 Ga0373951_0081779_115_759 214
282 3300035111 Ga0373923_0159776 Ga0373923_0159776_71_718 214
283 3300035112 Ga0373932_0035709 Ga0373932_0035709_239_886 214
284 3300035112 Ga0373932_0056412 Ga0373932_0056412_265_912 214
285 3300035112 Ga0373932_0069518 Ga0373932_0069518_34_681 214
286 3300035113 Ga0373936_0057151 Ga0373936_0057151_869_1516 214
287 3300035114 Ga0373939_0003379 Ga0373939_0003379_2327_2974 214
288 3300035114 Ga0373939_0026682 Ga0373939_0026682_221_865 214
289 3300035114 Ga0373939_0068877 Ga0373939_0068877_138_785 214
290 3300035115 Ga0373941_0037500 Ga0373941_0037500_58_702 214
291 3300035115 Ga0373941_0068064 Ga0373941_0068064_140_787 214
292 3300035116 Ga0373945_0002098 Ga0373945_0002098_322_969 214
293 3300035121 Ga0373960_0026544 Ga0373960_0026544_612_1259 214
294 3300035121 Ga0373960_0039531 Ga0373960_0039531_362_1006 214
295 3300035241 Ga0373961_0003172 Ga0373961_0003172_396_1040 214
296 3300035242 Ga0373962_0074392 Ga0373962_0074392_179_826 214
297 3300035398 Ga0316574_0008034 Ga0316574_0008034_2642_3292 214
298 3300035410 Ga0373924_0088624 Ga0373924_0088624_161_808 214
299 3300035691 Ga0373931_0000717 Ga0373931_0000717_10930_11574 214
300 3300035691 Ga0373931_0000741 Ga0373931_0000741_10644_11291 214
301 3300035691 Ga0373931_0058957 Ga0373931_0058957_189_836 214
302 3300035695 Ga0373927_0017359 Ga0373927_0017359_993_1640 214
303 3300035724 Ga0373933_0094758 Ga0373933_0094758_1184_1828 214
304 3300041408 Ga0439453_0004586 Ga0439453_0004586_1369_2016 214
305 3300042001 Ga0439441_003316 Ga0439441_003316_1398_2045 214
306 3300042117 Ga0450913_002852 Ga0450913_002852_410_1057 214
307 3300042436 Ga0439435_0016000 Ga0439435_0016000_326_973 214
308 3300042437 Ga0439444_0001626 Ga0439444_0001626_1583_2230 214
309 3300042461 Ga0439460_0048948 Ga0439460_0048948_65_712 214
310 3300042876 Ga0451577_0036589 Ga0451577_0036589_458_1105 214
311 3300042876 Ga0451577_0246936 Ga0451577_0246936_48_695 214
312 3300042876 Ga0451577_0256899 Ga0451577_0256899_893_1537 214
313 3300044683 Ga0466965_0194795 Ga0466965_0194795_355_999 214
314 3300044712 Ga0453684_0433550 Ga0453684_0433550_11_658 214
315 3300045051 Ga0451576_0000756 Ga0451576_0000756_42578_43225 214
316 3300045051 Ga0451576_0045877 Ga0451576_0045877_3680_4327 214
317 3300045051 Ga0451576_0273885 Ga0451576_0273885_883_1530 214
318 3300045051 Ga0451576_0365381 Ga0451576_0365381_610_1254 214
319 3300045051 Ga0451576_1590619 Ga0451576_1590619_23_667 214
320 3300046462 Ga0495651_0158700 Ga0495651_0158700_877_1527 214
321 3300046473 Ga0495582_0069727 Ga0495582_0069727_536_1183 214
322 3300046475 Ga0495639_0004956 Ga0495639_0004956_1987_2634 214
323 3300046525 Ga0495663_0131318 Ga0495663_0131318_133_777 214
324 3300046526 Ga0495666_0030451 Ga0495666_0030451_1609_2256 214
325 3300046528 Ga0495642_0055473 Ga0495642_0055473_498_1145 214
326 3300046531 Ga0495665_0016268 Ga0495665_0016268_816_1463 214
327 3300046535 Ga0495586_0014364 Ga0495586_0014364_486_1133 214
328 3300046537 Ga0495598_0002062 Ga0495598_0002062_1405_2049 214
329 3300046674 Ga0495588_0027725 Ga0495588_0027725_1742_2389 214
330 3300046681 Ga0495647_0000667 Ga0495647_0000667_1742_2389 214
331 3300046683 Ga0495658_0020309 Ga0495658_0020309_2577_3224 214
332 3300046684 Ga0495669_0274497 Ga0495669_0274497_23_670 214
333 3300047317 Ga0495604_0302905 Ga0495604_0302905_42_692 214
334 3300047318 Ga0495636_0124504 Ga0495636_0124504_196_840 214
335 3300047321 Ga0495676_0071188 Ga0495676_0071188_688_1335 214
336 3300048905 Ga0496102_0456729 Ga0496102_0456729_258_908 214
337 3300048911 Ga0496108_0093201 Ga0496108_0093201_255_905 214
338 3300048912 Ga0496109_0924802 Ga0496109_0924802_76_726 214
339 3300048914 Ga0496111_0195947 Ga0496111_0195947_263_913 214
340 3300048916 Ga0496113_0201612 Ga0496113_0201612_488_1138 214
341 3300049568 Ga0501031_0103636 Ga0501031_0103636_715_1362 214
342 3300049568 Ga0501031_0150296 Ga0501031_0150296_323_970 214
343 3300049575 Ga0501039_0147033 Ga0501039_0147033_274_924 214
344 3300049575 Ga0501039_0434885 Ga0501039_0434885_190_837 214
