F429046

General Info

Members Datasets Scaffolds Average Seq Length
381 214 762 330

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0134301|Ga0495628_0134301_105_1205
Length 366
Sequence LIPVAKRQYQDWHLLGAGGLFPPAASLAQPSAVAGDTMSAAASPVTPDQPGWLDPELATLTQDRFSDPGWIFERKLDGERCLAFTSGRQVRLMTRNQKEDTSTYPEITEALAAQAGSFIIDGEIVAFDGGQTRFARLQQRLGVRHPGLDLRAAVPVCYYIFDVLWAGGRDMRPLPLRQRKQILRGLLTFAGPLRFTEHIDTDGEAYFRQACASGWEGVIAKRADAPYRAGRTKDWLKFKCEAGQEFVIGGFTDPRGTRTGFGALLLGYYDPGHDLVYAGKVGTGFTQQTLDSLHATLAGLEQDRPPFDRGHLPRSGVHWVQPRLVAEVGFSEWTTDGELRHPRFQGLRDDKDPADVIREMPQQSGK

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
210 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
211 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
212 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
213 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
214 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0.26
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.94
Rhizosphere 92.39
Stem 0
Stem Tuber 0.26
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0134301 3300046516 Bacteria 1892
2 Ga0070683_100345903 3300005329 Bacteria 1416
3 Ga0068868_100020120 3300005338 Bacteria 5008
4 Ga0070671_100072007 3300005355 Bacteria 2885
5 Ga0070709_10000457 3300005434 Bacteria 24352
6 Ga0070709_10107741 3300005434 Bacteria 1868
7 Ga0070714_100004758 3300005435 Bacteria 10278
8 Ga0070714_100004878 3300005435 Bacteria 10183
9 Ga0070713_100004730 3300005436 Bacteria 9203
10 Ga0070713_100059307 3300005436 Bacteria 3196
11 Ga0070713_100177038 3300005436 Bacteria 1914
12 Ga0070710_10000366 3300005437 Bacteria 21196
13 Ga0070710_10001280 3300005437 Bacteria 11935
14 Ga0070711_100007664 3300005439 Bacteria 6574
15 Ga0070708_100002810 3300005445 Bacteria 13520
16 Ga0070708_100009643 3300005445 Bacteria 7787
17 Ga0070708_100245849 3300005445 Bacteria 1680
18 Ga0070681_10089841 3300005458 Bacteria 3023
19 Ga0070706_100000437 3300005467 Bacteria 50114
20 Ga0070706_100013465 3300005467 Bacteria 7563
21 Ga0070706_100018104 3300005467 Bacteria 6498
22 Ga0070706_100018147 3300005467 Bacteria 6491
23 Ga0070706_100021408 3300005467 Bacteria 5955
24 Ga0070706_100028863 3300005467 Bacteria 5109
25 Ga0070707_100000137 3300005468 Bacteria 68751
26 Ga0070707_100000147 3300005468 Bacteria 67308
27 Ga0070707_100075577 3300005468 Bacteria 3249
28 Ga0070707_100159950 3300005468 Bacteria 2194
29 Ga0070698_100000334 3300005471 Bacteria 48431
30 Ga0070698_100000566 3300005471 Bacteria 39728
31 Ga0070698_100005808 3300005471 Bacteria 13498
32 Ga0070698_100006367 3300005471 Bacteria 12815
33 Ga0070698_100009213 3300005471 Bacteria 10594
34 Ga0070698_100021032 3300005471 Bacteria 6835
35 Ga0070698_100070986 3300005471 Bacteria 3493
36 Ga0070698_100135811 3300005471 Bacteria 2413
37 Ga0070699_100022862 3300005518 Bacteria 5387
38 Ga0070699_100406370 3300005518 Bacteria 1231
39 Ga0070679_100298759 3300005530 Bacteria 1561
40 Ga0070679_100357991 3300005530 Bacteria 1407
41 Ga0070684_100129473 3300005535 Bacteria 2276
42 Ga0070684_100145041 3300005535 Bacteria 2148
43 Ga0070697_100001519 3300005536 Bacteria 17640
44 Ga0070697_100039904 3300005536 Bacteria 3796
45 Ga0070665_100139658 3300005548 Bacteria 2426
46 Ga0068855_100054849 3300005563 Bacteria 4684
47 Ga0068855_100133610 3300005563 Bacteria 2832
48 Ga0070664_100050096 3300005564 Bacteria 3533
49 Ga0068856_100049446 3300005614 Bacteria 4144
50 Ga0068856_100057268 3300005614 Bacteria 3848
51 Ga0068856_100129258 3300005614 Bacteria 2530
52 Ga0068852_100305612 3300005616 Bacteria 1541
53 Ga0068863_100259195 3300005841 Bacteria 1681
54 Ga0068858_100048340 3300005842 Bacteria 3943
55 Ga0068860_100066724 3300005843 Bacteria 3418
