F429005

General Info

Members Datasets Scaffolds Average Seq Length
381 180 381 184

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0056968|Ga0373943_0056968_1238_1918
Length 226
Sequence MGFFPHLQFARQALFFPPRAKSGDGPQPARRGKVRPVNPPDRRTNMLSNTTSKIGWKASDFALPAVDGRTYSLADVRGPKGTLVVFICNHCPYVKASIGRIVAEAEALREIGVGTIAVMPNDTDTYAEDSFDNMKAFAARHRFTFPYAIDKTQEVARAYDAQCTPDFFGFNARDELQYRGRLDAARMTPVANARRDLFEAMKQVTETGQGPKEQLPSMGCSIKWRR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
77 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
78 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 2.89
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13617335 2162886012 Bacteria 1225
2 MBSR1b_contig_9095992 2162886012 Bacteria 1459
3 Ga0055536_1001852 3300003781 Bacteria 12365
4 Ga0065715_10102385 3300005293 Bacteria 3119
5 Ga0065707_10010857 3300005295 Bacteria 2944
6 Ga0070670_100022586 3300005331 Bacteria 5413
7 Ga0070689_100045262 3300005340 Bacteria 3388
8 Ga0070661_100360228 3300005344 Bacteria 1143
9 Ga0070675_100167049 3300005354 Bacteria 1896
10 Ga0070671_100014971 3300005355 Bacteria 6263
11 Ga0070688_100062993 3300005365 Bacteria 2349
12 Ga0070659_100408354 3300005366 Bacteria 1147
13 Ga0070711_100104140 3300005439 Bacteria 2070
14 Ga0070711_100275282 3300005439 Bacteria 1330
15 Ga0070684_100632478 3300005535 Bacteria 996
16 Ga0070684_100954520 3300005535 Bacteria 804
17 Ga0070697_100600987 3300005536 Bacteria 967
18 Ga0070695_100424175 3300005545 Bacteria 1013
19 Ga0070665_100044019 3300005548 Bacteria 4484
20 Ga0070702_100176523 3300005615 Bacteria 1394
21 Ga0068863_100709075 3300005841 Bacteria 1000
22 Ga0068858_100852163 3300005842 Bacteria 890
23 Ga0068860_100958665 3300005843 Bacteria 873
24 Ga0068862_100629208 3300005844 Bacteria 1033
25 Ga0081455_10042500 3300005937 Bacteria 3986
26 Ga0075365_10030940 3300006038 Bacteria 3432
27 Ga0075364_10041080 3300006051 Bacteria 3002
28 Ga0075432_10063276 3300006058 Bacteria 1321
29 Ga0070716_100196733 3300006173 Bacteria 1336
30 Ga0070712_100008044 3300006175 Bacteria 6617
31 Ga0070712_100195825 3300006175 Unclassified 1584
32 Ga0070712_100322371 3300006175 Bacteria 1257
33 Ga0097621_100833254 3300006237 Bacteria 856
34 Ga0075428_100027757 3300006844 Bacteria 6262
35 Ga0075428_100143277 3300006844 Bacteria 2598
36 Ga0075428_100204278 3300006844 Bacteria 2135
37 Ga0075428_100455164 3300006844 Bacteria 1371
38 Ga0075428_100699642 3300006844 Bacteria 1080
39 Ga0075430_100066070 3300006846 Bacteria 3037
40 Ga0075430_100253695 3300006846 Bacteria 1457
41 Ga0075430_100506391 3300006846 Bacteria 996
42 Ga0075430_100813680 3300006846 Bacteria 770
43 Ga0075431_100108687 3300006847 Bacteria 2862
44 Ga0075431_100142105 3300006847 Bacteria 2474
45 Ga0075431_100246113 3300006847 Bacteria 1818
46 Ga0075431_100471397 3300006847 Bacteria 1249
47 Ga0075433_10020196 3300006852 Bacteria 5565
48 Ga0075433_10167483 3300006852 Bacteria 1955
49 Ga0075434_100096673 3300006871 Bacteria 2958
50 Ga0075434_100112230 3300006871 Bacteria 2737
51 Ga0075434_100141562 3300006871 Bacteria 2425
52 Ga0075434_100225021 3300006871 Bacteria 1896
53 Ga0075429_100026862 3300006880 Bacteria 4997
54 Ga0075429_100534493 3300006880 Bacteria 1027
55 Ga0075435_100134575 3300007076 Bacteria 2069
56 Ga0075435_100231865 3300007076 Bacteria 1569
57 Ga0075435_100235393 3300007076 Bacteria 1556
58 Ga0075435_100377532 3300007076 Bacteria 1217
59 Ga0075435_100457511 3300007076 Bacteria 1101
60 Ga0105240_10000094 3300009093 Bacteria 181637
61 Ga0105240_10001093 3300009093 Bacteria 47879
62 Ga0111539_10130207 3300009094 Bacteria 2946
63 Ga0111539_10243183 3300009094 Bacteria 2095
64 Ga0111539_10625348 3300009094 Bacteria 1254
65 Ga0114129_10005518 3300009147 Bacteria 17893
66 Ga0114129_10135335 3300009147 Bacteria 3381
67 Ga0114129_10264120 3300009147 Bacteria 2305
68 Ga0114129_11169856 3300009147 Bacteria 959
69 Ga0105248_10256284 3300009177 Bacteria 1969
70 Ga0105237_10856053 3300009545 Bacteria 916
71 Ga0157370_10898359 3300013104 Bacteria 804
72 Ga0157374_10158131 3300013296 Bacteria 2206
73 Ga0157378_11738940 3300013297 Bacteria 671
74 Ga0163163_10099078 3300014325 Bacteria 2936
75 Ga0213874_10059688 3300021377 Bacteria 1192
76 Ga0228598_1016369 3300024227 Bacteria 1463
77 Ga0209676_1000019 3300025292 Bacteria 620012
78 Ga0209050_1006612 3300025298 Bacteria 6806
79 Ga0207695_10000419 3300025913 Bacteria 94504
80 Ga0207695_10002907 3300025913 Bacteria 24789
81 Ga0207693_10001435 3300025915 Bacteria 21136
82 Ga0207693_10177295 3300025915 Unclassified 1677
83 Ga0207663_10140119 3300025916 Bacteria 1684
84 Ga0207663_10149326 3300025916 Bacteria 1638
85 Ga0207663_10805747 3300025916 Bacteria 748
86 Ga0207646_10793203 3300025922 Bacteria 844
87 Ga0207650_10010336 3300025925 Bacteria 6399
88 Ga0207659_10063837 3300025926 Bacteria 2664
89 Ga0207700_10051071 3300025928 Bacteria 3084
90 Ga0207664_10490423 3300025929 Unclassified 1100
91 Ga0207664_10704261 3300025929 Unclassified 908
92 Ga0207644_10023276 3300025931 Bacteria 4241
93 Ga0207706_10255411 3300025933 Bacteria 1530
94 Ga0207709_10915689 3300025935 Bacteria 713
95 Ga0207667_10314652 3300025949 Bacteria 1599
96 Ga0207651_10009184 3300025960 Bacteria 5391
97 Ga0207668_10596725 3300025972 Bacteria 962
98 Ga0207641_10325440 3300026088 Bacteria 1459
99 Ga0207683_10472546 3300026121 Bacteria 1157
100 Ga0207428_10038031 3300027907 Bacteria 3915
101 Ga0207428_10062838 3300027907 Bacteria 2935
102 Ga0268266_10025681 3300028379 Bacteria 5012
103 Ga0268265_10056435 3300028380 Bacteria 2988
