F429097

General Info

Members Datasets Scaffolds Average Seq Length
381 237 762 147

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0000044|Ga0500635_0000044_6504_7046
Length 180
Sequence MLPVMGIIVSQRKPRLYAGTCLWSVLTMLGSMQRMPIKLENVGIAVRDLDEAISFFSDLGLSVMGRDTISGEWADTAVGIDGNHAKIAVLQTPDGHGQLELFEYIHPAEAIETAPTLPNEIGMHRVAFSVDDIDEALEIAAKHGCLPLRGVATYEDVYKLTYLRGPSGIIVMLAQELKKS

Samples

Sample ID Description Type Environment
1 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
121 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
206 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
207 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
208 2643221546 Microbacterium sp. Root53 Isolate Unclassified
209 2643221615 Nocardioides sp. Root224 Isolate Unclassified
210 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
211 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
212 2643221711 Terrabacter sp. Root85 Isolate Unclassified
213 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
214 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
215 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
216 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
217 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
218 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
219 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
220 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
221 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
222 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
223 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
224 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
225 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
226 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
227 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
228 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
229 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
230 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
231 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
232 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
233 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
234 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
235 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
236 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
237 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.5
Metatranscriptomes 1.84
Isolates 8.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 13.65
Nodule 0
Rhizoplane 10.5
Rhizosphere 60.1
Stem 0
Stem Tuber 0.26
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500635_0000044 3300053080 Bacteria 87331
2 JGI25154J39366_1001263 3300002738 Bacteria 9455
3 JGI25164J39214_1000598 3300002772 Bacteria 15791
4 JGI25165J46597_1000002 3300003214 Bacteria 765387
5 Ga0055539_1000090 3300003752 Bacteria 112260
6 Ga0055533_1000001 3300003756 Bacteria 1863437
7 Ga0055525_1000126 3300003759 Bacteria 115430
8 Ga0055527_1000091 3300003760 Bacteria 70221
9 Ga0055542_1000216 3300003762 Bacteria 70219
10 Ga0055529_1000234 3300003763 Bacteria 70241
11 Ga0065714_10069588 3300005288 Bacteria 4167
12 Ga0065714_10305695 3300005288 Bacteria 688
13 Ga0070658_10000090 3300005327 Bacteria 81871
14 Ga0070658_10214387 3300005327 Bacteria 1627
15 Ga0070683_100010237 3300005329 Bacteria 8055
16 Ga0070668_100033683 3300005347 Bacteria 3902
17 Ga0070668_101152939 3300005347 Bacteria 701
18 Ga0070671_100008564 3300005355 Bacteria 8202
19 Ga0070659_100153260 3300005366 Bacteria 1881
20 Ga0070659_100848612 3300005366 Bacteria 796
21 Ga0070667_100001739 3300005367 Bacteria 19455
22 Ga0070710_10027864 3300005437 Bacteria 3017
23 Ga0070663_100317291 3300005455 Bacteria 1252
24 Ga0070678_101938473 3300005456 Bacteria 557