56 Ga0081455_10122965 3300005937 Bacteria 2042
57 Ga0081538_10010485 3300005981 Bacteria 7599
58 Ga0081540_1000582 3300005983 Bacteria 35204
59 Ga0070717_10008039 3300006028 Bacteria 7863
60 Ga0070717_10045847 3300006028 Bacteria 3575
61 Ga0070717_10126760 3300006028 Bacteria 2192
62 Ga0070717_10149781 3300006028 Bacteria 2018
63 Ga0070715_10014979 3300006163 Bacteria 2884
64 Ga0070716_100002591 3300006173 Bacteria 8356
65 Ga0070712_100017056 3300006175 Bacteria 4695
66 Ga0070712_100018913 3300006175 Bacteria 4483
67 Ga0097621_100196388 3300006237 Bacteria 1750
68 Ga0097621_100205572 3300006237 Bacteria 1711
69 Ga0068871_100063269 3300006358 Bacteria 3026
70 Ga0068871_100184200 3300006358 Bacteria 1796
71 Ga0075428_100053502 3300006844 Unclassified 4423
72 Ga0075428_100117270 3300006844 Bacteria 2900
73 Ga0075431_100314068 3300006847 Bacteria 1581
74 Ga0075433_10010514 3300006852 Bacteria 7432
75 Ga0075434_100044663 3300006871 Bacteria 4394
76 Ga0075436_100003896 3300006914 Bacteria 10228
77 Ga0075436_100070555 3300006914 Bacteria 2415
78 Ga0075436_100077725 3300006914 Bacteria 2299
79 Ga0075435_100003957 3300007076 Bacteria 10127
80 Ga0075435_100241970 3300007076 Bacteria 1535
81 Ga0099794_10036882 3300007265 Bacteria 2312
82 Ga0099794_10088055 3300007265 Bacteria 1538
83 Ga0111539_10031752 3300009094 Bacteria 6416
84 Ga0105245_10061201 3300009098 Bacteria 3393
85 Ga0114129_10076811 3300009147 Bacteria 4648
86 Ga0105241_10048884 3300009174 Bacteria 3220
87 Ga0105238_10074196 3300009551 Bacteria 3395
88 Ga0105249_10368125 3300009553 Bacteria 1460
89 Ga0105239_10360569 3300010375 Bacteria 1642
90 Ga0157369_10192698 3300013105 Bacteria 2141
91 Ga0163162_10408352 3300013306 Bacteria 1491
92 Ga0157372_10028985 3300013307 Bacteria 6040
93 Ga0157372_10325097 3300013307 Bacteria 1791
94 Ga0163163_10020658 3300014325 Bacteria 6205
95 Ga0157379_10036363 3300014968 Bacteria 4392
96 Ga0157379_10384449 3300014968 Bacteria 1288
97 Ga0157376_10015515 3300014969 Bacteria 5756
98 Ga0157376_10026506 3300014969 Bacteria 4582
99 Ga0206353_10608718 3300020082 Bacteria 1251
100 Ga0213876_10017434 3300021384 Bacteria 3792
101 Ga0213875_10000171 3300021388 Bacteria 68278
102 Ga0207692_10003072 3300025898 Bacteria 6480
103 Ga0207692_10009900 3300025898 Bacteria 3996
104 Ga0207692_10016076 3300025898 Bacteria 3304
105 Ga0207647_10053504 3300025904 Bacteria 2487
106 Ga0207685_10021159 3300025905 Bacteria 2175
107 Ga0207685_10055380 3300025905 Bacteria 1548
108 Ga0207699_10000396 3300025906 Bacteria 22569
109 Ga0207699_10080911 3300025906 Bacteria 2014
110 Ga0207684_10000007 3300025910 Bacteria 612969
111 Ga0207684_10000015 3300025910 Bacteria 427232
112 Ga0207684_10000905 3300025910 Bacteria 33727
113 Ga0207684_10015172 3300025910 Bacteria 6635
114 Ga0207684_10026516 3300025910 Bacteria 4940
115 Ga0207684_10027832 3300025910 Bacteria 4815
116 Ga0207684_10157240 3300025910 Bacteria 1956
117 Ga0207654_10034780 3300025911 Bacteria 2801
118 Ga0207695_10244943 3300025913 Bacteria 1693
119 Ga0207671_10337459 3300025914 Bacteria 1194
120 Ga0207693_10007064 3300025915 Bacteria 9267
121 Ga0207693_10018133 3300025915 Bacteria 5609
122 Ga0207693_10023770 3300025915 Bacteria 4863
123 Ga0207663_10005718 3300025916 Bacteria 6290
124 Ga0207663_10010288 3300025916 Bacteria 4973
125 Ga0207652_10389787 3300025921 Bacteria 1257
126 Ga0207646_10000292 3300025922 Bacteria 68174
127 Ga0207646_10000398 3300025922 Bacteria 58325
128 Ga0207646_10005444 3300025922 Bacteria 13387
129 Ga0207646_10078697 3300025922 Bacteria 2947
130 Ga0207646_10144894 3300025922 Bacteria 2140
131 Ga0207694_10028845 3300025924 Bacteria 4233
132 Ga0207700_10002375 3300025928 Bacteria 10823
133 Ga0207700_10010319 3300025928 Bacteria 5886