104 Ga0307513_10100998 3300031456 Bacteria 2908
105 Ga0316575_10006570 3300031665 Bacteria 4189
106 Ga0265342_10144013 3300031712 Bacteria 1328
107 Ga0307413_10101666 3300031824 Bacteria 1901
108 Ga0307412_10680147 3300031911 Bacteria 881
109 Ga0373930_0105087 3300034816 Unclassified 675
110 Ga0373926_0003294 3300035083 Bacteria 5189
111 Ga0373926_0070977 3300035083 Bacteria 1280
112 Ga0373934_0367583 3300035086 Bacteria 600
113 Ga0373944_0003805 3300035089 Bacteria 3908
114 Ga0373944_0032762 3300035089 Bacteria 1571
115 Ga0373949_0136945 3300035090 Unclassified 699
116 Ga0373952_0045625 3300035092 Unclassified 1028
117 Ga0373923_0042284 3300035111 Bacteria 1882
118 Ga0373923_0046063 3300035111 Bacteria 1813
119 Ga0373936_0007329 3300035113 Bacteria 4152
120 Ga0373936_0183728 3300035113 Bacteria 918
121 Ga0373936_0426759 3300035113 Unclassified 611
122 Ga0373945_0005370 3300035116 Unclassified 4101
123 Ga0373945_0006504 3300035116 Bacteria 3772
124 Ga0373945_0063951 3300035116 Bacteria 1378
125 Ga0373953_0097491 3300035117 Bacteria 1235
126 Ga0373954_0186761 3300035118 Bacteria 1017
127 Ga0373943_0000852 3300035170 Bacteria 13464
128 Ga0373943_0032119 3300035170 Bacteria 2494
129 Ga0373943_0056968 3300035170 Bacteria 1941
130 Ga0373943_0087544 3300035170 Bacteria 1607
131 Ga0373946_0005285 3300035171 Bacteria 4656
132 Ga0373946_0010854 3300035171 Bacteria 3384
133 Ga0373946_0116650 3300035171 Bacteria 1214
134 Ga0373946_0126425 3300035171 Bacteria 1172
135 Ga0373946_0203586 3300035171 Bacteria 949
136 Ga0373955_0693911 3300035172 Bacteria 625
137 Ga0316574_0001852 3300035398 Bacteria 10312
138 Ga0373924_0033379 3300035410 Bacteria 2077
139 Ga0373935_0011821 3300035692 Bacteria 5244
140 Ga0373935_0091400 3300035692 Bacteria 1993
141 Ga0373927_0002915 3300035695 Bacteria 12441
142 Ga0373927_0010640 3300035695 Bacteria 6128
143 Ga0373927_0045500 3300035695 Bacteria 2838
144 Ga0373927_0069526 3300035695 Unclassified 2278
145 Ga0373927_0129359 3300035695 Bacteria 1649
146 Ga0373927_0318406 3300035695 Bacteria 1024
147 Ga0373927_0349483 3300035695 Bacteria 974
148 Ga0373947_0027852 3300035725 Bacteria 3309
149 Ga0373947_0054591 3300035725 Bacteria 2411
150 Ga0373947_0060626 3300035725 Bacteria 2297
151 Ga0373947_0065230 3300035725 Bacteria 2221
152 Ga0373947_0099800 3300035725 Bacteria 1823
153 Ga0373947_0313066 3300035725 Bacteria 1048
154 Ga0373937_0369132 3300036401 Bacteria 1360
155 Ga0373937_0882095 3300036401 Bacteria 843
156 Ga0373925_0005535 3300037068 Bacteria 9404
157 Ga0373925_0011401 3300037068 Bacteria 6443
158 Ga0373925_0285234 3300037068 Bacteria 1331
159 Ga0395900_0202432 3300037418 Bacteria 2008
160 Ga0395898_0113459 3300037466 Bacteria 2597
161 Ga0395905_1037811 3300037471 Bacteria 723
162 Ga0395901_0663526 3300038443 Bacteria 1045
163 Ga0395901_0719930 3300038443 Bacteria 994
164 Ga0436365_0244288 3300039437 Bacteria 704
165 Ga0436363_0159647 3300039450 Bacteria 4970
166 Ga0436363_0422742 3300039450 Bacteria 2026
167 Ga0439453_0005939 3300041408 Bacteria 1882
168 Ga0451845_0186909 3300041501 Bacteria 707
169 Ga0495592_0015196 3300046454 Bacteria 5847
170 Ga0495592_0030571 3300046454 Bacteria 4074
171 Ga0495592_0169987 3300046454 Bacteria 1494
172 Ga0495592_0182543 3300046454 Bacteria 1428
173 Ga0495603_0183585 3300046455 Bacteria 1210
174 Ga0495629_0016731 3300046459 Bacteria 5263
175 Ga0495629_0169305 3300046459 Bacteria 1516
176 Ga0495629_0186574 3300046459 Bacteria 1436
177 Ga0495629_0281362 3300046459 Bacteria 1141
178 Ga0495629_0446867 3300046459 Bacteria 875
179 Ga0495641_0168876 3300046461 Unclassified 979
180 Ga0495651_0180871 3300046462 Bacteria 1492
181 Ga0495651_0191573 3300046462 Bacteria 1438
182 Ga0495653_0033727 3300046463 Bacteria 4053
183 Ga0495653_0222434 3300046463 Bacteria 1268
184 Ga0495653_0286984 3300046463 Bacteria 1078
185 Ga0495653_0452070 3300046463 Bacteria 808
186 Ga0495580_0017498 3300046472 Bacteria 5359
187 Ga0495580_0156349 3300046472 Bacteria 1579
188 Ga0495580_0300572 3300046472 Unclassified 1093
189 Ga0495639_0011537 3300046475 Bacteria 3811
190 Ga0495639_0054469 3300046475 Bacteria 1823
191 Ga0495662_0004841 3300046476 Bacteria 6744
192 Ga0495662_0014810 3300046476 Bacteria 3789
193 Ga0495662_0020930 3300046476 Bacteria 3163
194 Ga0495662_0172896 3300046476 Unclassified 1064
195 Ga0495662_0314344 3300046476 Bacteria 770
196 Ga0495664_0000397 3300046477 Bacteria 21312
197 Ga0495664_0021315 3300046477 Bacteria 3743
198 Ga0495584_0309637 3300046491 Bacteria 802
199 Ga0495608_0010561 3300046511 Bacteria 6443
200 Ga0495618_0001928 3300046514 Bacteria 13598
201 Ga0495618_0008252 3300046514 Bacteria 6309
202 Ga0495618_0079323 3300046514 Bacteria 2094
203 Ga0495618_0123257 3300046514 Bacteria 1659
204 Ga0495618_0295429 3300046514 Unclassified 1007
205 Ga0495618_0592973 3300046514 Unclassified 660
206 Ga0495628_0037849 3300046516 Bacteria 3866
207 Ga0495630_0003061 3300046517 Bacteria 11593
208 Ga0495630_0051065 3300046517 Bacteria 3094
209 Ga0495630_0061841 3300046517 Bacteria 2812
210 Ga0495630_0149453 3300046517 Bacteria 1777
211 Ga0495630_0177185 3300046517 Bacteria 1625
212 Ga0495630_0184152 3300046517 Bacteria 1593
213 Ga0495637_0026303 3300046520 Bacteria 2614
214 Ga0495644_0294669 3300046523 Bacteria 634
215 Ga0495666_0031122 3300046526 Bacteria 2615
216 Ga0495652_0014581 3300046529 Bacteria 7048
217 Ga0495652_0072458 3300046529 Bacteria 2871
218 Ga0495652_0094324 3300046529 Bacteria 2441
219 Ga0495652_0453988 3300046529 Bacteria 897