25 Ga0070706_100008831 3300005467 Bacteria 9389
26 Ga0070684_100147975 3300005535 Bacteria 2126
27 Ga0068853_100335852 3300005539 Bacteria 1403
28 Ga0070665_100040723 3300005548 Bacteria 4669
29 Ga0070665_100167668 3300005548 Bacteria 2198
30 Ga0068855_100582287 3300005563 Bacteria 1208
31 Ga0068856_100547027 3300005614 Bacteria 1179
32 Ga0068852_100571973 3300005616 Bacteria 1132
33 Ga0068864_100229660 3300005618 Bacteria 1716
34 Ga0068863_100014971 3300005841 Bacteria 7450
35 Ga0068858_100037678 3300005842 Bacteria 4485
36 Ga0068860_100005253 3300005843 Bacteria 13144
37 Ga0081455_10078999 3300005937 Bacteria 2703
38 Ga0081540_1146505 3300005983 Bacteria 939
39 Ga0070717_10173755 3300006028 Bacteria 1875
40 Ga0075363_100003308 3300006048 Bacteria 6828
41 Ga0075363_100022961 3300006048 Bacteria 3158
42 Ga0075363_100262801 3300006048 Bacteria 996
43 Ga0075364_10127751 3300006051 Bacteria 1705
44 Ga0075364_10613000 3300006051 Bacteria 744
45 Ga0075367_10000964 3300006178 Bacteria 11746
46 Ga0075369_10211989 3300006186 Bacteria 896
47 Ga0075370_10008827 3300006353 Bacteria 5204
48 Ga0075370_10310959 3300006353 Bacteria 938
49 Ga0075370_10348971 3300006353 Bacteria 884
50 Ga0105244_10016555 3300009036 Bacteria 4197
51 Ga0105247_10322381 3300009101 Bacteria 1078
52 Ga0105243_10314759 3300009148 Bacteria 1424
53 Ga0105249_10183467 3300009553 Bacteria 2037
54 Ga0105239_12040751 3300010375 Bacteria 666
55 Ga0157371_10310594 3300013102 Bacteria 1142
56 Ga0157371_10925008 3300013102 Bacteria 662
57 Ga0157370_10063421 3300013104 Bacteria 3501
58 Ga0157370_10224619 3300013104 Bacteria 1739
59 Ga0157370_10256127 3300013104 Bacteria 1618
60 Ga0157370_10348431 3300013104 Bacteria 1365
61 Ga0157369_10000398 3300013105 Bacteria 57899
62 Ga0157369_10056660 3300013105 Bacteria 4229
63 Ga0163162_10119238 3300013306 Bacteria 2741
64 Ga0157372_10622993 3300013307 Bacteria 1257
65 Ga0157375_10372668 3300013308 Bacteria 1594
66 Ga0157375_10451863 3300013308 Bacteria 1450
67 Ga0157375_10593296 3300013308 Bacteria 1267
68 Ga0157375_10675601 3300013308 Bacteria 1188
69 Ga0163163_10241938 3300014325 Bacteria 1854
70 Ga0157380_10047470 3300014326 Bacteria 3378
71 Ga0182008_10031876 3300014497 Bacteria 2650
72 Ga0157379_10068902 3300014968 Bacteria 3163
73 Ga0157379_10306171 3300014968 Bacteria 1449
74 Ga0206353_10815863 3300020082 Bacteria 720
75 Ga0209566_100066 3300025225 Bacteria 186951
76 Ga0209674_100001 3300025226 Bacteria 4013750
77 Ga0209672_100006 3300025228 Bacteria 1004497
78 Ga0209147_100370 3300025229 Bacteria 31762
79 Ga0209563_100001 3300025230 Bacteria 4013775
80 Ga0207427_100329 3300025231 Bacteria 31805
81 Ga0209437_101085 3300025233 Bacteria 8710
82 Ga0209258_101558 3300025242 Bacteria 7663
83 Ga0209646_1000085 3300025246 Bacteria 197351
84 Ga0209677_100001 3300025253 Bacteria 4013787
85 Ga0209148_1000152 3300025254 Bacteria 153782
86 Ga0209233_1000001 3300025261 Bacteria 2992747
87 Ga0209455_1000134 3300025272 Bacteria 153783
88 Ga0209051_1002863 3300025303 Bacteria 11864
89 Ga0207655_1016205 3300025728 Bacteria 4091
90 Ga0207692_10020306 3300025898 Bacteria 3019
91 Ga0207680_10006857 3300025903 Bacteria 5527
92 Ga0207680_10475891 3300025903 Bacteria 888
93 Ga0207705_10000006 3300025909 Bacteria 657147
94 Ga0207684_10015571 3300025910 Bacteria 6543
95 Ga0207657_10082673 3300025919 Bacteria 2695
96 Ga0207644_10010503 3300025931 Bacteria 6103
97 Ga0207690_10101210 3300025932 Bacteria 2058
98 Ga0207690_10494536 3300025932 Bacteria 989
99 Ga0207712_10101835 3300025961 Bacteria 2137
100 Ga0207668_10073724 3300025972 Bacteria 2447
101 Ga0207658_10018616 3300025986 Bacteria 4800
102 Ga0207658_10266137 3300025986 Bacteria 1463
103 Ga0207703_10056039 3300026035 Bacteria 3208
104 Ga0207678_10289450 3300026067 Bacteria 1407
