F428989

General Info

Members Datasets Scaffolds Average Seq Length
381 137 367 232

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10624459|Ga0207698_106244591
Length 266
Sequence MDATVFKKNLKTIDTSSLVDRVEKKLVETLQKKKLKTGDSIPKEIELAETLGVSRTVIREALLRLRMMGLIESKKKKGAVITSPDLFGILSKSMNPHILDQETLKEIFEIRLALEIGMADFLFKRKTDENIEELKKIVSKEPEITDQHLFNISHEIAFHGKLYEITGNDTMKKFQKMLLPVFDYVHHSGLLGKPITFKKFVSHKELVDILDKGTPELFRNAMRHHLENHFARIFDXNMQIGKFENVKIGIGFICSFTISKIFFSGI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
12 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
13 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
124 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
127 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
137 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 0
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 0
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2963908 2162886007 Bacteria 27528
2 SwRhRL2b_contig_3952261 2162886007 Bacteria 34047
3 SwRhRL2b_contig_406873 2162886007 Bacteria 3042
4 JGI24736J21556_1004776 3300001904 Bacteria 2301
5 rootH2_10038132 3300003320 Bacteria 2438
6 rootL2_10276438 3300003322 Bacteria 5763
7 rootH1_10370031 3300003323 Bacteria 1072
8 Ga0055536_1000049 3300003781 Bacteria 113328
9 Ga0055536_1014867 3300003781 Bacteria 2701
10 Ga0055530_10002255 3300003791 Bacteria 12695
11 Ga0065165_1000043 3300005262 Bacteria 203850
12 Ga0065714_10002765 3300005288 Bacteria 65513
13 Ga0065714_10003280 3300005288 Bacteria 26984
14 Ga0065714_10003574 3300005288 Bacteria 7566
15 Ga0065714_10064461 3300005288 Bacteria 66149
16 Ga0065714_10177409 3300005288 Bacteria 974
17 Ga0065704_10070251 3300005289 Bacteria 48366
18 Ga0065704_10070264 3300005289 Bacteria 44804
19 Ga0065704_10074701 3300005289 Bacteria 6076
20 Ga0065704_10083829 3300005289 Bacteria 3412
21 Ga0070658_10040432 3300005327 Bacteria 3762
22 Ga0070658_10137981 3300005327 Bacteria 2036
23 Ga0070658_10152781 3300005327 Bacteria 1933
24 Ga0070658_10236031 3300005327 Bacteria 1549
25 Ga0070658_10249902 3300005327 Unclassified 1504
26 Ga0070683_100010899 3300005329 Bacteria 7827
27 Ga0070680_100034152 3300005336 Bacteria 4101
28 Ga0070680_100041219 3300005336 Bacteria 3743
29 Ga0070680_100044817 3300005336 Bacteria 3594
30 Ga0070682_100489838 3300005337 Unclassified 950
31 Ga0068868_100428913 3300005338 Bacteria 1146
32 Ga0070660_100000248 3300005339 Bacteria 35592
33 Ga0070660_100031428 3300005339 Unclassified 3987
34 Ga0070660_100032917 3300005339 Bacteria 3904
35 Ga0070660_100075330 3300005339 Bacteria 2642
36 Ga0070660_100121747 3300005339 Bacteria 2082
37 Ga0070660_100386844 3300005339 Unclassified 1155
38 Ga0070660_100685691 3300005339 Bacteria 859
39 Ga0070692_10075166 3300005345 Bacteria 1809
40 Ga0070692_10294762 3300005345 Bacteria 988
41 Ga0070659_100016252 3300005366 Bacteria 5585
42 Ga0070659_100074092 3300005366 Bacteria 2711
43 Ga0070659_100191689 3300005366 Bacteria 1680
44 Ga0070659_100193038 3300005366 Bacteria 1674
45 Ga0070659_100214917 3300005366 Unclassified 1585
46 Ga0070659_100456738 3300005366 Bacteria 1084
47 Ga0070714_100241043 3300005435 Bacteria 1669
48 Ga0070711_100842296 3300005439 Unclassified 780
49 Ga0070663_100056455 3300005455 Bacteria 2813
50 Ga0070663_100256692 3300005455 Bacteria 1385
51 Ga0070663_100488379 3300005455 Bacteria 1021
52 Ga0070662_100000658 3300005457 Bacteria 20955
53 Ga0070681_10038735 3300005458 Bacteria 4779
54 Ga0070681_10090849 3300005458 Bacteria 3004