220 Ga0495665_0010258 3300046531 Bacteria 5070
221 Ga0495665_0034096 3300046531 Bacteria 2722
222 Ga0495665_0037708 3300046531 Bacteria 2579
223 Ga0495665_0066702 3300046531 Bacteria 1899
224 Ga0495640_0002731 3300046533 Bacteria 14194
225 Ga0495640_0003646 3300046533 Bacteria 12369
226 Ga0495640_0010509 3300046533 Bacteria 7145
227 Ga0495640_0068992 3300046533 Bacteria 2378
228 Ga0495640_0111438 3300046533 Bacteria 1788
229 Ga0495640_0298792 3300046533 Bacteria 1000
230 Ga0495640_0324621 3300046533 Unclassified 953
231 Ga0495586_0009144 3300046535 Bacteria 5271
232 Ga0495586_0053836 3300046535 Bacteria 2180
233 Ga0495586_0109374 3300046535 Bacteria 1537
234 Ga0495587_0265611 3300046536 Bacteria 963
235 Ga0495587_0283512 3300046536 Bacteria 928
236 Ga0495587_0329434 3300046536 Bacteria 852
237 Ga0495645_0021303 3300046543 Bacteria 4684
238 Ga0495645_0082260 3300046543 Bacteria 2309
239 Ga0495622_0201078 3300046557 Bacteria 888
240 Ga0495667_0105709 3300046559 Bacteria 1820
241 Ga0495667_0142183 3300046559 Bacteria 1546
242 Ga0495667_0209509 3300046559 Bacteria 1246
243 Ga0495667_0299918 3300046559 Bacteria 1018
244 Ga0495667_0449526 3300046559 Bacteria 810
245 Ga0495656_0039294 3300046615 Bacteria 1965
246 Ga0495634_0012832 3300046642 Bacteria 6063
247 Ga0495634_0013454 3300046642 Bacteria 5912
248 Ga0495634_0022074 3300046642 Unclassified 4487
249 Ga0495634_0022327 3300046642 Bacteria 4459
250 Ga0495634_0045090 3300046642 Bacteria 2982
251 Ga0495634_0167645 3300046642 Bacteria 1382
252 Ga0495634_0194014 3300046642 Bacteria 1265
253 Ga0495635_0009035 3300046663 Bacteria 6953
254 Ga0495635_0009589 3300046663 Bacteria 6766
255 Ga0495635_0154054 3300046663 Bacteria 1565
256 Ga0495635_0254699 3300046663 Unclassified 1183
257 Ga0495635_0379757 3300046663 Bacteria 940
258 Ga0495659_0108259 3300046664 Bacteria 1083
259 Ga0495588_0297868 3300046674 Bacteria 849
260 Ga0495657_0398684 3300046675 Bacteria 810
261 Ga0495657_0619449 3300046675 Bacteria 625
262 Ga0495599_0047289 3300046678 Bacteria 2697
263 Ga0495599_0236761 3300046678 Bacteria 1114
264 Ga0495623_0129470 3300046679 Bacteria 1512
265 Ga0495646_0052897 3300046680 Bacteria 2451
266 Ga0495646_0101224 3300046680 Bacteria 1652
267 Ga0495646_0186410 3300046680 Bacteria 1136
268 Ga0495647_0082025 3300046681 Bacteria 1309
269 Ga0495647_0219114 3300046681 Bacteria 839
270 Ga0495658_0020906 3300046683 Bacteria 3444
271 Ga0495658_0071895 3300046683 Bacteria 2011
272 Ga0495658_0219674 3300046683 Bacteria 1189
273 Ga0495613_0017759 3300046689 Bacteria 5301
274 Ga0495613_0045357 3300046689 Bacteria 3251
275 Ga0495613_0131957 3300046689 Bacteria 1789
276 Ga0495613_0177787 3300046689 Bacteria 1508
277 Ga0495613_0205983 3300046689 Bacteria 1385
278 Ga0495624_0016216 3300046690 Bacteria 5016
279 Ga0495624_0046699 3300046690 Bacteria 2753
280 Ga0495624_0053294 3300046690 Bacteria 2554
281 Ga0495600_0212233 3300046809 Bacteria 1240
282 Ga0495581_0029430 3300047315 Bacteria 3183
283 Ga0495581_0124216 3300047315 Bacteria 1503
284 Ga0495581_0171089 3300047315 Bacteria 1270
285 Ga0495604_0074671 3300047317 Bacteria 2555
286 Ga0495604_0119723 3300047317 Bacteria 1907
287 Ga0495604_0142929 3300047317 Bacteria 1708
288 Ga0495604_0300195 3300047317 Bacteria 1079
289 Ga0495604_0532458 3300047317 Bacteria 759
290 Ga0495674_0008333 3300047319 Bacteria 9880
291 Ga0495674_0011447 3300047319 Bacteria 8369
292 Ga0495674_0130288 3300047319 Bacteria 2119
293 Ga0495674_0153865 3300047319 Unclassified 1927
294 Ga0495674_0155766 3300047319 Bacteria 1914
295 Ga0495674_0166547 3300047319 Bacteria 1841
296 Ga0495674_0171924 3300047319 Unclassified 1807
297 Ga0495674_0328294 3300047319 Bacteria 1245
298 Ga0495676_0044951 3300047321 Bacteria 3599
299 Ga0495676_0109886 3300047321 Bacteria 2025
300 Ga0495680_0061582 3300047322 Bacteria 2886
301 Ga0495680_0487765 3300047322 Bacteria 838
302 Ga0495684_0003766 3300047471 Bacteria 11834
303 Ga0495684_0004729 3300047471 Bacteria 10631
304 Ga0495684_0004806 3300047471 Bacteria 10548
305 Ga0495684_0066803 3300047471 Bacteria 2734
306 Ga0495684_0080367 3300047471 Bacteria 2475
307 Ga0495593_0049499 3300047673 Bacteria 2230
308 Ga0496108_0111977 3300048911 Bacteria 2335
309 Ga0496109_0028623 3300048912 Bacteria 4985
310 Ga0496109_0475518 3300048912 Bacteria 1180
311 Ga0496110_0165508 3300048913 Bacteria 2005
312 Ga0496110_0608255 3300048913 Bacteria 991
313 Ga0496111_0548687 3300048914 Bacteria 849
314 Ga0496112_0030620 3300048915 Bacteria 5210
315 Ga0496112_1021800 3300048915 Bacteria 746
316 Ga0496113_0767837 3300048916 Bacteria 767
317 Ga0496114_0390529 3300048917 Bacteria 1232
318 Ga0496115_0137121 3300048918 Bacteria 2018
319 Ga0501077_0114260 3300049593 Bacteria 1712
320 Ga0501079_0136953 3300049741 Bacteria 1907
321 Ga0501079_1300017 3300049741 Bacteria 573
322 Ga0501081_0782514 3300049743 Bacteria 718
323 nmdc:mga00v17_32803_c1 3300050491 Bacteria 3072
324 nmdc:mga0yw44_2090_c1 3300050492 Bacteria 8347
325 nmdc:mga0yw44_35191_c1 3300050492 Bacteria 2941
326 nmdc:mga0yw44_752248_c1 3300050492 Bacteria 662
327 nmdc:mga05p37_123264_c1 3300050507 Bacteria 3184
328 nmdc:mga05p37_302529_c1 3300050507 Bacteria 1900
329 nmdc:mga05p37_58572_c1 3300050507 Bacteria 4744
330 nmdc:mga05p37_938408_c1 3300050507 Bacteria 928
331 nmdc:mga09592_55880_c1 3300050508 Bacteria 3336
332 nmdc:mga09592_68685_c1 3300050508 Bacteria 3006
333 nmdc:mga0qj67_152095_c1 3300050509 Bacteria 1878
334 nmdc:mga0qj67_28292_c1 3300050509 Bacteria 4351
335 nmdc:mga0qj67_56393_c1 3300050509 Bacteria 3114