105 Ga0207678_10370996 3300026067 Bacteria 1236
106 Ga0207702_10588707 3300026078 Bacteria 1091
107 Ga0207641_10026255 3300026088 Bacteria 4806
108 Ga0207641_12438449 3300026088 Bacteria 522
109 Ga0207676_10394930 3300026095 Bacteria 1291
110 Ga0268266_10008553 3300028379 Bacteria 9095
111 Ga0268264_10030452 3300028381 Bacteria 4423
112 Ga0307408_100103328 3300031548 Bacteria 2175
113 Ga0307408_100212350 3300031548 Bacteria 1573
114 Ga0307408_100481778 3300031548 Bacteria 1082
115 Ga0307408_100568848 3300031548 Bacteria 1003
116 Ga0307408_100569116 3300031548 Bacteria 1002
117 Ga0307408_100853829 3300031548 Bacteria 830
118 Ga0307405_10695581 3300031731 Bacteria 841
119 Ga0307413_10534487 3300031824 Bacteria 948
120 Ga0307410_10271368 3300031852 Bacteria 1327
121 Ga0307410_10433380 3300031852 Bacteria 1069
122 Ga0307406_10000791 3300031901 Bacteria 17697
123 Ga0307406_10078121 3300031901 Bacteria 2191
124 Ga0307406_10140186 3300031901 Bacteria 1710
125 Ga0307412_10328166 3300031911 Bacteria 1220
126 Ga0307412_10695841 3300031911 Bacteria 872
127 Ga0307409_100202870 3300031995 Bacteria 1776
128 Ga0307409_100236784 3300031995 Bacteria 1659
129 Ga0307409_100546942 3300031995 Bacteria 1136
130 Ga0307409_101378748 3300031995 Bacteria 731
131 Ga0307416_100150261 3300032002 Bacteria 2135
132 Ga0307416_100791594 3300032002 Bacteria 1043
133 Ga0307414_10074244 3300032004 Bacteria 2463
134 Ga0307414_10141007 3300032004 Bacteria 1887
135 Ga0307414_10234689 3300032004 Bacteria 1515
136 Ga0307414_10554146 3300032004 Bacteria 1025
137 Ga0307411_10278242 3300032005 Bacteria 1331
138 Ga0307411_11108500 3300032005 Bacteria 714
139 Ga0307411_11226686 3300032005 Bacteria 681
140 Ga0307415_100144102 3300032126 Bacteria 1824
141 Ga0307415_100242488 3300032126 Bacteria 1459
142 Ga0307415_100767455 3300032126 Bacteria 877
143 Ga0373925_1469759 3300037068 Bacteria 558
144 Ga0395899_0014357 3300037312 Bacteria 6046
145 Ga0395899_0075948 3300037312 Bacteria 2453
146 Ga0395899_0151365 3300037312 Bacteria 1644
147 Ga0395899_0575757 3300037312 Bacteria 720
148 Ga0395900_0018446 3300037418 Bacteria 7117
149 Ga0395900_0038045 3300037418 Bacteria 4960
150 Ga0395900_0126088 3300037418 Bacteria 2626
151 Ga0395900_0332853 3300037418 Bacteria 1496
152 Ga0395898_0001149 3300037466 Bacteria 40453
153 Ga0395898_0077703 3300037466 Bacteria 3204
154 Ga0395898_0521643 3300037466 Bacteria 1129
155 Ga0395905_0850926 3300037471 Bacteria 815
156 Ga0436364_0383953 3300037853 Bacteria 566
157 Ga0395901_0005212 3300038443 Bacteria 13122
158 Ga0395901_0033680 3300038443 Bacteria 5289
159 Ga0395901_0235809 3300038443 Bacteria 1909
160 Ga0395901_0482099 3300038443 Bacteria 1265
161 Ga0395901_0649446 3300038443 Bacteria 1058
162 Ga0436361_1058882 3300039447 Bacteria 1014
163 Ga0451791_0623053 3300041451 Bacteria 583
164 Ga0451793_0224639 3300041452 Bacteria 612
165 Ga0451797_0232951 3300041453 Bacteria 547
166 Ga0451797_1474083 3300041453 Bacteria 681
167 Ga0451802_0987406 3300041460 Bacteria 692
168 Ga0451802_1962660 3300041460 Bacteria 796
169 Ga0451833_0532435 3300041491 Bacteria 8757
170 Ga0451837_0559807 3300041494 Bacteria 4868
171 Ga0451841_0196689 3300041498 Bacteria 1208
172 Ga0451851_0159219 3300041507 Bacteria 741
173 Ga0451853_0500190 3300041512 Bacteria 581
174 Ga0439442_000673 3300042002 Bacteria 7240
175 Ga0439432_101275 3300042006 Bacteria 861
176 Ga0439457_015927 3300042014 Bacteria 1679
177 Ga0439462_0041284 3300042015 Bacteria 1232
178 Ga0450920_009486 3300042122 Bacteria 1792
179 Ga0450920_009708 3300042122 Bacteria 1774
180 Ga0450907_000493 3300042146 Bacteria 10910
181 Ga0450907_045242 3300042146 Bacteria 755
182 Ga0439434_0004135 3300042435 Bacteria 4239
183 Ga0466972_0062258 3300044658 Bacteria 1788
184 Ga0466965_0271273 3300044683 Bacteria 914