134 Ga0207700_10112878 3300025928 Bacteria 2190
135 Ga0207664_10003089 3300025929 Bacteria 11060
136 Ga0207664_10025255 3300025929 Bacteria 4473
137 Ga0207664_10038217 3300025929 Bacteria 3720
138 Ga0207644_10238466 3300025931 Bacteria 1447
139 Ga0207665_10000853 3300025939 Bacteria 20605
140 Ga0207665_10009981 3300025939 Bacteria 6233
141 Ga0207665_10099733 3300025939 Bacteria 2026
142 Ga0207665_10108386 3300025939 Bacteria 1948
143 Ga0207679_10041266 3300025945 Bacteria 3308
144 Ga0207667_10080160 3300025949 Bacteria 3382
145 Ga0207703_10136270 3300026035 Bacteria 2125
146 Ga0207702_10043318 3300026078 Bacteria 3779
147 Ga0207702_10435809 3300026078 Bacteria 1269
148 Ga0207641_10238639 3300026088 Bacteria 1693
149 Ga0207674_10200692 3300026116 Bacteria 1944
150 Ga0207675_100362933 3300026118 Bacteria 1421
151 Ga0207698_10268831 3300026142 Bacteria 1571
152 Ga0268264_10292131 3300028381 Bacteria 1531
153 Ga0265336_10025032 3300028666 Bacteria 1881
154 Ga0265338_10002851 3300028800 Bacteria 25265
155 Ga0307513_10010057 3300031456 Bacteria 11917
156 Ga0307405_10031884 3300031731 Bacteria 3108
157 Ga0307405_10293086 3300031731 Bacteria 1231
158 Ga0316577_10099733 3300031733 Bacteria 1628
159 Ga0307413_10150385 3300031824 Bacteria 1621
160 Ga0307410_10054291 3300031852 Bacteria 2715
161 Ga0307410_10059313 3300031852 Bacteria 2612
162 Ga0307410_10083450 3300031852 Bacteria 2250
163 Ga0307410_10112598 3300031852 Bacteria 1971
164 Ga0307406_10291970 3300031901 Bacteria 1248
165 Ga0307407_10039572 3300031903 Bacteria 2623
166 Ga0307407_10152389 3300031903 Bacteria 1503
167 Ga0307409_100020415 3300031995 Bacteria 4514
168 Ga0307409_100032896 3300031995 Bacteria 3767
169 Ga0307409_100283244 3300031995 Bacteria 1533
170 Ga0307416_100007066 3300032002 Bacteria 7092
171 Ga0307416_100028796 3300032002 Bacteria 4137
172 Ga0307416_100082334 3300032002 Bacteria 2726
173 Ga0307414_10078990 3300032004 Bacteria 2400
174 Ga0307411_10007832 3300032005 Bacteria 5483
175 Ga0307415_100029405 3300032126 Bacteria 3511
176 Ga0307415_100179968 3300032126 Bacteria 1658
177 Ga0307415_100375341 3300032126 Bacteria 1205
178 Ga0316214_1002605 3300033545 Bacteria 2224
179 Ga0373930_0022931 3300034816 Bacteria 1238
180 Ga0373958_0007854 3300034819 Bacteria 1712
181 Ga0373959_0012060 3300034820 Bacteria 1537
182 Ga0373938_0006071 3300034957 Bacteria 2073
183 Ga0373934_0016510 3300035086 Bacteria 2806
184 Ga0373944_0018088 3300035089 Bacteria 2010
185 Ga0373944_0020516 3300035089 Bacteria 1905
186 Ga0373951_0009835 3300035091 Bacteria 2150
187 Ga0373923_0050498 3300035111 Bacteria 1742
188 Ga0373936_0096219 3300035113 Bacteria 1245
189 Ga0373945_0016984 3300035116 Bacteria 2462
190 Ga0373953_0007514 3300035117 Bacteria 3655
191 Ga0373954_0028504 3300035118 Bacteria 2567
192 Ga0373954_0089779 3300035118 Bacteria 1475
193 Ga0373956_0010904 3300035119 Bacteria 3737
194 Ga0373956_0114579 3300035119 Bacteria 1256
195 Ga0373957_0002186 3300035120 Bacteria 5527
196 Ga0373943_0041001 3300035170 Bacteria 2237
197 Ga0373946_0095811 3300035171 Bacteria 1322
198 Ga0373955_0002758 3300035172 Bacteria 7704
199 Ga0373961_0036134 3300035241 Bacteria 1405
200 Ga0373962_0008326 3300035242 Bacteria 2550
201 Ga0373924_0003009 3300035410 Bacteria 5735
202 Ga0373935_0026706 3300035692 Bacteria 3566
203 Ga0373927_0094182 3300035695 Bacteria 1946
204 Ga0373933_0002261 3300035724 Bacteria 10985
205 Ga0373947_0066415 3300035725 Bacteria 2201
206 Ga0373937_0027128 3300036401 Bacteria 5177
207 Ga0373925_0010043 3300037068 Bacteria 6876
208 Ga0373925_0037454 3300037068 Bacteria 3581
209 Ga0395900_0041268 3300037418 Bacteria 4757
210 Ga0395898_0333205 3300037466 Bacteria 1447