336 nmdc:mga06r32_20941_c1 3300050510 Bacteria 6030
337 nmdc:mga06r32_209512_c1 3300050510 Bacteria 1937
338 nmdc:mga06r32_346005_c1 3300050510 Bacteria 1471
339 nmdc:mga06r32_3498_c1 3300050510 Bacteria 14017
340 nmdc:mga06r32_758535_c1 3300050510 Bacteria 933
341 nmdc:mga06r32_81986_c1 3300050510 Bacteria 3142
342 nmdc:mga08y16_29540_c1 3300050511 Bacteria 5775
343 nmdc:mga08y16_70765_c1 3300050511 Bacteria 3636
344 nmdc:mga0n895_36343_c1 3300050512 Bacteria 4756
345 nmdc:mga0rr50_118600_c1 3300050513 Bacteria 2103
346 nmdc:mga0rr50_34962_c1 3300050513 Bacteria 3604
347 nmdc:mga0rr50_62730_c1 3300050513 Bacteria 2805
348 nmdc:mga0a205_130646_c1 3300050515 Bacteria 2412
349 nmdc:mga0a205_233539_c1 3300050515 Bacteria 1722
350 nmdc:mga0a205_39511_c1 3300050515 Bacteria 4542
351 Ga0495601_0008192 3300053077 Bacteria 6164
352 Ga0495601_0010751 3300053077 Bacteria 5460
353 Ga0495601_0016536 3300053077 Bacteria 4471
354 Ga0495601_0018640 3300053077 Unclassified 4225
355 Ga0495601_0040850 3300053077 Bacteria 2906
356 Ga0495601_0069788 3300053077 Bacteria 2241
357 Ga0495601_0113920 3300053077 Bacteria 1753
358 Ga0495601_0250434 3300053077 Bacteria 1157
359 Ga0495601_0383582 3300053077 Bacteria 912
360 Ga0495612_0000258 3300053078 Bacteria 21898
361 Ga0495612_0000551 3300053078 Bacteria 15054
362 Ga0495612_0034503 3300053078 Bacteria 2049
363 Ga0495595_0319978 3300053084 Bacteria 781
364 Ga0495619_0004508 3300053085 Bacteria 8896
365 Ga0495619_0010394 3300053085 Bacteria 5858
366 Ga0495619_0029823 3300053085 Bacteria 3527
367 Ga0495619_0046478 3300053085 Bacteria 2854
368 Ga0495619_0059329 3300053085 Bacteria 2542
369 Ga0495619_0078775 3300053085 Bacteria 2215
370 Ga0495619_0079075 3300053085 Bacteria 2211
371 Ga0495619_0199905 3300053085 Bacteria 1383
372 Ga0495619_0264740 3300053085 Bacteria 1191
373 Ga0495619_0510182 3300053085 Unclassified 827
374 Ga0500559_0255253 3300053136 Bacteria 826
375 Ga0500588_0162346 3300053146 Bacteria 814
376 Ga0501084_0234894 3300054114 Bacteria 1548
377 Ga0501084_0727082 3300054114 Bacteria 837
378 Ga0590071_023602 3300059421 Bacteria 1455
379 Ga0590074_016434 3300059423 Bacteria 1260
380 Ga0590075_053239 3300059424 Bacteria 1039
381 Ga0530510_0225695 3300061734 Bacteria 1393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100022586 Ga0070670_1000225865 180
2 3300005340 Ga0070689_100045262 Ga0070689_1000452623 180
3 3300005344 Ga0070661_100360228 Ga0070661_1003602282 180
4 3300005354 Ga0070675_100167049 Ga0070675_1001670491 180
5 3300005355 Ga0070671_100014971 Ga0070671_1000149714 180
6 3300005365 Ga0070688_100062993 Ga0070688_1000629933 180
7 3300005439 Ga0070711_100104140 Ga0070711_1001041403 180
8 3300005439 Ga0070711_100275282 Ga0070711_1002752822 180
9 3300005548 Ga0070665_100044019 Ga0070665_1000440195 180
10 3300005615 Ga0070702_100176523 Ga0070702_1001765231 180
11 3300006175 Ga0070712_100008044 Ga0070712_1000080445 180
12 3300006175 Ga0070712_100195825 Ga0070712_1001958253 180
13 3300006175 Ga0070712_100322371 Ga0070712_1003223712 180
14 3300009177 Ga0105248_10256284 Ga0105248_102562842 180
15 3300009545 Ga0105237_10856053 Ga0105237_108560531 180
16 3300013104 Ga0157370_10898359 Ga0157370_108983591 180
17 3300013296 Ga0157374_10158131 Ga0157374_101581311 180
18 3300013297 Ga0157378_11738940 Ga0157378_117389401 180
19 3300014325 Ga0163163_10099078 Ga0163163_100990783 180
20 3300024227 Ga0228598_1016369 Ga0228598_10163691 180
21 3300025915 Ga0207693_10001435 Ga0207693_1000143516 180
22 3300025915 Ga0207693_10177295 Ga0207693_101772952 180
23 3300025916 Ga0207663_10140119 Ga0207663_101401192 180
24 3300025916 Ga0207663_10149326 Ga0207663_101493262 180
25 3300025916 Ga0207663_10805747 Ga0207663_108057471 180
26 3300025925 Ga0207650_10010336 Ga0207650_100103365 180
27 3300025926 Ga0207659_10063837 Ga0207659_100638373 180
28 3300025928 Ga0207700_10051071 Ga0207700_100510711 180
29 3300025929 Ga0207664_10490423 Ga0207664_104904232 180
30 3300025929 Ga0207664_10704261 Ga0207664_107042611 180
31 3300025931 Ga0207644_10023276 Ga0207644_100232766 180
32 3300025933 Ga0207706_10255411 Ga0207706_102554112 180
33 3300025960 Ga0207651_10009184 Ga0207651_100091843 180
34 3300028379 Ga0268266_10025681 Ga0268266_100256813 180
35 3300035086 Ga0373934_0367583 Ga0373934_0367583_13_558 180
36 3300035089 Ga0373944_0003805 Ga0373944_0003805_430_975 180
37 3300035111 Ga0373923_0042284 Ga0373923_0042284_416_961 180
38 3300035111 Ga0373923_0046063 Ga0373923_0046063_60_605 180
39 3300035113 Ga0373936_0007329 Ga0373936_0007329_711_1256 180
40 3300035116 Ga0373945_0005370 Ga0373945_0005370_1420_1965 180
41 3300035116 Ga0373945_0063951 Ga0373945_0063951_370_915 180
42 3300035117 Ga0373953_0097491 Ga0373953_0097491_267_812 180
43 3300035170 Ga0373943_0032119 Ga0373943_0032119_370_915 180
44 3300035170 Ga0373943_0056968 Ga0373943_0056968_1238_1918 180
45 3300035170 Ga0373943_0087544 Ga0373943_0087544_1002_1547 180
46 3300035171 Ga0373946_0005285 Ga0373946_0005285_3427_3972 180
47 3300035171 Ga0373946_0116650 Ga0373946_0116650_300_845 180
48 3300035172 Ga0373955_0693911 Ga0373955_0693911_59_604 180
49 3300035410 Ga0373924_0033379 Ga0373924_0033379_1387_1932 180
50 3300035692 Ga0373935_0011821 Ga0373935_0011821_1000_1545 180
51 3300035695 Ga0373927_0010640 Ga0373927_0010640_4235_4780 180
52 3300035695 Ga0373927_0045500 Ga0373927_0045500_713_1258 180
53 3300035695 Ga0373927_0069526 Ga0373927_0069526_1244_1789 180
54 3300035725 Ga0373947_0027852 Ga0373947_0027852_1763_2308 180
55 3300035725 Ga0373947_0099800 Ga0373947_0099800_46_591 180