185 Ga0466961_0173064 3300044693 Bacteria 1342
186 Ga0466963_0128548 3300044694 Bacteria 1748
187 Ga0466971_0295330 3300044719 Bacteria 777
188 Ga0466968_0028981 3300044735 Bacteria 2287
189 Ga0466970_0014985 3300044765 Bacteria 3986
190 Ga0466970_0060558 3300044765 Bacteria 2027
191 Ga0466970_0515762 3300044765 Bacteria 689
192 Ga0466958_0134151 3300045836 Bacteria 1556
193 Ga0466967_0118327 3300045976 Bacteria 2444
194 Ga0466967_0145674 3300045976 Bacteria 2209
195 Ga0466967_1121513 3300045976 Bacteria 784
196 Ga0495668_0060824 3300046616 Bacteria 2083
197 Ga0495671_0174414 3300046692 Bacteria 1045
198 Ga0495671_0591037 3300046692 Bacteria 528
199 Ga0495649_0298809 3300046694 Bacteria 820
200 Ga0496100_0000430 3300048903 Bacteria 20393
201 Ga0496100_0013743 3300048903 Bacteria 4682
202 Ga0496100_0364433 3300048903 Bacteria 1094
203 Ga0496101_0000145 3300048904 Bacteria 62824
204 Ga0496101_0124744 3300048904 Bacteria 1950
205 Ga0496101_0323621 3300048904 Bacteria 1210
206 Ga0496101_0633713 3300048904 Bacteria 845
207 Ga0496101_1002600 3300048904 Bacteria 657
208 Ga0496102_0000016 3300048905 Bacteria 286787
209 Ga0496102_0000721 3300048905 Bacteria 32596
210 Ga0496102_0011567 3300048905 Bacteria 7614
211 Ga0496102_0205232 3300048905 Bacteria 1858
212 Ga0496102_0382064 3300048905 Bacteria 1325
213 Ga0496103_0000015 3300048906 Bacteria 287966
214 Ga0496103_0039003 3300048906 Bacteria 2918
215 Ga0496103_0076400 3300048906 Bacteria 2101
216 Ga0496104_0198622 3300048907 Bacteria 1917
217 Ga0496104_0239039 3300048907 Bacteria 1728
218 Ga0496105_0002638 3300048908 Bacteria 13053
219 Ga0496105_0632738 3300048908 Bacteria 827
220 Ga0496106_0114230 3300048909 Bacteria 2105
221 Ga0496107_0013067 3300048910 Bacteria 5801
222 Ga0496108_1434589 3300048911 Bacteria 576
223 Ga0496110_1398079 3300048913 Bacteria 609
224 Ga0496111_0005679 3300048914 Bacteria 8037
225 Ga0496113_0273234 3300048916 Bacteria 1351
226 Ga0496113_1048265 3300048916 Bacteria 641
227 Ga0496114_0006168 3300048917 Bacteria 9433
228 Ga0496114_0044581 3300048917 Bacteria 3681
229 Ga0496114_0047826 3300048917 Bacteria 3557
230 Ga0496114_0168013 3300048917 Bacteria 1910
231 Ga0496115_0008098 3300048918 Bacteria 7764
232 Ga0496115_0460837 3300048918 Bacteria 1025
233 Ga0496115_0536006 3300048918 Bacteria 937
234 Ga0496116_0000055 3300048919 Bacteria 286923
235 Ga0496116_0210702 3300048919 Bacteria 1007
236 Ga0496117_0000006 3300048920 Bacteria 758420
237 Ga0496117_0000276 3300048920 Bacteria 95844
238 Ga0496117_0003112 3300048920 Bacteria 19810
239 Ga0496117_0242192 3300048920 Bacteria 989
240 Ga0496118_0000004 3300048921 Bacteria 758420
241 Ga0496118_0000601 3300048921 Bacteria 59471
242 Ga0496118_0005997 3300048921 Bacteria 13556
243 Ga0496118_0006045 3300048921 Bacteria 13483
244 Ga0496119_0000392 3300048922 Bacteria 60458
245 Ga0496119_0008183 3300048922 Bacteria 9254
246 Ga0496120_0000272 3300048923 Bacteria 86274
247 Ga0496120_0064491 3300048923 Bacteria 2033
248 Ga0496120_0143604 3300048923 Bacteria 1209
249 Ga0496121_0008335 3300048924 Bacteria 12242
250 Ga0496121_0049533 3300048924 Bacteria 3561
251 Ga0496122_0005842 3300048925 Bacteria 14450
252 Ga0496122_0041121 3300048925 Bacteria 3661
253 Ga0496122_0049912 3300048925 Bacteria 3196
254 Ga0496122_0203605 3300048925 Bacteria 1154
255 Ga0496123_0004241 3300048926 Bacteria 15265
256 Ga0496123_0026113 3300048926 Bacteria 4386
257 Ga0496123_0113191 3300048926 Bacteria 1546
258 Ga0496123_0188084 3300048926 Bacteria 1071
259 Ga0496123_0391356 3300048926 Bacteria 635
260 Ga0496124_0002036 3300048927 Bacteria 27465
261 Ga0496124_0096240 3300048927 Bacteria 2405
262 Ga0496124_0174192 3300048927 Bacteria 1663
263 Ga0496125_0027003 3300048928 Bacteria 5213
264 Ga0496126_0000072 3300048929 Bacteria 238130