55 Ga0070681_10095446 3300005458 Bacteria 2922
56 Ga0070681_10127416 3300005458 Bacteria 2479
57 Ga0070681_10292575 3300005458 Bacteria 1538
58 Ga0070679_100005261 3300005530 Bacteria 11978
59 Ga0070679_100007047 3300005530 Bacteria 10484
60 Ga0070679_100041922 3300005530 Bacteria 4557
61 Ga0070679_100172794 3300005530 Unclassified 2133
62 Ga0070679_100483233 3300005530 Bacteria 1183
63 Ga0070684_100003827 3300005535 Bacteria 11381
64 Ga0070684_100112308 3300005535 Bacteria 2445
65 Ga0070684_100662108 3300005535 Unclassified 972
66 Ga0068853_100035054 3300005539 Bacteria 4261
67 Ga0068853_100036668 3300005539 Bacteria 4171
68 Ga0068855_100000133 3300005563 Bacteria 94906
69 Ga0068855_100010946 3300005563 Bacteria 10948
70 Ga0068855_100013163 3300005563 Bacteria 9978
71 Ga0068855_100015792 3300005563 Bacteria 9084
72 Ga0068855_100034910 3300005563 Bacteria 5993
73 Ga0068855_100050773 3300005563 Bacteria 4886
74 Ga0068855_100084165 3300005563 Bacteria 3684
75 Ga0068855_100177928 3300005563 Bacteria 2406
76 Ga0068855_100293363 3300005563 Bacteria 1802
77 Ga0068855_100332762 3300005563 Bacteria 1676
78 Ga0068855_100504063 3300005563 Unclassified 1315
79 Ga0068857_100005425 3300005577 Bacteria 10872
80 Ga0068857_100308106 3300005577 Bacteria 1461
81 Ga0068857_100333316 3300005577 Bacteria 1403
82 Ga0068857_100756013 3300005577 Bacteria 926
83 Ga0068854_100052660 3300005578 Unclassified 2920
84 Ga0068854_100601720 3300005578 Bacteria 939
85 Ga0068856_100012482 3300005614 Bacteria 8223
86 Ga0068856_100026443 3300005614 Bacteria 5659
87 Ga0068856_100056937 3300005614 Bacteria 3859
88 Ga0068856_100160544 3300005614 Bacteria 2258
89 Ga0068852_100000379 3300005616 Bacteria 29959
90 Ga0068852_100009701 3300005616 Bacteria 7154
91 Ga0068852_100010691 3300005616 Bacteria 6871
92 Ga0068852_100138890 3300005616 Unclassified 2247
93 Ga0068852_100160428 3300005616 Bacteria 2099
94 Ga0068852_100162089 3300005616 Bacteria 2089
95 Ga0068852_100514355 3300005616 Bacteria 1194
96 Ga0068859_100797462 3300005617 Bacteria 1032
97 Ga0097620_100797493 3300006931 Bacteria 1032
98 Ga0105240_10000398 3300009093 Bacteria 81045
99 Ga0105240_10003613 3300009093 Bacteria 23948
100 Ga0105240_10018469 3300009093 Bacteria 9362
101 Ga0105240_10225646 3300009093 Unclassified 2180
102 Ga0105240_10688948 3300009093 Bacteria 1117
103 Ga0111539_10173129 3300009094 Unclassified 2522
104 Ga0105241_10003058 3300009174 Bacteria 12475
105 Ga0105241_10004032 3300009174 Bacteria 10869
106 Ga0105241_10430544 3300009174 Bacteria 1163
107 Ga0105241_10510836 3300009174 Bacteria 1073
108 Ga0105237_10002634 3300009545 Bacteria 22084
109 Ga0105237_10043874 3300009545 Unclassified 4502
110 Ga0105237_10527315 3300009545 Unclassified 1188
111 Ga0105239_10107396 3300010375 Bacteria 3092
112 Ga0105239_10451983 3300010375 Bacteria 1458
113 Ga0105239_10549740 3300010375 Unclassified 1315
114 Ga0105246_10106657 3300011119 Bacteria 2050
115 Ga0157373_10000043 3300013100 Bacteria 113422
116 Ga0157373_10000601 3300013100 Bacteria 27966
117 Ga0157373_10001097 3300013100 Bacteria 20827
118 Ga0157373_10030373 3300013100 Bacteria 3888
119 Ga0157373_10036689 3300013100 Bacteria 3516
120 Ga0157373_10071380 3300013100 Bacteria 2453
121 Ga0157373_10082703 3300013100 Bacteria 2263
122 Ga0157373_10144127 3300013100 Bacteria 1675
123 Ga0157373_10264921 3300013100 Bacteria 1216
124 Ga0157371_10000416 3300013102 Bacteria 52659
125 Ga0157371_10000486 3300013102 Bacteria 48340