56 3300036401 Ga0373937_0369132 Ga0373937_0369132_323_868 180
57 3300036401 Ga0373937_0882095 Ga0373937_0882095_240_785 180
58 3300037068 Ga0373925_0011401 Ga0373925_0011401_2948_3493 180
59 3300037068 Ga0373925_0285234 Ga0373925_0285234_689_1234 180
60 3300041501 Ga0451845_0186909 Ga0451845_0186909_97_645 180
61 3300046454 Ga0495592_0015196 Ga0495592_0015196_4693_5238 180
62 3300046454 Ga0495592_0169987 Ga0495592_0169987_578_1123 180
63 3300046454 Ga0495592_0182543 Ga0495592_0182543_311_856 180
64 3300046459 Ga0495629_0169305 Ga0495629_0169305_61_606 180
65 3300046459 Ga0495629_0186574 Ga0495629_0186574_28_573 180
66 3300046459 Ga0495629_0281362 Ga0495629_0281362_439_984 180
67 3300046462 Ga0495651_0180871 Ga0495651_0180871_500_1045 180
68 3300046463 Ga0495653_0033727 Ga0495653_0033727_382_927 180
69 3300046463 Ga0495653_0222434 Ga0495653_0222434_532_1077 180
70 3300046463 Ga0495653_0452070 Ga0495653_0452070_117_662 180
71 3300046472 Ga0495580_0017498 Ga0495580_0017498_687_1232 180
72 3300046472 Ga0495580_0300572 Ga0495580_0300572_28_573 180
73 3300046475 Ga0495639_0011537 Ga0495639_0011537_3241_3786 180
74 3300046475 Ga0495639_0054469 Ga0495639_0054469_1243_1788 180
75 3300046476 Ga0495662_0014810 Ga0495662_0014810_1504_2049 180
76 3300046476 Ga0495662_0020930 Ga0495662_0020930_823_1368 180
77 3300046476 Ga0495662_0172896 Ga0495662_0172896_330_875 180
78 3300046477 Ga0495664_0000397 Ga0495664_0000397_6292_6837 180
79 3300046511 Ga0495608_0010561 Ga0495608_0010561_4809_5354 180
80 3300046514 Ga0495618_0001928 Ga0495618_0001928_6596_7141 180
81 3300046514 Ga0495618_0123257 Ga0495618_0123257_590_1135 180
82 3300046514 Ga0495618_0295429 Ga0495618_0295429_162_707 180
83 3300046517 Ga0495630_0003061 Ga0495630_0003061_5047_5592 180
84 3300046517 Ga0495630_0184152 Ga0495630_0184152_503_1048 180
85 3300046526 Ga0495666_0031122 Ga0495666_0031122_224_769 180
86 3300046529 Ga0495652_0072458 Ga0495652_0072458_618_1163 180
87 3300046529 Ga0495652_0094324 Ga0495652_0094324_1504_2049 180
88 3300046531 Ga0495665_0010258 Ga0495665_0010258_419_964 180
89 3300046531 Ga0495665_0034096 Ga0495665_0034096_1098_1643 180
90 3300046531 Ga0495665_0037708 Ga0495665_0037708_1708_2253 180
91 3300046533 Ga0495640_0003646 Ga0495640_0003646_4831_5376 180
92 3300046533 Ga0495640_0010509 Ga0495640_0010509_3887_4432 180
93 3300046533 Ga0495640_0298792 Ga0495640_0298792_244_789 180
94 3300046535 Ga0495586_0009144 Ga0495586_0009144_868_1413 180
95 3300046535 Ga0495586_0053836 Ga0495586_0053836_986_1531 180
96 3300046536 Ga0495587_0265611 Ga0495587_0265611_88_633 180
97 3300046543 Ga0495645_0021303 Ga0495645_0021303_2944_3489 180
98 3300046559 Ga0495667_0142183 Ga0495667_0142183_287_832 180
99 3300046559 Ga0495667_0209509 Ga0495667_0209509_334_879 180
100 3300046559 Ga0495667_0299918 Ga0495667_0299918_267_812 180
101 3300046642 Ga0495634_0012832 Ga0495634_0012832_4520_5065 180
102 3300046642 Ga0495634_0013454 Ga0495634_0013454_4548_5093 180
103 3300046642 Ga0495634_0022074 Ga0495634_0022074_933_1478 180
104 3300046663 Ga0495635_0009035 Ga0495635_0009035_5589_6134 180
105 3300046675 Ga0495657_0619449 Ga0495657_0619449_59_604 180
106 3300046678 Ga0495599_0236761 Ga0495599_0236761_108_653 180
107 3300046679 Ga0495623_0129470 Ga0495623_0129470_556_1101 180
108 3300046680 Ga0495646_0052897 Ga0495646_0052897_758_1303 180
109 3300046681 Ga0495647_0219114 Ga0495647_0219114_210_755 180
110 3300046683 Ga0495658_0071895 Ga0495658_0071895_42_587 180
111 3300046689 Ga0495613_0045357 Ga0495613_0045357_686_1231 180
112 3300046689 Ga0495613_0177787 Ga0495613_0177787_97_642 180
113 3300046689 Ga0495613_0205983 Ga0495613_0205983_261_806 180
114 3300046690 Ga0495624_0016216 Ga0495624_0016216_2461_3006 180
115 3300046690 Ga0495624_0046699 Ga0495624_0046699_1826_2371 180
116 3300046809 Ga0495600_0212233 Ga0495600_0212233_244_789 180
117 3300047315 Ga0495581_0171089 Ga0495581_0171089_456_1001 180
118 3300047317 Ga0495604_0074671 Ga0495604_0074671_172_717 180
119 3300047317 Ga0495604_0119723 Ga0495604_0119723_1255_1800 180
120 3300047319 Ga0495674_0008333 Ga0495674_0008333_3800_4345 180
121 3300047319 Ga0495674_0153865 Ga0495674_0153865_808_1353 180
122 3300047319 Ga0495674_0171924 Ga0495674_0171924_820_1365 180
123 3300047319 Ga0495674_0328294 Ga0495674_0328294_80_625 180
124 3300047321 Ga0495676_0044951 Ga0495676_0044951_1693_2238 180
125 3300047322 Ga0495680_0061582 Ga0495680_0061582_1500_2045 180
126 3300047471 Ga0495684_0004729 Ga0495684_0004729_4548_5093 180
127 3300047471 Ga0495684_0004806 Ga0495684_0004806_6453_6998 180
128 3300047673 Ga0495593_0049499 Ga0495593_0049499_1160_1705 180
129 3300048911 Ga0496108_0111977 Ga0496108_0111977_145_690 180
130 3300048912 Ga0496109_0475518 Ga0496109_0475518_172_849 180
131 3300048913 Ga0496110_0608255 Ga0496110_0608255_101_778 180
132 3300048914 Ga0496111_0548687 Ga0496111_0548687_210_755 180
133 3300048915 Ga0496112_0030620 Ga0496112_0030620_1148_1825 180
134 3300048915 Ga0496112_1021800 Ga0496112_1021800_120_665 180
135 3300048916 Ga0496113_0767837 Ga0496113_0767837_142_687 180
136 3300048918 Ga0496115_0137121 Ga0496115_0137121_579_1124 180
137 3300053077 Ga0495601_0010751 Ga0495601_0010751_1716_2261 180
138 3300053077 Ga0495601_0018640 Ga0495601_0018640_948_1493 180
139 3300053077 Ga0495601_0069788 Ga0495601_0069788_508_1053 180
140 3300053078 Ga0495612_0000258 Ga0495612_0000258_15382_15927 180
141 3300053078 Ga0495612_0034503 Ga0495612_0034503_29_574 180
142 3300053085 Ga0495619_0004508 Ga0495619_0004508_6752_7297 180