265 Ga0496126_0200016 3300048929 Bacteria 1688
266 Ga0496126_1237178 3300048929 Bacteria 547
267 Ga0501031_0001048 3300049568 Bacteria 16785
268 Ga0501032_0000955 3300049569 Bacteria 23363
269 Ga0501032_0005833 3300049569 Bacteria 9110
270 Ga0501033_0001191 3300049570 Bacteria 23501
271 Ga0501033_0050244 3300049570 Bacteria 3094
272 Ga0501034_0004408 3300049571 Bacteria 15670
273 Ga0501034_0005849 3300049571 Bacteria 13378
274 Ga0501034_0006116 3300049571 Bacteria 12989
275 Ga0501034_0027157 3300049571 Bacteria 5823
276 Ga0501034_0118882 3300049571 Bacteria 2629
277 Ga0501034_0826050 3300049571 Bacteria 818
278 Ga0501036_0006375 3300049572 Bacteria 9574
279 Ga0501036_0121131 3300049572 Bacteria 2209
280 Ga0501037_0003791 3300049573 Bacteria 10967
281 Ga0501037_0094285 3300049573 Bacteria 2164
282 Ga0501038_0000195 3300049574 Bacteria 52526
283 Ga0501038_0016619 3300049574 Bacteria 6671
284 Ga0501038_0059241 3300049574 Bacteria 3280
285 Ga0501038_0291127 3300049574 Bacteria 1283
286 Ga0501039_0039846 3300049575 Bacteria 3627
287 Ga0501039_0987458 3300049575 Bacteria 654
288 Ga0501040_0084035 3300049576 Bacteria 2208
289 Ga0501042_0027088 3300049578 Bacteria 4030
290 Ga0501042_0278324 3300049578 Bacteria 1208
291 Ga0501043_0002157 3300049579 Bacteria 16786
292 Ga0501043_0005272 3300049579 Bacteria 10450
293 Ga0501043_0061006 3300049579 Bacteria 2961
294 Ga0501046_0001615 3300049580 Bacteria 21554
295 Ga0501047_0007487 3300049581 Bacteria 10273
296 Ga0501047_0135628 3300049581 Bacteria 2341
297 Ga0501048_0000709 3300049582 Bacteria 24346
298 Ga0501048_0805312 3300049582 Bacteria 675
299 Ga0501068_0057031 3300049584 Bacteria 2368
300 Ga0501069_0013142 3300049585 Bacteria 4412
301 Ga0501070_0001006 3300049586 Bacteria 25283
302 Ga0501070_0023367 3300049586 Bacteria 5179
303 Ga0501072_0286869 3300049588 Bacteria 1309
304 Ga0501073_0000569 3300049589 Bacteria 26046
305 Ga0501073_0007680 3300049589 Bacteria 8003
306 Ga0501073_0013066 3300049589 Bacteria 6056
307 Ga0501074_0017024 3300049590 Bacteria 5273
308 Ga0501074_0038252 3300049590 Bacteria 3477
309 Ga0501077_0313602 3300049593 Bacteria 1000
310 Ga0501079_0383425 3300049741 Bacteria 1102
311 Ga0501080_0007899 3300049742 Bacteria 9635
312 Ga0501080_0013382 3300049742 Bacteria 7545
313 Ga0501080_0033540 3300049742 Bacteria 4792
314 Ga0501083_0013130 3300049744 Bacteria 5788
315 Ga0501083_0035410 3300049744 Bacteria 3410
316 Ga0501035_0006928 3300049822 Bacteria 10586
317 Ga0501035_0112975 3300049822 Bacteria 2379
318 Ga0501044_0010541 3300049823 Bacteria 10025
319 Ga0501044_0019092 3300049823 Bacteria 7339
320 Ga0501045_0112929 3300049824 Bacteria 2015
321 nmdc:mga03n38_555727_c1 3300050490 Bacteria 650
322 nmdc:mga03n38_73208_c1 3300050490 Bacteria 1590
323 nmdc:mga00v17_212251_c1 3300050491 Bacteria 1253
324 nmdc:mga00v17_38406_c1 3300050491 Bacteria 2863
325 nmdc:mga00v17_411260_c1 3300050491 Bacteria 879
326 nmdc:mga0yw44_183086_c1 3300050492 Bacteria 1379
327 nmdc:mga0yw44_439269_c1 3300050492 Bacteria 884
328 nmdc:mga07m45_131756_c1 3300050496 Bacteria 1446
329 nmdc:mga07m45_180280_c2 3300050496 Bacteria 528
330 nmdc:mga07m45_203653_c1 3300050496 Bacteria 1151
331 nmdc:mga0sz30_247603_c1 3300050516 Bacteria 793
332 Ga0495619_0180288 3300053085 Bacteria 1461
333 Ga0500559_0000454 3300053136 Bacteria 29202
334 Ga0500559_0000814 3300053136 Bacteria 20301
335 Ga0500573_0002863 3300053140 Bacteria 8767
336 Ga0500573_0262778 3300053140 Bacteria 883
337 Ga0500577_0171609 3300053142 Bacteria 928
338 Ga0500616_0000010 3300053153 Bacteria 761410
339 Ga0500616_0000089 3300053153 Bacteria 191075
340 Ga0500616_0056979 3300053153 Bacteria 2038
341 Ga0500645_007668 3300053730 Bacteria 3738
342 Ga0501084_0002679 3300054114 Bacteria 14335