345 3300049576 Ga0501040_0022022 Ga0501040_0022022_2338_2985 214
346 3300049577 Ga0501041_0325688 Ga0501041_0325688_198_845 214
347 3300049578 Ga0501042_0105006 Ga0501042_0105006_1350_1997 214
348 3300049580 Ga0501046_0269367 Ga0501046_0269367_396_1043 214
349 3300049582 Ga0501048_0077197 Ga0501048_0077197_14_661 214
350 3300049583 Ga0501067_0054106 Ga0501067_0054106_597_1256 214
351 3300049585 Ga0501069_0308059 Ga0501069_0308059_194_838 214
352 3300049587 Ga0501071_0041833 Ga0501071_0041833_2404_3051 214
353 3300049588 Ga0501072_0075339 Ga0501072_0075339_1915_2562 214
354 3300049588 Ga0501072_0324622 Ga0501072_0324622_113_805 214
355 3300049588 Ga0501072_0865157 Ga0501072_0865157_46_693 214
356 3300049591 Ga0501075_0084651 Ga0501075_0084651_859_1506 214
357 3300049592 Ga0501076_0126858 Ga0501076_0126858_663_1310 214
358 3300049592 Ga0501076_0976540 Ga0501076_0976540_33_680 214
359 3300049743 Ga0501081_0187831 Ga0501081_0187831_112_762 214
360 3300049743 Ga0501081_0197722 Ga0501081_0197722_682_1329 214
361 3300049743 Ga0501081_0356109 Ga0501081_0356109_198_845 214
362 3300049824 Ga0501045_0043305 Ga0501045_0043305_1936_2583 214
363 3300050507 nmdc:mga05p37_2350_c1 nmdc:mga05p37_2350_c1_13768_14415 214
364 3300050507 nmdc:mga05p37_800370_c1 nmdc:mga05p37_800370_c1_288_935 214
365 3300050508 nmdc:mga09592_156754_c1 nmdc:mga09592_156754_c1_966_1613 214
366 3300050509 nmdc:mga0qj67_8294_c1 nmdc:mga0qj67_8294_c1_4706_5353 214
367 3300050510 nmdc:mga06r32_110623_c1 nmdc:mga06r32_110623_c1_289_936 214
368 3300050510 nmdc:mga06r32_508580_c1 nmdc:mga06r32_508580_c1_520_1164 214
369 3300050511 nmdc:mga08y16_394645_c1 nmdc:mga08y16_394645_c1_216_863 214
370 3300050511 nmdc:mga08y16_438388_c1 nmdc:mga08y16_438388_c1_171_818 214
371 3300050511 nmdc:mga08y16_5615_c1 nmdc:mga08y16_5615_c1_579_1226 214
372 3300050511 nmdc:mga08y16_738850_c1 nmdc:mga08y16_738850_c1_153_803 214
373 3300050512 nmdc:mga0n895_11021_c1 nmdc:mga0n895_11021_c1_621_1268 214
374 3300050512 nmdc:mga0n895_186126_c1 nmdc:mga0n895_186126_c1_28_678 214
375 3300050512 nmdc:mga0n895_260_c1 nmdc:mga0n895_260_c1_18768_19412 214
376 3300050513 nmdc:mga0rr50_1143_c1 nmdc:mga0rr50_1143_c1_1693_2337 214
377 3300050513 nmdc:mga0rr50_2307_c1 nmdc:mga0rr50_2307_c1_6770_7417 214
378 3300050513 nmdc:mga0rr50_811053_c1 nmdc:mga0rr50_811053_c1_112_759 214
379 3300050514 nmdc:mga08x19_1280_c1 nmdc:mga08x19_1280_c1_5099_5746 214
380 3300050515 nmdc:mga0a205_2190_c1 nmdc:mga0a205_2190_c1_7314_7961 214
381 3300054114 Ga0501084_0183176 Ga0501084_0183176_445_1092 214
382 iso_pu_bacteria 8006964411 8006968182 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

32

177

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9077 2 213
3d31-assembly1.cif.gz_A modbc from methanosarcina acetivorans 0.9065 1 213
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9063 2 213
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9045 2 213
1b0u-assembly1.cif.gz_A-2 atp-binding subunit of the histidine permease from salmonella typhimurium 0.9037 2 213
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.942 1 213 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 2 70 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 1 213 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9318 1 213 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9238 2 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2H5W4K4-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivF 0.9844 2 213 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A520W562-F1-model_v4 ATP-binding cassette domain-containing protein 0.9806 1 211 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A426VCW3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9804 1 213 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7C2FUK1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9804 1 212 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A426VCW3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9759 1 213 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.9 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map