143 3300053085 Ga0495619_0078775 Ga0495619_0078775_1445_1990 180
144 3300053085 Ga0495619_0079075 Ga0495619_0079075_1172_1717 180
145 3300053085 Ga0495619_0264740 Ga0495619_0264740_162_707 180
146 3300025972 Ga0207668_10596725 Ga0207668_105967251 181
147 3300031712 Ga0265342_10144013 Ga0265342_101440132 181
148 3300039437 Ga0436365_0244288 Ga0436365_0244288_68_616 181
149 3300039450 Ga0436363_0159647 Ga0436363_0159647_419_1033 181
150 3300046523 Ga0495644_0294669 Ga0495644_0294669_76_624 181
151 3300049593 Ga0501077_0114260 Ga0501077_0114260_749_1297 181
152 3300049741 Ga0501079_0136953 Ga0501079_0136953_666_1214 181
153 3300049741 Ga0501079_1300017 Ga0501079_1300017_10_558 181
154 3300049743 Ga0501081_0782514 Ga0501081_0782514_75_623 181
155 3300054114 Ga0501084_0234894 Ga0501084_0234894_893_1441 181
156 3300061734 Ga0530510_0225695 Ga0530510_0225695_720_1268 181
157 3300003781 Ga0055536_1001852 Ga0055536_10018523 182
158 3300005295 Ga0065707_10010857 Ga0065707_100108571 182
159 3300005535 Ga0070684_100632478 Ga0070684_1006324781 182
160 3300005535 Ga0070684_100954520 Ga0070684_1009545202 182
161 3300005536 Ga0070697_100600987 Ga0070697_1006009872 182
162 3300005843 Ga0068860_100958665 Ga0068860_1009586651 182
163 3300005844 Ga0068862_100629208 Ga0068862_1006292082 182
164 3300005937 Ga0081455_10042500 Ga0081455_100425004 182
165 3300006038 Ga0075365_10030940 Ga0075365_100309403 182
166 3300006051 Ga0075364_10041080 Ga0075364_100410805 182
167 3300006058 Ga0075432_10063276 Ga0075432_100632763 182
168 3300006173 Ga0070716_100196733 Ga0070716_1001967332 182
169 3300006237 Ga0097621_100833254 Ga0097621_1008332541 182
170 3300006844 Ga0075428_100027757 Ga0075428_1000277577 182
171 3300006844 Ga0075428_100143277 Ga0075428_1001432772 182
172 3300006844 Ga0075428_100204278 Ga0075428_1002042783 182
173 3300006844 Ga0075428_100455164 Ga0075428_1004551641 182
174 3300006844 Ga0075428_100699642 Ga0075428_1006996422 182
175 3300006846 Ga0075430_100066070 Ga0075430_1000660702 182
176 3300006846 Ga0075430_100253695 Ga0075430_1002536952 182
177 3300006846 Ga0075430_100506391 Ga0075430_1005063912 182
178 3300006847 Ga0075431_100108687 Ga0075431_1001086875 182
179 3300006847 Ga0075431_100142105 Ga0075431_1001421053 182
180 3300006847 Ga0075431_100246113 Ga0075431_1002461133 182
181 3300006852 Ga0075433_10020196 Ga0075433_100201966 182
182 3300006852 Ga0075433_10167483 Ga0075433_101674833 182
183 3300006871 Ga0075434_100096673 Ga0075434_1000966731 182
184 3300006871 Ga0075434_100112230 Ga0075434_1001122304 182
185 3300006871 Ga0075434_100141562 Ga0075434_1001415624 182
186 3300006871 Ga0075434_100225021 Ga0075434_1002250212 182
187 3300006880 Ga0075429_100026862 Ga0075429_1000268622 182
188 3300006880 Ga0075429_100534493 Ga0075429_1005344931 182
189 3300007076 Ga0075435_100134575 Ga0075435_1001345752 182
190 3300007076 Ga0075435_100231865 Ga0075435_1002318653 182
191 3300007076 Ga0075435_100235393 Ga0075435_1002353932 182
192 3300007076 Ga0075435_100377532 Ga0075435_1003775321 182
193 3300007076 Ga0075435_100457511 Ga0075435_1004575113 182
194 3300009094 Ga0111539_10130207 Ga0111539_101302072 182
195 3300009094 Ga0111539_10243183 Ga0111539_102431833 182
196 3300009094 Ga0111539_10625348 Ga0111539_106253481 182
197 3300009147 Ga0114129_10005518 Ga0114129_1000551819 182
198 3300009147 Ga0114129_10135335 Ga0114129_101353355 182
199 3300009147 Ga0114129_10264120 Ga0114129_102641204 182
200 3300009147 Ga0114129_11169856 Ga0114129_111698561 182
201 3300021377 Ga0213874_10059688 Ga0213874_100596882 182
202 3300025292 Ga0209676_1000019 Ga0209676_1000019455 182
203 3300025298 Ga0209050_1006612 Ga0209050_10066127 182
204 3300025922 Ga0207646_10793203 Ga0207646_107932032 182
205 3300025935 Ga0207709_10915689 Ga0207709_109156892 182
206 3300026088 Ga0207641_10325440 Ga0207641_103254402 182
207 3300026121 Ga0207683_10472546 Ga0207683_104725461 182
208 3300027907 Ga0207428_10038031 Ga0207428_100380313 182
209 3300027907 Ga0207428_10062838 Ga0207428_100628382 182
210 3300028380 Ga0268265_10056435 Ga0268265_100564351 182
211 3300031456 Ga0307513_10100998 Ga0307513_101009983 182
212 3300031665 Ga0316575_10006570 Ga0316575_100065702 182
213 3300034816 Ga0373930_0105087 Ga0373930_0105087_18_569 182
214 3300035083 Ga0373926_0003294 Ga0373926_0003294_529_1080 182
215 3300035083 Ga0373926_0070977 Ga0373926_0070977_55_606 182
216 3300035089 Ga0373944_0032762 Ga0373944_0032762_163_714 182
217 3300035090 Ga0373949_0136945 Ga0373949_0136945_36_644 182
218 3300035092 Ga0373952_0045625 Ga0373952_0045625_324_932 182
219 3300035113 Ga0373936_0183728 Ga0373936_0183728_28_579 182
220 3300035113 Ga0373936_0426759 Ga0373936_0426759_21_572 182
221 3300035116 Ga0373945_0006504 Ga0373945_0006504_1233_1784 182
222 3300035118 Ga0373954_0186761 Ga0373954_0186761_47_598 182
223 3300035170 Ga0373943_0000852 Ga0373943_0000852_4657_5208 182
224 3300035171 Ga0373946_0010854 Ga0373946_0010854_1946_2497 182
225 3300035171 Ga0373946_0126425 Ga0373946_0126425_172_765 182
226 3300035171 Ga0373946_0203586 Ga0373946_0203586_296_904 182
227 3300035398 Ga0316574_0001852 Ga0316574_0001852_7070_7621 182
228 3300035692 Ga0373935_0091400 Ga0373935_0091400_720_1271 182
229 3300035695 Ga0373927_0002915 Ga0373927_0002915_6338_6889 182
230 3300035695 Ga0373927_0129359 Ga0373927_0129359_344_895 182
231 3300035695 Ga0373927_0318406 Ga0373927_0318406_293_886 182
232 3300035695 Ga0373927_0349483 Ga0373927_0349483_402_953 182
233 3300035725 Ga0373947_0054591 Ga0373947_0054591_1503_2096 182