211 Ga0436364_1374271 3300037853 Bacteria 119265
212 Ga0395901_0270680 3300038443 Unclassified 1767
213 Ga0395901_0403983 3300038443 Bacteria 1403
214 Ga0436365_1863936 3300039437 Bacteria 9205
215 Ga0436363_0160860 3300039450 Bacteria 1214
216 Ga0466972_0007805 3300044658 Bacteria 5370
217 Ga0466972_0021943 3300044658 Bacteria 3181
218 Ga0466961_0005205 3300044693 Bacteria 8186
219 Ga0466961_0042071 3300044693 Bacteria 2929
220 Ga0466961_0071064 3300044693 Bacteria 2209
221 Ga0466961_0082326 3300044693 Bacteria 2036
222 Ga0466961_0089022 3300044693 Bacteria 1950
223 Ga0466963_0000786 3300044694 Bacteria 15785
224 Ga0466963_0002983 3300044694 Bacteria 9563
225 Ga0466963_0021419 3300044694 Bacteria 4078
226 Ga0466963_0035636 3300044694 Bacteria 3242
227 Ga0466963_0042529 3300044694 Bacteria 2984
228 Ga0466963_0043773 3300044694 Bacteria 2945
229 Ga0466963_0292456 3300044694 Bacteria 1145
230 Ga0466964_0004229 3300044706 Bacteria 5288
231 Ga0466971_0006437 3300044719 Bacteria 5102
232 Ga0466971_0030069 3300044719 Bacteria 2430
233 Ga0466968_0003861 3300044735 Bacteria 5564
234 Ga0466968_0064293 3300044735 Bacteria 1587
235 Ga0466970_0018507 3300044765 Bacteria 3607
236 Ga0466970_0089802 3300044765 Bacteria 1667
237 Ga0466957_0022820 3300044842 Bacteria 3695
238 Ga0466957_0027813 3300044842 Bacteria 3362
239 Ga0466960_0000435 3300044901 Bacteria 14256
240 Ga0466960_0171045 3300044901 Bacteria 1172
241 Ga0466959_0035995 3300045049 Bacteria 3658
242 Ga0466959_0039882 3300045049 Bacteria 3471
243 Ga0466959_0066683 3300045049 Bacteria 2611
244 Ga0466958_0005090 3300045836 Bacteria 7024
245 Ga0466958_0008742 3300045836 Bacteria 5622
246 Ga0466958_0019731 3300045836 Bacteria 3924
247 Ga0466958_0081831 3300045836 Bacteria 1987
248 Ga0466958_0145903 3300045836 Bacteria 1491
249 Ga0466958_0196880 3300045836 Bacteria 1282
250 Ga0466967_0000279 3300045976 Bacteria 22606
251 Ga0466967_0004769 3300045976 Bacteria 9234
252 Ga0466967_0007230 3300045976 Bacteria 7980
253 Ga0466967_0007626 3300045976 Bacteria 7830
254 Ga0466967_0010290 3300045976 Bacteria 7005
255 Ga0466967_0011633 3300045976 Bacteria 6682
256 Ga0466967_0015603 3300045976 Bacteria 5958
257 Ga0466967_0041022 3300045976 Bacteria 3987
258 Ga0466967_0043222 3300045976 Bacteria 3900
259 Ga0466967_0045210 3300045976 Bacteria 3825
260 Ga0466967_0052847 3300045976 Bacteria 3569
261 Ga0466967_0115231 3300045976 Bacteria 2474
262 Ga0466967_0243950 3300045976 Bacteria 1714
263 Ga0495592_0003357 3300046454 Bacteria 11461
264 Ga0495592_0126814 3300046454 Bacteria 1789
265 Ga0495603_0026790 3300046455 Bacteria 3482
266 Ga0495603_0256712 3300046455 Bacteria 1006
267 Ga0495629_0030334 3300046459 Bacteria 3834
268 Ga0495641_0026882 3300046461 Bacteria 2804
269 Ga0495641_0098698 3300046461 Bacteria 1303
270 Ga0495651_0009830 3300046462 Bacteria 7353
271 Ga0495653_0003145 3300046463 Bacteria 13233
272 Ga0495580_0034500 3300046472 Bacteria 3643
273 Ga0495580_0248481 3300046472 Bacteria 1218
274 Ga0495582_0009480 3300046473 Bacteria 5362
275 Ga0495582_0040374 3300046473 Bacteria 2570
276 Ga0495639_0102508 3300046475 Bacteria 1352
277 Ga0495662_0021922 3300046476 Bacteria 3087
278 Ga0495664_0036079 3300046477 Bacteria 2913
279 Ga0495608_0040677 3300046511 Bacteria 3113
280 Ga0495618_0018084 3300046514 Bacteria 4326
281 Ga0495618_0095111 3300046514 Bacteria 1905
282 Ga0495628_0077071 3300046516 Bacteria 2593
283 Ga0495630_0075129 3300046517 Bacteria 2546
284 Ga0495630_0128406 3300046517 Bacteria 1924
285 Ga0495630_0163339 3300046517 Bacteria 1695
286 Ga0495652_0059550 3300046529 Bacteria 3231
287 Ga0495652_0191636 3300046529 Bacteria 1559
288 Ga0495652_0279619 3300046529 Bacteria 1223
289 Ga0495665_0003908 3300046531 Bacteria 8063