126 Ga0157371_10000669 3300013102 Bacteria 40629
127 Ga0157371_10002197 3300013102 Bacteria 18937
128 Ga0157371_10006268 3300013102 Bacteria 9853
129 Ga0157371_10006997 3300013102 Bacteria 9180
130 Ga0157371_10008009 3300013102 Bacteria 8467
131 Ga0157371_10044900 3300013102 Bacteria 3145
132 Ga0157371_10045424 3300013102 Bacteria 3126
133 Ga0157371_10049727 3300013102 Bacteria 2978
134 Ga0157371_10054230 3300013102 Bacteria 2848
135 Ga0157371_10063488 3300013102 Bacteria 2617
136 Ga0157371_10080996 3300013102 Bacteria 2299
137 Ga0157371_10105100 3300013102 Bacteria 2003
138 Ga0157371_10115699 3300013102 Bacteria 1905
139 Ga0157370_10001110 3300013104 Bacteria 33701
140 Ga0157370_10003868 3300013104 Bacteria 17439
141 Ga0157370_10009399 3300013104 Bacteria 10451
142 Ga0157370_10021571 3300013104 Bacteria 6418
143 Ga0157370_10026295 3300013104 Bacteria 5748
144 Ga0157370_10027947 3300013104 Bacteria 5556
145 Ga0157370_10033765 3300013104 Unclassified 4986
146 Ga0157370_10039979 3300013104 Bacteria 4530
147 Ga0157370_10076917 3300013104 Bacteria 3144
148 Ga0157370_10077212 3300013104 Bacteria 3138
149 Ga0157370_10082501 3300013104 Bacteria 3024
150 Ga0157370_10096371 3300013104 Bacteria 2776
151 Ga0157370_10128511 3300013104 Bacteria 2364
152 Ga0157370_10264738 3300013104 Bacteria 1588
153 Ga0157370_10497078 3300013104 Bacteria 1120
154 Ga0157369_10002425 3300013105 Bacteria 22409
155 Ga0157369_10012447 3300013105 Bacteria 9656
156 Ga0157369_10029992 3300013105 Bacteria 6002
157 Ga0157369_10031013 3300013105 Bacteria 5891
158 Ga0157369_10051400 3300013105 Unclassified 4460
159 Ga0157369_10059136 3300013105 Bacteria 4134
160 Ga0157369_10119325 3300013105 Unclassified 2799
161 Ga0157369_10232885 3300013105 Bacteria 1925
162 Ga0157369_10374131 3300013105 Unclassified 1479
163 Ga0157369_10578149 3300013105 Bacteria 1160
164 Ga0157374_10002365 3300013296 Bacteria 15890
165 Ga0163162_10025960 3300013306 Bacteria 5790
166 Ga0157372_10000001 3300013307 Bacteria 791349
167 Ga0157372_10000231 3300013307 Bacteria 62248
168 Ga0157372_10006539 3300013307 Bacteria 12401
169 Ga0157372_10024950 3300013307 Bacteria 6498
170 Ga0157372_10030816 3300013307 Bacteria 5868
171 Ga0157372_10041576 3300013307 Bacteria 5084
172 Ga0157372_10050249 3300013307 Bacteria 4638
173 Ga0157372_10051149 3300013307 Bacteria 4597
174 Ga0157372_10052906 3300013307 Bacteria 4524
175 Ga0157372_10064620 3300013307 Bacteria 4106
176 Ga0157372_10097277 3300013307 Bacteria 3356
177 Ga0157372_10159511 3300013307 Bacteria 2606
178 Ga0157372_10230547 3300013307 Bacteria 2147
179 Ga0157372_10469587 3300013307 Bacteria 1466
180 Ga0157372_10605419 3300013307 Bacteria 1277
181 Ga0157372_10662927 3300013307 Bacteria 1215
182 Ga0157372_10664324 3300013307 Bacteria 1213
183 Ga0157372_11176072 3300013307 Bacteria 886
184 Ga0157372_11527631 3300013307 Bacteria 769
185 Ga0157375_10041762 3300013308 Bacteria 4431
186 Ga0157375_10132484 3300013308 Bacteria 2613
187 Ga0157380_10201496 3300014326 Bacteria 1766
188 Ga0157380_10297560 3300014326 Bacteria 1485
189 Ga0182008_10000001 3300014497 Bacteria 540790
190 Ga0182008_10020046 3300014497 Bacteria 3446
191 Ga0182008_10053850 3300014497 Bacteria 1992
192 Ga0182008_10164783 3300014497 Unclassified 1117
193 Ga0182006_1001890 3300015261 Bacteria 11951
194 Ga0182007_10002417 3300015262 Bacteria 9327
195 Ga0182007_10006207 3300015262 Bacteria 5153
196 Ga0182007_10010010 3300015262 Bacteria 3776