234 3300035725 Ga0373947_0060626 Ga0373947_0060626_954_1505 182
235 3300035725 Ga0373947_0065230 Ga0373947_0065230_981_1532 182
236 3300035725 Ga0373947_0313066 Ga0373947_0313066_440_991 182
237 3300037068 Ga0373925_0005535 Ga0373925_0005535_6402_6953 182
238 3300037418 Ga0395900_0202432 Ga0395900_0202432_1124_1675 182
239 3300037466 Ga0395898_0113459 Ga0395898_0113459_367_918 182
240 3300037471 Ga0395905_1037811 Ga0395905_1037811_131_682 182
241 3300038443 Ga0395901_0663526 Ga0395901_0663526_154_705 182
242 3300038443 Ga0395901_0719930 Ga0395901_0719930_41_592 182
243 3300039450 Ga0436363_0422742 Ga0436363_0422742_511_1062 182
244 3300041408 Ga0439453_0005939 Ga0439453_0005939_922_1473 182
245 3300046454 Ga0495592_0030571 Ga0495592_0030571_896_1447 182
246 3300046455 Ga0495603_0183585 Ga0495603_0183585_143_694 182
247 3300046459 Ga0495629_0016731 Ga0495629_0016731_558_1151 182
248 3300046459 Ga0495629_0446867 Ga0495629_0446867_66_617 182
249 3300046461 Ga0495641_0168876 Ga0495641_0168876_333_884 182
250 3300046463 Ga0495653_0286984 Ga0495653_0286984_242_793 182
251 3300046472 Ga0495580_0156349 Ga0495580_0156349_553_1104 182
252 3300046476 Ga0495662_0004841 Ga0495662_0004841_2330_2923 182
253 3300046476 Ga0495662_0314344 Ga0495662_0314344_135_686 182
254 3300046477 Ga0495664_0021315 Ga0495664_0021315_89_682 182
255 3300046491 Ga0495584_0309637 Ga0495584_0309637_72_623 182
256 3300046514 Ga0495618_0008252 Ga0495618_0008252_5469_6062 182
257 3300046514 Ga0495618_0079323 Ga0495618_0079323_1106_1657 182
258 3300046514 Ga0495618_0592973 Ga0495618_0592973_86_637 182
259 3300046516 Ga0495628_0037849 Ga0495628_0037849_1159_1710 182
260 3300046517 Ga0495630_0051065 Ga0495630_0051065_2363_2914 182
261 3300046517 Ga0495630_0061841 Ga0495630_0061841_240_833 182
262 3300046517 Ga0495630_0149453 Ga0495630_0149453_657_1208 182
263 3300046517 Ga0495630_0177185 Ga0495630_0177185_846_1397 182
264 3300046520 Ga0495637_0026303 Ga0495637_0026303_1060_1611 182
265 3300046529 Ga0495652_0014581 Ga0495652_0014581_4683_5234 182
266 3300046529 Ga0495652_0453988 Ga0495652_0453988_61_612 182
267 3300046531 Ga0495665_0066702 Ga0495665_0066702_464_1015 182
268 3300046533 Ga0495640_0002731 Ga0495640_0002731_3902_4495 182
269 3300046533 Ga0495640_0068992 Ga0495640_0068992_383_934 182
270 3300046533 Ga0495640_0111438 Ga0495640_0111438_429_980 182
271 3300046533 Ga0495640_0324621 Ga0495640_0324621_241_849 182
272 3300046535 Ga0495586_0109374 Ga0495586_0109374_548_1111 182
273 3300046536 Ga0495587_0283512 Ga0495587_0283512_195_746 182
274 3300046543 Ga0495645_0082260 Ga0495645_0082260_1631_2224 182
275 3300046557 Ga0495622_0201078 Ga0495622_0201078_105_656 182
276 3300046559 Ga0495667_0449526 Ga0495667_0449526_56_607 182
277 3300046615 Ga0495656_0039294 Ga0495656_0039294_180_731 182
278 3300046642 Ga0495634_0022327 Ga0495634_0022327_3593_4186 182
279 3300046642 Ga0495634_0045090 Ga0495634_0045090_1105_1656 182
280 3300046642 Ga0495634_0167645 Ga0495634_0167645_11_562 182
281 3300046642 Ga0495634_0194014 Ga0495634_0194014_136_744 182
282 3300046663 Ga0495635_0009589 Ga0495635_0009589_2224_2817 182
283 3300046663 Ga0495635_0154054 Ga0495635_0154054_671_1222 182
284 3300046663 Ga0495635_0254699 Ga0495635_0254699_592_1143 182
285 3300046663 Ga0495635_0379757 Ga0495635_0379757_358_909 182
286 3300046664 Ga0495659_0108259 Ga0495659_0108259_127_678 182
287 3300046674 Ga0495588_0297868 Ga0495588_0297868_283_834 182
288 3300046678 Ga0495599_0047289 Ga0495599_0047289_1334_1885 182
289 3300046680 Ga0495646_0186410 Ga0495646_0186410_298_849 182
290 3300046681 Ga0495647_0082025 Ga0495647_0082025_678_1229 182
291 3300046683 Ga0495658_0020906 Ga0495658_0020906_2560_3111 182
292 3300046683 Ga0495658_0219674 Ga0495658_0219674_589_1140 182
293 3300046689 Ga0495613_0017759 Ga0495613_0017759_4515_5066 182
294 3300046689 Ga0495613_0131957 Ga0495613_0131957_534_1085 182
295 3300046690 Ga0495624_0053294 Ga0495624_0053294_1607_2158 182
296 3300047315 Ga0495581_0029430 Ga0495581_0029430_1661_2212 182
297 3300047315 Ga0495581_0124216 Ga0495581_0124216_178_729 182
298 3300047317 Ga0495604_0142929 Ga0495604_0142929_1095_1646 182
299 3300047317 Ga0495604_0300195 Ga0495604_0300195_363_956 182
300 3300047317 Ga0495604_0532458 Ga0495604_0532458_102_653 182
301 3300047319 Ga0495674_0011447 Ga0495674_0011447_2548_3141 182
302 3300047319 Ga0495674_0130288 Ga0495674_0130288_1006_1557 182
303 3300047319 Ga0495674_0155766 Ga0495674_0155766_477_1028 182
304 3300047319 Ga0495674_0166547 Ga0495674_0166547_857_1408 182
305 3300047321 Ga0495676_0109886 Ga0495676_0109886_1221_1772 182
306 3300047322 Ga0495680_0487765 Ga0495680_0487765_71_622 182
307 3300047471 Ga0495684_0003766 Ga0495684_0003766_2440_3033 182
308 3300047471 Ga0495684_0066803 Ga0495684_0066803_1465_2016 182
309 3300047471 Ga0495684_0080367 Ga0495684_0080367_1430_1981 182
310 3300048917 Ga0496114_0390529 Ga0496114_0390529_660_1211 182
311 3300050491 nmdc:mga00v17_32803_c1 nmdc:mga00v17_32803_c1_2060_2611 182
312 3300050492 nmdc:mga0yw44_2090_c1 nmdc:mga0yw44_2090_c1_7478_8029 182
313 3300050492 nmdc:mga0yw44_752248_c1 nmdc:mga0yw44_752248_c1_77_628 182
314 3300050507 nmdc:mga05p37_123264_c1 nmdc:mga05p37_123264_c1_1930_2481 182
315 3300050507 nmdc:mga05p37_302529_c1 nmdc:mga05p37_302529_c1_1055_1606 182
316 3300050507 nmdc:mga05p37_58572_c1 nmdc:mga05p37_58572_c1_4001_4552 182
317 3300050507 nmdc:mga05p37_938408_c1 nmdc:mga05p37_938408_c1_151_813 182
318 3300050508 nmdc:mga09592_55880_c1 nmdc:mga09592_55880_c1_332_883 182