290 Ga0495640_0009580 3300046533 Bacteria 7533
291 Ga0495640_0013493 3300046533 Bacteria 6209
292 Ga0495640_0028601 3300046533 Bacteria 4011
293 Ga0495586_0028296 3300046535 Bacteria 2999
294 Ga0495586_0050390 3300046535 Bacteria 2253
295 Ga0495587_0002500 3300046536 Bacteria 12273
296 Ga0495587_0024093 3300046536 Bacteria 3734
297 Ga0495645_0034194 3300046543 Bacteria 3709
298 Ga0495645_0045283 3300046543 Bacteria 3209
299 Ga0495634_0010219 3300046642 Bacteria 6883
300 Ga0495634_0034387 3300046642 Bacteria 3478
301 Ga0495634_0258001 3300046642 Bacteria 1064
302 Ga0495635_0015630 3300046663 Bacteria 5302
303 Ga0495657_0046534 3300046675 Bacteria 2936
304 Ga0495599_0024136 3300046678 Bacteria 3802
305 Ga0495599_0110158 3300046678 Bacteria 1715
306 Ga0495623_0191482 3300046679 Bacteria 1181
307 Ga0495646_0003022 3300046680 Bacteria 10422
308 Ga0495646_0009816 3300046680 Bacteria 6082
309 Ga0495658_0022343 3300046683 Bacteria 3344
310 Ga0495658_0113620 3300046683 Bacteria 1631
311 Ga0495613_0009952 3300046689 Bacteria 7065
312 Ga0495613_0028262 3300046689 Bacteria 4171
313 Ga0495624_0027267 3300046690 Bacteria 3740
314 Ga0495624_0038977 3300046690 Bacteria 3049
315 Ga0495600_0015079 3300046809 Bacteria 4880
316 Ga0495600_0042031 3300046809 Bacteria 2979
317 Ga0495581_0003647 3300047315 Bacteria 8867
318 Ga0495581_0006450 3300047315 Bacteria 6806
319 Ga0495604_0116646 3300047317 Bacteria 1938
320 Ga0495674_0041572 3300047319 Bacteria 4106
321 Ga0495674_0113971 3300047319 Bacteria 2289
322 Ga0495674_0134596 3300047319 Bacteria 2080
323 Ga0495676_0052715 3300047321 Bacteria 3245
324 Ga0495676_0054160 3300047321 Bacteria 3190
325 Ga0495680_0075547 3300047322 Bacteria 2556
326 Ga0495675_0060848 3300047444 Bacteria 2392
327 Ga0495684_0014257 3300047471 Bacteria 6116
328 Ga0495684_0032598 3300047471 Bacteria 4000
329 Ga0495684_0042223 3300047471 Bacteria 3493
330 Ga0495593_0012416 3300047673 Bacteria 4870
331 Ga0495593_0028605 3300047673 Bacteria 3061
332 Ga0495602_0032823 3300048088 Bacteria 4882
333 Ga0495602_0181008 3300048088 Bacteria 1625
334 Ga0496100_0234536 3300048903 Bacteria 1351
335 Ga0496103_0010127 3300048906 Bacteria 5575
336 Ga0496104_0011478 3300048907 Bacteria 7938
337 Ga0496104_0060928 3300048907 Bacteria 3575
338 Ga0496105_0111280 3300048908 Bacteria 2260
339 Ga0496106_0136581 3300048909 Bacteria 1926
340 Ga0496107_0118422 3300048910 Bacteria 1950
341 Ga0496108_0071400 3300048911 Bacteria 2929
342 Ga0496108_0081427 3300048911 Bacteria 2743
343 Ga0496108_0122320 3300048911 Bacteria 2233
344 Ga0496110_0291511 3300048913 Bacteria 1486
345 Ga0496111_0053223 3300048914 Bacteria 2924
346 Ga0496111_0186736 3300048914 Bacteria 1541
347 Ga0496112_0108858 3300048915 Bacteria 2741
348 Ga0496115_0083070 3300048918 Bacteria 2610
349 Ga0496126_0000027 3300048929 Bacteria 396518
350 Ga0496126_0287769 3300048929 Bacteria 1360
351 Ga0501047_0325558 3300049581 Bacteria 1376
352 nmdc:mga05p37_14743_c1 3300050507 Bacteria 9388
353 nmdc:mga06r32_101240_c1 3300050510 Unclassified 2827
354 nmdc:mga06r32_330370_c1 3300050510 Bacteria 1510
355 nmdc:mga08y16_65585_c1 3300050511 Bacteria 3790
356 nmdc:mga0n895_15717_c1 3300050512 Bacteria 6917
357 nmdc:mga0n895_39751_c1 3300050512 Bacteria 4567
358 nmdc:mga0rr50_76229_c1 3300050513 Bacteria 2574
359 nmdc:mga08x19_121029_c1 3300050514 Bacteria 1755
360 nmdc:mga08x19_39648_c1 3300050514 Bacteria 2994
361 nmdc:mga08x19_44787_c1 3300050514 Bacteria 2826
362 nmdc:mga0a205_13214_c1 3300050515 Bacteria 7674
363 nmdc:mga0a205_169351_c1 3300050515 Bacteria 2080
364 Ga0495601_0081888 3300053077 Bacteria 2072
365 Ga0495595_0002745 3300053084 Bacteria 6913
366 Ga0495595_0028183 3300053084 Bacteria 2507