197 Ga0182007_10033678 3300015262 Bacteria 1735
198 Ga0163161_10000391 3300017792 Bacteria 36781
199 Ga0209233_1026482 3300025261 Bacteria 1417
200 Ga0209676_1000001 3300025292 Bacteria 1852142
201 Ga0209676_1000584 3300025292 Bacteria 54694
202 Ga0209050_1000258 3300025298 Bacteria 113741
203 Ga0209050_1021200 3300025298 Bacteria 2379
204 Ga0207647_10001256 3300025904 Bacteria 19506
205 Ga0207647_10001340 3300025904 Bacteria 18926
206 Ga0207647_10001627 3300025904 Bacteria 17271
207 Ga0207647_10015743 3300025904 Bacteria 5177
208 Ga0207705_10023834 3300025909 Bacteria 4367
209 Ga0207705_10055498 3300025909 Unclassified 2856
210 Ga0207705_10184471 3300025909 Bacteria 1576
211 Ga0207705_10214811 3300025909 Bacteria 1459
212 Ga0207654_10022968 3300025911 Bacteria 3335
213 Ga0207654_10036694 3300025911 Bacteria 2740
214 Ga0207707_10010112 3300025912 Bacteria 8188
215 Ga0207707_10044580 3300025912 Bacteria 3867
216 Ga0207707_10077699 3300025912 Bacteria 2898
217 Ga0207707_10235031 3300025912 Bacteria 1594
218 Ga0207707_10250489 3300025912 Bacteria 1539
219 Ga0207695_10000076 3300025913 Bacteria 307969
220 Ga0207695_10000090 3300025913 Bacteria 272143
221 Ga0207695_10022607 3300025913 Bacteria 7132
222 Ga0207695_10049043 3300025913 Bacteria 4454
223 Ga0207695_10217409 3300025913 Bacteria 1819
224 Ga0207671_10003364 3300025914 Bacteria 16041
225 Ga0207671_10269179 3300025914 Unclassified 1342
226 Ga0207671_10366505 3300025914 Bacteria 1144
227 Ga0207660_10024530 3300025917 Bacteria 4084
228 Ga0207660_10102087 3300025917 Bacteria 2144
229 Ga0207657_10005835 3300025919 Bacteria 12829
230 Ga0207657_10012918 3300025919 Bacteria 8210
231 Ga0207657_10039289 3300025919 Bacteria 4207
232 Ga0207657_10056361 3300025919 Bacteria 3391
233 Ga0207657_10091241 3300025919 Unclassified 2541
234 Ga0207657_10110544 3300025919 Bacteria 2270
235 Ga0207657_10350445 3300025919 Bacteria 1164
236 Ga0207657_10594048 3300025919 Bacteria 864
237 Ga0207652_10000013 3300025921 Bacteria 222247
238 Ga0207652_10000074 3300025921 Bacteria 108397
239 Ga0207652_10001161 3300025921 Bacteria 23656
240 Ga0207652_10006665 3300025921 Bacteria 9303
241 Ga0207652_10058952 3300025921 Bacteria 3308
242 Ga0207690_10039609 3300025932 Bacteria 3075
243 Ga0207690_10071519 3300025932 Unclassified 2393
244 Ga0207690_10399516 3300025932 Bacteria 1096
245 Ga0207706_10002012 3300025933 Bacteria 19898
246 Ga0207667_10000100 3300025949 Bacteria 138482
247 Ga0207667_10000453 3300025949 Bacteria 54929
248 Ga0207667_10007036 3300025949 Bacteria 13591
249 Ga0207667_10031568 3300025949 Bacteria 5716
250 Ga0207667_10053465 3300025949 Bacteria 4249
251 Ga0207667_10078643 3300025949 Bacteria 3418
252 Ga0207667_10085652 3300025949 Bacteria 3262
253 Ga0207667_10202045 3300025949 Bacteria 2039
254 Ga0207667_10393940 3300025949 Bacteria 1410
255 Ga0207640_10002604 3300025981 Bacteria 9665
256 Ga0207640_10036485 3300025981 Bacteria 3087
257 Ga0207640_10070442 3300025981 Unclassified 2352
258 Ga0207640_10110572 3300025981 Bacteria 1947
259 Ga0207677_10241174 3300026023 Unclassified 1462
260 Ga0207639_10071515 3300026041 Bacteria 2713
261 Ga0207639_10074848 3300026041 Bacteria 2661
262 Ga0207678_10010312 3300026067 Bacteria 8201
263 Ga0207678_10275828 3300026067 Bacteria 1442
264 Ga0207678_10508729 3300026067 Bacteria 1050
265 Ga0207702_10158511 3300026078 Bacteria 2065
266 Ga0207702_10309263 3300026078 Bacteria 1502
267 Ga0207702_10389866 3300026078 Bacteria 1341
268 Ga0207702_10675196 3300026078 Bacteria 1017