319 3300050508 nmdc:mga09592_68685_c1 nmdc:mga09592_68685_c1_1857_2408 182
320 3300050509 nmdc:mga0qj67_152095_c1 nmdc:mga0qj67_152095_c1_1304_1855 182
321 3300050509 nmdc:mga0qj67_28292_c1 nmdc:mga0qj67_28292_c1_284_835 182
322 3300050509 nmdc:mga0qj67_56393_c1 nmdc:mga0qj67_56393_c1_2362_2913 182
323 3300050510 nmdc:mga06r32_20941_c1 nmdc:mga06r32_20941_c1_2677_3228 182
324 3300050510 nmdc:mga06r32_209512_c1 nmdc:mga06r32_209512_c1_789_1340 182
325 3300050510 nmdc:mga06r32_3498_c1 nmdc:mga06r32_3498_c1_5607_6158 182
326 3300050510 nmdc:mga06r32_758535_c1 nmdc:mga06r32_758535_c1_215_766 182
327 3300050510 nmdc:mga06r32_81986_c1 nmdc:mga06r32_81986_c1_1532_2083 182
328 3300050511 nmdc:mga08y16_29540_c1 nmdc:mga08y16_29540_c1_2714_3265 182
329 3300050511 nmdc:mga08y16_70765_c1 nmdc:mga08y16_70765_c1_571_1122 182
330 3300050512 nmdc:mga0n895_36343_c1 nmdc:mga0n895_36343_c1_2371_2922 182
331 3300050513 nmdc:mga0rr50_118600_c1 nmdc:mga0rr50_118600_c1_459_1010 182
332 3300050513 nmdc:mga0rr50_34962_c1 nmdc:mga0rr50_34962_c1_2627_3178 182
333 3300050513 nmdc:mga0rr50_62730_c1 nmdc:mga0rr50_62730_c1_1645_2196 182
334 3300050515 nmdc:mga0a205_130646_c1 nmdc:mga0a205_130646_c1_969_1520 182
335 3300050515 nmdc:mga0a205_233539_c1 nmdc:mga0a205_233539_c1_696_1247 182
336 3300050515 nmdc:mga0a205_39511_c1 nmdc:mga0a205_39511_c1_2157_2708 182
337 3300053077 Ga0495601_0008192 Ga0495601_0008192_1982_2575 182
338 3300053077 Ga0495601_0016536 Ga0495601_0016536_1357_1908 182
339 3300053077 Ga0495601_0040850 Ga0495601_0040850_598_1149 182
340 3300053077 Ga0495601_0113920 Ga0495601_0113920_408_959 182
341 3300053077 Ga0495601_0250434 Ga0495601_0250434_126_677 182
342 3300053077 Ga0495601_0383582 Ga0495601_0383582_68_619 182
343 3300053078 Ga0495612_0000551 Ga0495612_0000551_13959_14552 182
344 3300053084 Ga0495595_0319978 Ga0495595_0319978_155_706 182
345 3300053085 Ga0495619_0010394 Ga0495619_0010394_3944_4537 182
346 3300053085 Ga0495619_0029823 Ga0495619_0029823_891_1442 182
347 3300053085 Ga0495619_0059329 Ga0495619_0059329_415_966 182
348 3300053085 Ga0495619_0199905 Ga0495619_0199905_344_895 182
349 3300053085 Ga0495619_0510182 Ga0495619_0510182_79_630 182
350 3300053136 Ga0500559_0255253 Ga0500559_0255253_233_781 182
351 3300053146 Ga0500588_0162346 Ga0500588_0162346_162_749 182
352 3300054114 Ga0501084_0727082 Ga0501084_0727082_269_817 182
353 3300005842 Ga0068858_100852163 Ga0068858_1008521631 183
354 3300006846 Ga0075430_100813680 Ga0075430_1008136801 183
355 3300006847 Ga0075431_100471397 Ga0075431_1004713971 183
356 3300031824 Ga0307413_10101666 Ga0307413_101016662 183
357 3300050510 nmdc:mga06r32_346005_c1 nmdc:mga06r32_346005_c1_601_1152 183
358 3300059421 Ga0590071_023602 Ga0590071_023602_325_876 183
359 3300059423 Ga0590074_016434 Ga0590074_016434_367_918 183
360 3300059424 Ga0590075_053239 Ga0590075_053239_292_843 183
361 2162886012 MBSR1b_contig_13617335 MBSR1b_0621.00003300 184
362 2162886012 MBSR1b_contig_9095992 MBSR1b_0071.00001180 184
363 3300005293 Ga0065715_10102385 Ga0065715_101023855 184
364 3300005366 Ga0070659_100408354 Ga0070659_1004083541 184
365 3300005545 Ga0070695_100424175 Ga0070695_1004241751 184
366 3300005841 Ga0068863_100709075 Ga0068863_1007090751 184
367 3300009093 Ga0105240_10000094 Ga0105240_10000094112 184
368 3300009093 Ga0105240_10001093 Ga0105240_1000109311 184
369 3300025913 Ga0207695_10000419 Ga0207695_1000041972 184
370 3300025913 Ga0207695_10002907 Ga0207695_1000290731 184
371 3300025949 Ga0207667_10314652 Ga0207667_103146522 184
372 3300031911 Ga0307412_10680147 Ga0307412_106801472 184
373 3300046462 Ga0495651_0191573 Ga0495651_0191573_147_704 184
374 3300046536 Ga0495587_0329434 Ga0495587_0329434_281_838 184
375 3300046559 Ga0495667_0105709 Ga0495667_0105709_751_1308 184
376 3300046675 Ga0495657_0398684 Ga0495657_0398684_94_651 184
377 3300046680 Ga0495646_0101224 Ga0495646_0101224_854_1411 184
378 3300048912 Ga0496109_0028623 Ga0496109_0028623_4200_4754 184
379 3300048913 Ga0496110_0165508 Ga0496110_0165508_1230_1784 184
380 3300050492 nmdc:mga0yw44_35191_c1 nmdc:mga0yw44_35191_c1_470_1027 184
381 3300053085 Ga0495619_0046478 Ga0495619_0046478_1215_1772 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

54

180

0.92

PF08534

Redoxin

Redoxin

53

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9354 9 183
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9346 8 184
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.9221 10 181
1lu4-assembly1.cif.gz_A 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions 0.9099 17 133
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.8956 8 184
ID Description Score Start End Superfamily
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9333 9 184 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9214 10 181 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8894 9 184 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8853 2 181 3.40.30.10
af_I6YGW6_98_222_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.862 34 135 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A530QHJ9-F1-model_v4 Thioredoxin family protein 1.004 32 135 GO:0016209
GO:0016491
AF-A0A661EN42-F1-model_v4 Thioredoxin family protein 1.001 43 182 GO:0016209
GO:0016491
AF-A0A1F3ZCH4-F1-model_v4 Alkyl hydroperoxide reductase 0.9978 42 182 GO:0016209
GO:0016491
AF-A0A2C9AKC6-F1-model_v4 deleted 0.9952 9 182
AF-A0A436GIK1-F1-model_v4 Thioredoxin family protein 0.9945 8 184 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map