367 Ga0495619_0023226 3300053085 Bacteria 3974
368 Ga0495619_0030475 3300053085 Bacteria 3492
369 Ga0495619_0070075 3300053085 Bacteria 2344
370 Ga0500556_0000911 3300053104 Bacteria 16352
371 Ga0500599_001521 3300053736 Bacteria 2681
372 Ga0466962_0005495 3300061719 Bacteria 6091
373 Ga0466962_0017579 3300061719 Bacteria 3443
374 Ga0466962_0030696 3300061719 Bacteria 2574
375 Ga0466962_0115230 3300061719 Bacteria 1295
376 2776372323 2775506925 Bacteria 7237746
377 2863071382 2863067949 Bacteria 8541735
378 2866557089 2866552031 Bacteria 5824618
379 2899369912 2899359706 Bacteria 10940472
380 2899374631 2899370129 Bacteria 6781179
381 8056207810 8056207758 Bacteria 8639239
382 Ga0495628_0134301
383 Ga0070683_100345903
384 Ga0068868_100020120
385 Ga0070671_100072007
386 Ga0070709_10000457
387 Ga0070709_10107741
388 Ga0070714_100004758
389 Ga0070714_100004878
390 Ga0070713_100004730
391 Ga0070713_100059307
392 Ga0070713_100177038
393 Ga0070710_10000366
394 Ga0070710_10001280
395 Ga0070711_100007664
396 Ga0070708_100002810
397 Ga0070708_100009643
398 Ga0070708_100245849
399 Ga0070681_10089841
400 Ga0070706_100000437
401 Ga0070706_100013465
402 Ga0070706_100018104
403 Ga0070706_100018147
404 Ga0070706_100021408
405 Ga0070706_100028863
406 Ga0070707_100000137
407 Ga0070707_100000147
408 Ga0070707_100075577
409 Ga0070707_100159950
410 Ga0070698_100000334
411 Ga0070698_100000566
412 Ga0070698_100005808
413 Ga0070698_100006367
414 Ga0070698_100009213
415 Ga0070698_100021032
416 Ga0070698_100070986
417 Ga0070698_100135811
418 Ga0070699_100022862
419 Ga0070699_100406370
420 Ga0070679_100298759
421 Ga0070679_100357991
422 Ga0070684_100129473
423 Ga0070684_100145041
424 Ga0070697_100001519
425 Ga0070697_100039904
426 Ga0070665_100139658
427 Ga0068855_100054849
428 Ga0068855_100133610
429 Ga0070664_100050096
430 Ga0068856_100049446
431 Ga0068856_100057268
432 Ga0068856_100129258
433 Ga0068852_100305612
434 Ga0068863_100259195
435 Ga0068858_100048340
436 Ga0068860_100066724
437 Ga0081455_10122965
438 Ga0081538_10010485
439 Ga0081540_1000582
440 Ga0070717_10008039
441 Ga0070717_10045847
442 Ga0070717_10126760
443 Ga0070717_10149781
444 Ga0070715_10014979
445 Ga0070716_100002591
446 Ga0070712_100017056
447 Ga0070712_100018913
448 Ga0097621_100196388
449 Ga0097621_100205572
450 Ga0068871_100063269
451 Ga0068871_100184200
452 Ga0075428_100053502
453 Ga0075428_100117270
454 Ga0075431_100314068
455 Ga0075433_10010514
456 Ga0075434_100044663
457 Ga0075436_100003896
458 Ga0075436_100070555
459 Ga0075436_100077725
460 Ga0075435_100003957
461 Ga0075435_100241970
462 Ga0099794_10036882
463 Ga0099794_10088055
464 Ga0111539_10031752
465 Ga0105245_10061201
466 Ga0114129_10076811
467 Ga0105241_10048884
468 Ga0105238_10074196
469 Ga0105249_10368125
470 Ga0105239_10360569
471 Ga0157369_10192698
472 Ga0163162_10408352
473 Ga0157372_10028985
474 Ga0157372_10325097
475 Ga0163163_10020658
476 Ga0157379_10036363
477 Ga0157379_10384449
478 Ga0157376_10015515
479 Ga0157376_10026506
480 Ga0206353_10608718
481 Ga0213876_10017434
482 Ga0213875_10000171
483 Ga0207692_10003072
484 Ga0207692_10009900
485 Ga0207692_10016076
486 Ga0207647_10053504
487 Ga0207685_10021159
488 Ga0207685_10055380
489 Ga0207699_10000396
490 Ga0207699_10080911
491 Ga0207684_10000007
492 Ga0207684_10000015
493 Ga0207684_10000905
494 Ga0207684_10015172
495 Ga0207684_10026516
496 Ga0207684_10027832
497 Ga0207684_10157240
498 Ga0207654_10034780
499 Ga0207695_10244943
500 Ga0207671_10337459
501 Ga0207693_10007064
502 Ga0207693_10018133
503 Ga0207693_10023770
504 Ga0207663_10005718
505 Ga0207663_10010288
506 Ga0207652_10389787
507 Ga0207646_10000292
508 Ga0207646_10000398
509 Ga0207646_10005444
510 Ga0207646_10078697