343 Ga0587084_007740 3300059477 Bacteria 1343
344 Ga0587077_014295 3300059493 Bacteria 1304
345 Ga0587094_110658 3300059513 Bacteria 540
346 Ga0587101_005700 3300059623 Bacteria 1393
347 Ga0587115_052564 3300059626 Bacteria 665
348 Ga0587119_033783 3300059658 Bacteria 710
349 2537900410 2537561592 Bacteria 4348607
350 2552113445 2551306166 Bacteria 9731570
351 2588109338 2585428157 Bacteria 3018951
352 2643754014 2643221546 Bacteria 2910897
353 2644089353 2643221615 Bacteria 5487866
354 2644198373 2643221635 Bacteria 2632343
355 2644319198 2643221657 Bacteria 5490246
356 2644611107 2643221711 Bacteria 4865335
357 2644678768 2643221724 Bacteria 3593515
358 2730228280 2728369380 Bacteria 3620317
359 2753036820 2751185725 Bacteria 5740550
360 2753324691 2751185792 Bacteria 5739090
361 2808879326 2808606366 Bacteria 4415912
362 2808896428 2808606371 Bacteria 4251511
363 2812322270 2811994872 Bacteria 4121241
364 2833712846 2833709550 Bacteria 4008291
365 2848553140 2848551377 Bacteria 3720646
366 2884765344 2884763398 Bacteria 4091164
367 2895662528 2895660088 Bacteria 3782833
368 2904779913 2904776348 Bacteria 4658726
369 2908816498 2908811453 Bacteria 5478616
370 2910813644 2910809715 Bacteria 4982797
371 2919036835 2919034639 Bacteria 4763403
372 2919524478 2919523602 Bacteria 3788128
373 2928121760 2928121344 Bacteria 3972376
374 2939661253 2939660829 Bacteria 3784848
375 2946042539 2946041624 Bacteria 4191385
376 2946062794 2946059875 Bacteria 4386623
377 2964328894 2964326757 Bacteria 3290868
378 2974319977 2974315732 Bacteria 4602776
379 2984523846 2984523437 Bacteria 4508481
380 8045833387 8045830549 Bacteria 4444727
381 8055038773 8055037949 Bacteria 3337834
382 Ga0500635_0000044
383 JGI25154J39366_1001263
384 JGI25164J39214_1000598
385 JGI25165J46597_1000002
386 Ga0055539_1000090
387 Ga0055533_1000001
388 Ga0055525_1000126
389 Ga0055527_1000091
390 Ga0055542_1000216
391 Ga0055529_1000234
392 Ga0065714_10069588
393 Ga0065714_10305695
394 Ga0070658_10000090
395 Ga0070658_10214387
396 Ga0070683_100010237
397 Ga0070668_100033683
398 Ga0070668_101152939
399 Ga0070671_100008564
400 Ga0070659_100153260
401 Ga0070659_100848612
402 Ga0070667_100001739
403 Ga0070710_10027864
404 Ga0070663_100317291
405 Ga0070678_101938473
406 Ga0070706_100008831
407 Ga0070684_100147975
408 Ga0068853_100335852
409 Ga0070665_100040723
410 Ga0070665_100167668
411 Ga0068855_100582287
412 Ga0068856_100547027
413 Ga0068852_100571973
414 Ga0068864_100229660
415 Ga0068863_100014971
416 Ga0068858_100037678
417 Ga0068860_100005253
418 Ga0081455_10078999
419 Ga0081540_1146505
420 Ga0070717_10173755
421 Ga0075363_100003308
422 Ga0075363_100022961
423 Ga0075363_100262801
424 Ga0075364_10127751
425 Ga0075364_10613000
426 Ga0075367_10000964
427 Ga0075369_10211989
428 Ga0075370_10008827
429 Ga0075370_10310959
430 Ga0075370_10348971
431 Ga0105244_10016555
432 Ga0105247_10322381
433 Ga0105243_10314759
434 Ga0105249_10183467
435 Ga0105239_12040751
436 Ga0157371_10310594
437 Ga0157371_10925008
438 Ga0157370_10063421
439 Ga0157370_10224619
440 Ga0157370_10256127
441 Ga0157370_10348431
442 Ga0157369_10000398
443 Ga0157369_10056660
444 Ga0163162_10119238
445 Ga0157372_10622993
446 Ga0157375_10372668
447 Ga0157375_10451863
448 Ga0157375_10593296
449 Ga0157375_10675601
450 Ga0163163_10241938
451 Ga0157380_10047470
452 Ga0182008_10031876
453 Ga0157379_10068902
454 Ga0157379_10306171
455 Ga0206353_10815863
456 Ga0209566_100066
457 Ga0209674_100001
458 Ga0209672_100006
459 Ga0209147_100370
460 Ga0209563_100001
461 Ga0207427_100329
462 Ga0209437_101085
463 Ga0209258_101558
464 Ga0209646_1000085
465 Ga0209677_100001
466 Ga0209148_1000152
467 Ga0209233_1000001
468 Ga0209455_1000134
469 Ga0209051_1002863
470 Ga0207655_1016205
471 Ga0207692_10020306
472 Ga0207680_10006857