269 Ga0207674_10009127 3300026116 Bacteria 11378
270 Ga0207674_10272568 3300026116 Bacteria 1640
271 Ga0207698_10002846 3300026142 Bacteria 10348
272 Ga0207698_10076191 3300026142 Bacteria 2684
273 Ga0207698_10086925 3300026142 Bacteria 2544
274 Ga0207698_10098785 3300026142 Bacteria 2413
275 Ga0207698_10424064 3300026142 Bacteria 1277
276 Ga0207698_10624459 3300026142 Bacteria 1065
277 Ga0307515_10000493 3300028794 Bacteria 94441
278 Ga0265327_10000207 3300031251 Bacteria 123193
279 Ga0307513_10638751 3300031456 Unclassified 772
280 Ga0307407_10480984 3300031903 Bacteria 907
281 Ga0307412_10000043 3300031911 Bacteria 166562
282 Ga0307412_10000075 3300031911 Bacteria 97612
283 Ga0307414_10002997 3300032004 Bacteria 8946
284 Ga0307414_10007108 3300032004 Bacteria 6281
285 Ga0307414_10007853 3300032004 Bacteria 6016
286 Ga0307414_10037368 3300032004 Bacteria 3251
287 Ga0307414_10068899 3300032004 Bacteria 2541
288 Ga0307414_10087685 3300032004 Bacteria 2301
289 Ga0307414_10807555 3300032004 Bacteria 856
290 Ga0395899_0000011 3300037312 Bacteria 521331
291 Ga0395899_0002810 3300037312 Bacteria 14026
292 Ga0395899_0006589 3300037312 Bacteria 8997
293 Ga0395899_0011557 3300037312 Bacteria 6759
294 Ga0395899_0033699 3300037312 Bacteria 3846
295 Ga0395899_0061352 3300037312 Bacteria 2769
296 Ga0395899_0299052 3300037312 Bacteria 1089
297 Ga0395900_0007472 3300037418 Bacteria 11297
298 Ga0395900_0007567 3300037418 Bacteria 11217
299 Ga0395900_0010663 3300037418 Bacteria 9398
300 Ga0395900_0125592 3300037418 Bacteria 2631
301 Ga0395900_0276504 3300037418 Bacteria 1672
302 Ga0395900_0287442 3300037418 Unclassified 1634
303 Ga0395898_0001381 3300037466 Bacteria 34756
304 Ga0395898_0016533 3300037466 Bacteria 7545
305 Ga0395898_0032678 3300037466 Bacteria 5194
306 Ga0395898_0076094 3300037466 Bacteria 3241
307 Ga0395898_0211978 3300037466 Bacteria 1847
308 Ga0395905_0004093 3300037471 Bacteria 15278
309 Ga0395905_0288055 3300037471 Bacteria 1529
310 Ga0395905_0372563 3300037471 Bacteria 1321
311 Ga0395901_0143402 3300038443 Bacteria 2510
312 Ga0395901_0205181 3300038443 Bacteria 2065
313 Ga0395901_0437233 3300038443 Bacteria 1339
314 Ga0395901_0437876 3300038443 Bacteria 1338
315 Ga0395901_0461149 3300038443 Bacteria 1298
316 Ga0451577_0000061 3300042876 Bacteria 268366
317 Ga0466969_0217937 3300044656 Unclassified 868
318 Ga0466966_0189565 3300044684 Unclassified 1246
319 Ga0453684_0000084 3300044712 Bacteria 398306
320 Ga0453684_0462049 3300044712 Bacteria 1411
321 Ga0451576_0000179 3300045051 Bacteria 159850
322 Ga0495650_0000110 3300046471 Bacteria 198355
323 Ga0495606_0000003 3300046507 Bacteria 449402
324 Ga0495610_0000160 3300046512 Bacteria 74776
325 Ga0495610_0000273 3300046512 Bacteria 53916
326 Ga0495610_0000986 3300046512 Bacteria 26264
327 Ga0495637_0037407 3300046520 Bacteria 2107
328 Ga0495633_0003146 3300046558 Bacteria 11175
329 Ga0495668_0044968 3300046616 Bacteria 2454
330 Ga0495625_0000013 3300046660 Bacteria 345151
331 Ga0495661_0005878 3300046665 Bacteria 8672
332 Ga0495671_0062239 3300046692 Bacteria 1839
333 Ga0495649_0000010 3300046694 Bacteria 430552
334 Ga0495679_041808 3300047446 Bacteria 1417
335 Ga0496116_0015738 3300048919 Bacteria 5963
336 Ga0496117_0006685 3300048920 Bacteria 11535
337 Ga0496122_0012107 3300048925 Bacteria 8639
338 Ga0496123_0027164 3300048926 Bacteria 4269
339 Ga0501298_044117 3300049521 Bacteria 910
340 Ga0501032_0242806 3300049569 Bacteria 1170