511 Ga0207646_10144894
512 Ga0207694_10028845
513 Ga0207700_10002375
514 Ga0207700_10010319
515 Ga0207700_10112878
516 Ga0207664_10003089
517 Ga0207664_10025255
518 Ga0207664_10038217
519 Ga0207644_10238466
520 Ga0207665_10000853
521 Ga0207665_10009981
522 Ga0207665_10099733
523 Ga0207665_10108386
524 Ga0207679_10041266
525 Ga0207667_10080160
526 Ga0207703_10136270
527 Ga0207702_10043318
528 Ga0207702_10435809
529 Ga0207641_10238639
530 Ga0207674_10200692
531 Ga0207675_100362933
532 Ga0207698_10268831
533 Ga0268264_10292131
534 Ga0265336_10025032
535 Ga0265338_10002851
536 Ga0307513_10010057
537 Ga0307405_10031884
538 Ga0307405_10293086
539 Ga0316577_10099733
540 Ga0307413_10150385
541 Ga0307410_10054291
542 Ga0307410_10059313
543 Ga0307410_10083450
544 Ga0307410_10112598
545 Ga0307406_10291970
546 Ga0307407_10039572
547 Ga0307407_10152389
548 Ga0307409_100020415
549 Ga0307409_100032896
550 Ga0307409_100283244
551 Ga0307416_100007066
552 Ga0307416_100028796
553 Ga0307416_100082334
554 Ga0307414_10078990
555 Ga0307411_10007832
556 Ga0307415_100029405
557 Ga0307415_100179968
558 Ga0307415_100375341
559 Ga0316214_1002605
560 Ga0373930_0022931
561 Ga0373958_0007854
562 Ga0373959_0012060
563 Ga0373938_0006071
564 Ga0373934_0016510
565 Ga0373944_0018088
566 Ga0373944_0020516
567 Ga0373951_0009835
568 Ga0373923_0050498
569 Ga0373936_0096219
570 Ga0373945_0016984
571 Ga0373953_0007514
572 Ga0373954_0028504
573 Ga0373954_0089779
574 Ga0373956_0010904
575 Ga0373956_0114579
576 Ga0373957_0002186
577 Ga0373943_0041001
578 Ga0373946_0095811
579 Ga0373955_0002758
580 Ga0373961_0036134
581 Ga0373962_0008326
582 Ga0373924_0003009
583 Ga0373935_0026706
584 Ga0373927_0094182
585 Ga0373933_0002261
586 Ga0373947_0066415
587 Ga0373937_0027128
588 Ga0373925_0010043
589 Ga0373925_0037454
590 Ga0395900_0041268
591 Ga0395898_0333205
592 Ga0436364_1374271
593 Ga0395901_0270680
594 Ga0395901_0403983
595 Ga0436365_1863936
596 Ga0436363_0160860
597 Ga0466972_0007805
598 Ga0466972_0021943
599 Ga0466961_0005205
600 Ga0466961_0042071
601 Ga0466961_0071064
602 Ga0466961_0082326
603 Ga0466961_0089022
604 Ga0466963_0000786
605 Ga0466963_0002983
606 Ga0466963_0021419
607 Ga0466963_0035636
608 Ga0466963_0042529
609 Ga0466963_0043773
610 Ga0466963_0292456
611 Ga0466964_0004229
612 Ga0466971_0006437
613 Ga0466971_0030069
614 Ga0466968_0003861
615 Ga0466968_0064293
616 Ga0466970_0018507
617 Ga0466970_0089802
618 Ga0466957_0022820
619 Ga0466957_0027813
620 Ga0466960_0000435
621 Ga0466960_0171045
622 Ga0466959_0035995
623 Ga0466959_0039882
624 Ga0466959_0066683
625 Ga0466958_0005090
626 Ga0466958_0008742
627 Ga0466958_0019731
628 Ga0466958_0081831
629 Ga0466958_0145903
630 Ga0466958_0196880
631 Ga0466967_0000279
632 Ga0466967_0004769
633 Ga0466967_0007230
634 Ga0466967_0007626
635 Ga0466967_0010290
636 Ga0466967_0011633
637 Ga0466967_0015603
638 Ga0466967_0041022
639 Ga0466967_0043222
640 Ga0466967_0045210
641 Ga0466967_0052847
642 Ga0466967_0115231
643 Ga0466967_0243950
644 Ga0495592_0003357
645 Ga0495592_0126814
646 Ga0495603_0026790
647 Ga0495603_0256712
648 Ga0495629_0030334
649 Ga0495641_0026882
650 Ga0495641_0098698
651 Ga0495651_0009830
652 Ga0495653_0003145
653 Ga0495580_0034500
654 Ga0495580_0248481
655 Ga0495582_0009480
656 Ga0495582_0040374
657 Ga0495639_0102508
658 Ga0495662_0021922
659 Ga0495664_0036079
660 Ga0495608_0040677
661 Ga0495618_0018084
662 Ga0495618_0095111
663 Ga0495628_0077071
664 Ga0495630_0075129
665 Ga0495630_0128406
666 Ga0495630_0163339
667 Ga0495652_0059550
668 Ga0495652_0191636
669 Ga0495652_0279619
670 Ga0495665_0003908
671 Ga0495640_0009580
672 Ga0495640_0013493
673 Ga0495640_0028601
674 Ga0495586_0028296
675 Ga0495586_0050390