473 Ga0207680_10475891
474 Ga0207705_10000006
475 Ga0207684_10015571
476 Ga0207657_10082673
477 Ga0207644_10010503
478 Ga0207690_10101210
479 Ga0207690_10494536
480 Ga0207712_10101835
481 Ga0207668_10073724
482 Ga0207658_10018616
483 Ga0207658_10266137
484 Ga0207703_10056039
485 Ga0207678_10289450
486 Ga0207678_10370996
487 Ga0207702_10588707
488 Ga0207641_10026255
489 Ga0207641_12438449
490 Ga0207676_10394930
491 Ga0268266_10008553
492 Ga0268264_10030452
493 Ga0307408_100103328
494 Ga0307408_100212350
495 Ga0307408_100481778
496 Ga0307408_100568848
497 Ga0307408_100569116
498 Ga0307408_100853829
499 Ga0307405_10695581
500 Ga0307413_10534487
501 Ga0307410_10271368
502 Ga0307410_10433380
503 Ga0307406_10000791
504 Ga0307406_10078121
505 Ga0307406_10140186
506 Ga0307412_10328166
507 Ga0307412_10695841
508 Ga0307409_100202870
509 Ga0307409_100236784
510 Ga0307409_100546942
511 Ga0307409_101378748
512 Ga0307416_100150261
513 Ga0307416_100791594
514 Ga0307414_10074244
515 Ga0307414_10141007
516 Ga0307414_10234689
517 Ga0307414_10554146
518 Ga0307411_10278242
519 Ga0307411_11108500
520 Ga0307411_11226686
521 Ga0307415_100144102
522 Ga0307415_100242488
523 Ga0307415_100767455
524 Ga0373925_1469759
525 Ga0395899_0014357
526 Ga0395899_0075948
527 Ga0395899_0151365
528 Ga0395899_0575757
529 Ga0395900_0018446
530 Ga0395900_0038045
531 Ga0395900_0126088
532 Ga0395900_0332853
533 Ga0395898_0001149
534 Ga0395898_0077703
535 Ga0395898_0521643
536 Ga0395905_0850926
537 Ga0436364_0383953
538 Ga0395901_0005212
539 Ga0395901_0033680
540 Ga0395901_0235809
541 Ga0395901_0482099
542 Ga0395901_0649446
543 Ga0436361_1058882
544 Ga0451791_0623053
545 Ga0451793_0224639
546 Ga0451797_0232951
547 Ga0451797_1474083
548 Ga0451802_0987406
549 Ga0451802_1962660
550 Ga0451833_0532435
551 Ga0451837_0559807
552 Ga0451841_0196689
553 Ga0451851_0159219
554 Ga0451853_0500190
555 Ga0439442_000673
556 Ga0439432_101275
557 Ga0439457_015927
558 Ga0439462_0041284
559 Ga0450920_009486
560 Ga0450920_009708
561 Ga0450907_000493
562 Ga0450907_045242
563 Ga0439434_0004135
564 Ga0466972_0062258
565 Ga0466965_0271273
566 Ga0466961_0173064
567 Ga0466963_0128548
568 Ga0466971_0295330
569 Ga0466968_0028981
570 Ga0466970_0014985
571 Ga0466970_0060558
572 Ga0466970_0515762
573 Ga0466958_0134151
574 Ga0466967_0118327
575 Ga0466967_0145674
576 Ga0466967_1121513
577 Ga0495668_0060824
578 Ga0495671_0174414
579 Ga0495671_0591037
580 Ga0495649_0298809
581 Ga0496100_0000430
582 Ga0496100_0013743
583 Ga0496100_0364433
584 Ga0496101_0000145
585 Ga0496101_0124744
586 Ga0496101_0323621
587 Ga0496101_0633713
588 Ga0496101_1002600
589 Ga0496102_0000016
590 Ga0496102_0000721
591 Ga0496102_0011567
592 Ga0496102_0205232
593 Ga0496102_0382064
594 Ga0496103_0000015
595 Ga0496103_0039003
596 Ga0496103_0076400
597 Ga0496104_0198622
598 Ga0496104_0239039
599 Ga0496105_0002638
600 Ga0496105_0632738
601 Ga0496106_0114230
602 Ga0496107_0013067
603 Ga0496108_1434589
604 Ga0496110_1398079
605 Ga0496111_0005679
606 Ga0496113_0273234
607 Ga0496113_1048265
608 Ga0496114_0006168
609 Ga0496114_0044581
610 Ga0496114_0047826
611 Ga0496114_0168013
612 Ga0496115_0008098
613 Ga0496115_0460837
614 Ga0496115_0536006
615 Ga0496116_0000055
616 Ga0496116_0210702
617 Ga0496117_0000006
618 Ga0496117_0000276
619 Ga0496117_0003112
620 Ga0496117_0242192
621 Ga0496118_0000004
622 Ga0496118_0000601
623 Ga0496118_0005997
624 Ga0496118_0006045
625 Ga0496119_0000392
626 Ga0496119_0008183
627 Ga0496120_0000272
628 Ga0496120_0064491
629 Ga0496120_0143604
630 Ga0496121_0008335
631 Ga0496121_0049533
632 Ga0496122_0005842
633 Ga0496122_0041121
634 Ga0496122_0049912
635 Ga0496122_0203605
636 Ga0496123_0004241
637 Ga0496123_0026113
638 Ga0496123_0113191
639 Ga0496123_0188084
640 Ga0496123_0391356
641 Ga0496124_0002036