341 Ga0501033_0429251 3300049570 Bacteria 920
342 Ga0501034_0022633 3300049571 Bacteria 6402
343 Ga0501034_0125138 3300049571 Bacteria 2556
344 Ga0501034_0420785 3300049571 Bacteria 1257
345 Ga0501070_0194112 3300049586 Unclassified 1668
346 Ga0501070_0251565 3300049586 Bacteria 1445
347 Ga0501207_038244 3300049654 Bacteria 827
348 Ga0501209_104595 3300049656 Bacteria 832
349 Ga0501217_012400 3300049661 Bacteria 1898
350 Ga0501217_016078 3300049661 Bacteria 1710
351 Ga0501223_024888 3300049663 Unclassified 1164
352 Ga0501242_002652 3300049674 Bacteria 1894
353 Ga0501257_021900 3300049686 Bacteria 1510
354 Ga0501257_043610 3300049686 Bacteria 1106
355 Ga0501241_016232 3300049758 Bacteria 1357
356 Ga0501241_029228 3300049758 Bacteria 1037
357 Ga0501035_0172033 3300049822 Bacteria 1871
358 Ga0501044_0315007 3300049823 Bacteria 1490
359 Ga0500651_0000625 3300053093 Bacteria 17617
360 Ga0500651_0006546 3300053093 Bacteria 6725
361 Ga0500566_0202241 3300053094 Bacteria 1002
362 Ga0500608_097577 3300053122 Unclassified 1365
363 Ga0500568_0048983 3300053139 Bacteria 1669
364 Ga0500624_000108 3300053157 Bacteria 39257
365 Ga0500624_000475 3300053157 Bacteria 11939
366 Ga0500634_0075274 3300053161 Bacteria 1756
367 Ga0500634_0171196 3300053161 Bacteria 989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10026295 Ga0157370_100262955 209
2 3300005338 Ga0068868_100428913 Ga0068868_1004289132 211
3 3300005339 Ga0070660_100031428 Ga0070660_1000314283 211
4 3300005366 Ga0070659_100193038 Ga0070659_1001930382 211
5 3300005457 Ga0070662_100000658 Ga0070662_1000006585 211
6 3300009093 Ga0105240_10225646 Ga0105240_102256462 211
7 3300009174 Ga0105241_10004032 Ga0105241_100040329 211
8 3300013105 Ga0157369_10119325 Ga0157369_101193253 211
9 3300013307 Ga0157372_10469587 Ga0157372_104695872 211
10 3300025919 Ga0207657_10091241 Ga0207657_100912412 211
11 3300025933 Ga0207706_10002012 Ga0207706_1000201215 211
12 3300026023 Ga0207677_10241174 Ga0207677_102411741 211
13 3300005455 Ga0070663_100256692 Ga0070663_1002566922 212
14 3300011119 Ga0105246_10106657 Ga0105246_101066572 212
15 3300013102 Ga0157371_10045424 Ga0157371_100454241 212
16 3300013102 Ga0157371_10049727 Ga0157371_100497274 212
17 3300013296 Ga0157374_10002365 Ga0157374_100023658 212
18 3300013307 Ga0157372_10000001 Ga0157372_100000014 212
19 3300013308 Ga0157375_10041762 Ga0157375_100417622 212
20 3300025261 Ga0209233_1026482 Ga0209233_10264822 212
21 3300025904 Ga0207647_10001256 Ga0207647_1000125622 212
22 3300025911 Ga0207654_10036694 Ga0207654_100366942 212
23 3300026067 Ga0207678_10275828 Ga0207678_102758281 212
24 3300044656 Ga0466969_0217937 Ga0466969_0217937_78_785 212
25 3300037466 Ga0395898_0211978 Ga0395898_0211978_15_659 213
26 3300053093 Ga0500651_0006546 Ga0500651_0006546_5039_5713 213
27 3300005329 Ga0070683_100010899 Ga0070683_1000108995 217
28 3300005535 Ga0070684_100003827 Ga0070684_1000038275 217
29 3300005616 Ga0068852_100514355 Ga0068852_1005143551 218
30 3300026116 Ga0207674_10272568 Ga0207674_102725682 218
31 3300005327 Ga0070658_10040432 Ga0070658_100404322 219
32 3300005327 Ga0070658_10137981 Ga0070658_101379812 219
33 3300005366 Ga0070659_100074092 Ga0070659_1000740922 219
34 3300005530 Ga0070679_100007047 Ga0070679_1000070476 219
35 3300005563 Ga0068855_100010946 Ga0068855_1000109463 219
36 3300013307 Ga0157372_10024950 Ga0157372_100249505 219
37 3300025909 Ga0207705_10023834 Ga0207705_100238342 219