676 Ga0495587_0002500
677 Ga0495587_0024093
678 Ga0495645_0034194
679 Ga0495645_0045283
680 Ga0495634_0010219
681 Ga0495634_0034387
682 Ga0495634_0258001
683 Ga0495635_0015630
684 Ga0495657_0046534
685 Ga0495599_0024136
686 Ga0495599_0110158
687 Ga0495623_0191482
688 Ga0495646_0003022
689 Ga0495646_0009816
690 Ga0495658_0022343
691 Ga0495658_0113620
692 Ga0495613_0009952
693 Ga0495613_0028262
694 Ga0495624_0027267
695 Ga0495624_0038977
696 Ga0495600_0015079
697 Ga0495600_0042031
698 Ga0495581_0003647
699 Ga0495581_0006450
700 Ga0495604_0116646
701 Ga0495674_0041572
702 Ga0495674_0113971
703 Ga0495674_0134596
704 Ga0495676_0052715
705 Ga0495676_0054160
706 Ga0495680_0075547
707 Ga0495675_0060848
708 Ga0495684_0014257
709 Ga0495684_0032598
710 Ga0495684_0042223
711 Ga0495593_0012416
712 Ga0495593_0028605
713 Ga0495602_0032823
714 Ga0495602_0181008
715 Ga0496100_0234536
716 Ga0496103_0010127
717 Ga0496104_0011478
718 Ga0496104_0060928
719 Ga0496105_0111280
720 Ga0496106_0136581
721 Ga0496107_0118422
722 Ga0496108_0071400
723 Ga0496108_0081427
724 Ga0496108_0122320
725 Ga0496110_0291511
726 Ga0496111_0053223
727 Ga0496111_0186736
728 Ga0496112_0108858
729 Ga0496115_0083070
730 Ga0496126_0000027
731 Ga0496126_0287769
732 Ga0501047_0325558
733 nmdc:mga05p37_14743_c1
734 nmdc:mga06r32_101240_c1
735 nmdc:mga06r32_330370_c1
736 nmdc:mga08y16_65585_c1
737 nmdc:mga0n895_15717_c1
738 nmdc:mga0n895_39751_c1
739 nmdc:mga0rr50_76229_c1
740 nmdc:mga08x19_121029_c1
741 nmdc:mga08x19_39648_c1
742 nmdc:mga08x19_44787_c1
743 nmdc:mga0a205_13214_c1
744 nmdc:mga0a205_169351_c1
745 Ga0495601_0081888
746 Ga0495595_0002745
747 Ga0495595_0028183
748 Ga0495619_0023226
749 Ga0495619_0030475
750 Ga0495619_0070075
751 Ga0500556_0000911
752 Ga0500599_001521
753 Ga0466962_0005495
754 Ga0466962_0017579
755 Ga0466962_0030696
756 Ga0466962_0115230
757 2776372323
758 2863071382
759 2866557089
760 2899369912
761 2899374631
762 8056207810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

257

351

0.96

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

55

239

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.8509 3 202
4eq5-assembly1.cif.gz_A dna ligase from the archaeon thermococcus sibiricus 0.8269 13 330
2cfm-assembly1.cif.gz_A atp-dependent dna ligase from pyrococcus furiosus 0.8178 13 330
3gde-assembly1.cif.gz_A the closed conformation of atp-dependent dna ligase from archaeoglobus fulgidus 0.7889 3 319
3vnn-assembly1.cif.gz_A crystal structure of a sub-domain of the nucleotidyltransferase (adenylation) domain of human dna ligase iv 0.7849 33 158
ID Description Score Start End Superfamily
af_P9WNV3_639_759_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9441 205 321 2.40.50.140
2hixA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9094 14 202 3.30.470.30
af_P9WNV3_639_759_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9068 205 321 2.40.50.140
4eq5A02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8976 14 200 3.30.470.30
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8896 14 202 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A2V8PWR4-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9848 6 322 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-D1Z0H6-F1-model_v4 Putative ATP-dependent DNA ligase 0.9827 6 324 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A7W0K0C4-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9767 18 324 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A2V9ZZK1-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9742 204 320 GO:0003910
GO:0006281
GO:0006310
AF-A0A7Y6E0G3-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9738 11 324 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Map