642 Ga0496124_0096240
643 Ga0496124_0174192
644 Ga0496125_0027003
645 Ga0496126_0000072
646 Ga0496126_0200016
647 Ga0496126_1237178
648 Ga0501031_0001048
649 Ga0501032_0000955
650 Ga0501032_0005833
651 Ga0501033_0001191
652 Ga0501033_0050244
653 Ga0501034_0004408
654 Ga0501034_0005849
655 Ga0501034_0006116
656 Ga0501034_0027157
657 Ga0501034_0118882
658 Ga0501034_0826050
659 Ga0501036_0006375
660 Ga0501036_0121131
661 Ga0501037_0003791
662 Ga0501037_0094285
663 Ga0501038_0000195
664 Ga0501038_0016619
665 Ga0501038_0059241
666 Ga0501038_0291127
667 Ga0501039_0039846
668 Ga0501039_0987458
669 Ga0501040_0084035
670 Ga0501042_0027088
671 Ga0501042_0278324
672 Ga0501043_0002157
673 Ga0501043_0005272
674 Ga0501043_0061006
675 Ga0501046_0001615
676 Ga0501047_0007487
677 Ga0501047_0135628
678 Ga0501048_0000709
679 Ga0501048_0805312
680 Ga0501068_0057031
681 Ga0501069_0013142
682 Ga0501070_0001006
683 Ga0501070_0023367
684 Ga0501072_0286869
685 Ga0501073_0000569
686 Ga0501073_0007680
687 Ga0501073_0013066
688 Ga0501074_0017024
689 Ga0501074_0038252
690 Ga0501077_0313602
691 Ga0501079_0383425
692 Ga0501080_0007899
693 Ga0501080_0013382
694 Ga0501080_0033540
695 Ga0501083_0013130
696 Ga0501083_0035410
697 Ga0501035_0006928
698 Ga0501035_0112975
699 Ga0501044_0010541
700 Ga0501044_0019092
701 Ga0501045_0112929
702 nmdc:mga03n38_555727_c1
703 nmdc:mga03n38_73208_c1
704 nmdc:mga00v17_212251_c1
705 nmdc:mga00v17_38406_c1
706 nmdc:mga00v17_411260_c1
707 nmdc:mga0yw44_183086_c1
708 nmdc:mga0yw44_439269_c1
709 nmdc:mga07m45_131756_c1
710 nmdc:mga07m45_180280_c2
711 nmdc:mga07m45_203653_c1
712 nmdc:mga0sz30_247603_c1
713 Ga0495619_0180288
714 Ga0500559_0000454
715 Ga0500559_0000814
716 Ga0500573_0002863
717 Ga0500573_0262778
718 Ga0500577_0171609
719 Ga0500616_0000010
720 Ga0500616_0000089
721 Ga0500616_0056979
722 Ga0500645_007668
723 Ga0501084_0002679
724 Ga0587084_007740
725 Ga0587077_014295
726 Ga0587094_110658
727 Ga0587101_005700
728 Ga0587115_052564
729 Ga0587119_033783
730 2537900410
731 2552113445
732 2588109338
733 2643754014
734 2644089353
735 2644198373
736 2644319198
737 2644611107
738 2644678768
739 2730228280
740 2753036820
741 2753324691
742 2808879326
743 2808896428
744 2812322270
745 2833712846
746 2848553140
747 2884765344
748 2895662528
749 2904779913
750 2908816498
751 2910813644
752 2919036835
753 2919524478
754 2928121760
755 2939661253
756 2946042539
757 2946062794
758 2964328894
759 2974319977
760 2984523846
761 8045833387
762 8055038773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

173

0.83

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

40

162

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9008 1 142
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8777 1 142
2p7o-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (tetragonal form) 0.7932 1 140
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7898 1 140
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7862 3 140
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8772 1 142 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8686 88 142 3.30.720.110
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8657 1 142 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8312 90 139 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8201 90 142 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4Y3NGU3-F1-model_v4 VOC domain-containing protein 0.9474 57 142
AF-A0A3Q9UCY6-F1-model_v4 Methylmalonyl-CoA epimerase (VOC family protein) 0.942 1 143 GO:0004493
GO:0046491
AF-A0A222TM84-F1-model_v4 deleted 0.9416 1 145
AF-A0A2U1ZPC6-F1-model_v4 VOC domain-containing protein 0.9404 1 145 GO:0004493
GO:0046491
AF-A0A1H0Z3D9-F1-model_v4 Catechol 2,3-dioxygenase 0.9404 1 142 GO:0004493
GO:0046491
GO:0051213

Map