38 3300025921 Ga0207652_10000013 Ga0207652_10000013140 219
39 3300025932 Ga0207690_10071519 Ga0207690_100715192 219
40 3300025949 Ga0207667_10053465 Ga0207667_100534652 219
41 3300032004 Ga0307414_10007853 Ga0307414_100078532 219
42 3300032004 Ga0307414_10037368 Ga0307414_100373682 219
43 3300037312 Ga0395899_0011557 Ga0395899_0011557_5418_6125 219
44 3300037418 Ga0395900_0007472 Ga0395900_0007472_3839_4546 219
45 3300038443 Ga0395901_0143402 Ga0395901_0143402_997_1704 219
46 3300003781 Ga0055536_1000049 Ga0055536_100004929 221
47 3300003791 Ga0055530_10002255 Ga0055530_100022558 221
48 3300013104 Ga0157370_10021571 Ga0157370_100215712 221
49 3300013104 Ga0157370_10076917 Ga0157370_100769174 221
50 3300013105 Ga0157369_10002425 Ga0157369_1000242514 221
51 3300013307 Ga0157372_11176072 Ga0157372_111760721 221
52 3300017792 Ga0163161_10000391 Ga0163161_1000039117 221
53 3300025292 Ga0209676_1000001 Ga0209676_100000169 221
54 3300025298 Ga0209050_1000258 Ga0209050_100025830 221
55 3300037312 Ga0395899_0000011 Ga0395899_0000011_316031_316738 221
56 3300037312 Ga0395899_0002810 Ga0395899_0002810_9517_10224 221
57 3300046512 Ga0495610_0000160 Ga0495610_0000160_38008_38712 221
58 3300046512 Ga0495610_0000986 Ga0495610_0000986_5490_6194 221
59 3300005288 Ga0065714_10003574 Ga0065714_100035747 222
60 3300005288 Ga0065714_10177409 Ga0065714_101774091 222
61 3300003323 rootH1_10370031 rootH1_103700311 223
62 3300009094 Ga0111539_10173129 Ga0111539_101731293 223
63 3300013102 Ga0157371_10000669 Ga0157371_1000066916 223
64 3300013104 Ga0157370_10082501 Ga0157370_100825012 223
65 3300013105 Ga0157369_10051400 Ga0157369_100514002 223
66 3300013306 Ga0163162_10025960 Ga0163162_100259606 223
67 3300013307 Ga0157372_10662927 Ga0157372_106629271 223
68 3300013307 Ga0157372_11527631 Ga0157372_115276311 223
69 3300013308 Ga0157375_10132484 Ga0157375_101324842 223
70 3300014326 Ga0157380_10297560 Ga0157380_102975602 223
71 3300025949 Ga0207667_10085652 Ga0207667_100856522 223
72 3300032004 Ga0307414_10068899 Ga0307414_100688992 223
73 3300032004 Ga0307414_10807555 Ga0307414_108075551 223
74 3300037312 Ga0395899_0061352 Ga0395899_0061352_1766_2473 223
75 3300037418 Ga0395900_0125592 Ga0395900_0125592_497_1204 223
76 3300037466 Ga0395898_0076094 Ga0395898_0076094_2237_2944 223
77 3300038443 Ga0395901_0205181 Ga0395901_0205181_88_795 223
78 iso_pu_bacteria 3003233435 3003235630 223
79 3300005577 Ga0068857_100333316 Ga0068857_1003333162 224
80 3300005617 Ga0068859_100797462 Ga0068859_1007974621 224
81 3300006931 Ga0097620_100797493 Ga0097620_1007974932 224
82 3300013102 Ga0157371_10115699 Ga0157371_101156992 224
83 3300013307 Ga0157372_10230547 Ga0157372_102305472 224
84 3300014326 Ga0157380_10201496 Ga0157380_102014962 224
85 3300014497 Ga0182008_10000001 Ga0182008_10000001455 224
86 3300031903 Ga0307407_10480984 Ga0307407_104809841 224
87 3300032004 Ga0307414_10087685 Ga0307414_100876852 224
88 3300037418 Ga0395900_0287442 Ga0395900_0287442_284_991 224
89 3300037471 Ga0395905_0004093 Ga0395905_0004093_11325_12032 224
90 3300044684 Ga0466966_0189565 Ga0466966_0189565_312_1022 224
91 3300044712 Ga0453684_0462049 Ga0453684_0462049_446_1153 224
92 3300046471 Ga0495650_0000110 Ga0495650_0000110_46452_47159 224
93 3300046507 Ga0495606_0000003 Ga0495606_0000003_290091_290798 224
94 3300046512 Ga0495610_0000273 Ga0495610_0000273_7784_8491 224
95 3300046520 Ga0495637_0037407 Ga0495637_0037407_699_1406 224
96 3300046558 Ga0495633_0003146 Ga0495633_0003146_9837_10544 224
97 3300046616 Ga0495668_0044968 Ga0495668_0044968_1528_2235 224
98 3300046660 Ga0495625_0000013 Ga0495625_0000013_148072_148779 224
99 3300046665 Ga0495661_0005878 Ga0495661_0005878_3339_4046 224
100 3300046692 Ga0495671_0062239 Ga0495671_0062239_488_1195 224
101 3300046694 Ga0495649_0000010 Ga0495649_0000010_196287_196994 224
102 3300049521 Ga0501298_044117 Ga0501298_044117_146_853 224
103 3300049654 Ga0501207_038244 Ga0501207_038244_106_813 224
104 3300049656 Ga0501209_104595 Ga0501209_104595_111_818 224
105 3300049661 Ga0501217_012400 Ga0501217_012400_1127_1834 224
106 3300049661 Ga0501217_016078 Ga0501217_016078_50_757 224
107 3300049663 Ga0501223_024888 Ga0501223_024888_42_749 224
108 3300049674 Ga0501242_002652 Ga0501242_002652_152_859 224
109 3300049686 Ga0501257_021900 Ga0501257_021900_149_856 224
110 3300049686 Ga0501257_043610 Ga0501257_043610_181_888 224
111 3300049758 Ga0501241_029228 Ga0501241_029228_70_777 224
112 3300053122 Ga0500608_097577 Ga0500608_097577_632_1339 224
113 3300053157 Ga0500624_000475 Ga0500624_000475_2680_3387 224
114 3300053161 Ga0500634_0075274 Ga0500634_0075274_644_1351 224
115 3300053161 Ga0500634_0171196 Ga0500634_0171196_104_811 224
116 3300005337 Ga0070682_100489838 Ga0070682_1004898381 225
117 3300005439 Ga0070711_100842296 Ga0070711_1008422961 225
118 3300005530 Ga0070679_100172794 Ga0070679_1001727942 225
119 3300005539 Ga0068853_100035054 Ga0068853_1000350542 225
120 3300005563 Ga0068855_100050773 Ga0068855_1000507732 225
121 3300005614 Ga0068856_100012482 Ga0068856_1000124827 225
122 3300009174 Ga0105241_10003058 Ga0105241_100030584 225
123 3300009545 Ga0105237_10043874 Ga0105237_100438744 225
124 3300010375 Ga0105239_10107396 Ga0105239_101073962 225
125 3300013100 Ga0157373_10030373 Ga0157373_100303732 225
126 3300013105 Ga0157369_10012447 Ga0157369_100124472 225
127 3300013307 Ga0157372_10159511 Ga0157372_101595112 225
128 3300031251 Ga0265327_10000207 Ga0265327_10000207135 225
129 3300005458 Ga0070681_10292575 Ga0070681_102925752 226
130 3300025912 Ga0207707_10235031 Ga0207707_102350312 226
131 3300049758 Ga0501241_016232 Ga0501241_016232_455_1144 226
132 iso_pu_bacteria 2522125168 2522550541 227
133 iso_pu_bacteria 2585427687 2586210541 227
134 iso_pu_bacteria 2738541284 2738764218 227
135 iso_pu_bacteria 2739367651 2739590438 227
136 iso_pu_bacteria 2775506987 2776611961 227
137 iso_pu_bacteria 2738541284 2738761122 228
138 iso_pu_bacteria 2775506987 2776613335 229
139 3300009093 Ga0105240_10688948 Ga0105240_106889482 230
140 3300025919 Ga0207657_10594048 Ga0207657_105940481 230
141 iso_pu_bacteria 2738541283 2738758029 230
142 iso_pu_bacteria 2840677318 2840678376 230
143 iso_pu_bacteria 2883068021 2883071020 230
144 iso_pu_bacteria 2890737413 2890739285 230
145 iso_pu_bacteria 2896085136 2896086193 230
146 2162886007 SwRhRL2b_contig_2963908 SwRhRL2b_0565.00004480 231
147 2162886007 SwRhRL2b_contig_3952261 SwRhRL2b_0141.00000140 231
148 2162886007 SwRhRL2b_contig_406873 SwRhRL2b_0266.00005150 231
149 3300001904 JGI24736J21556_1004776 JGI24736J21556_10047762 231
150 3300003320 rootH2_10038132 rootH2_100381322 231
151 3300003322 rootL2_10276438 rootL2_102764382 231
152 3300003781 Ga0055536_1014867 Ga0055536_10148672 231
153 3300005262 Ga0065165_1000043 Ga0065165_100004346 231
154 3300005288 Ga0065714_10002765 Ga0065714_1000276526 231
155 3300005288 Ga0065714_10003280 Ga0065714_1000328014 231
156 3300005288 Ga0065714_10064461 Ga0065714_1006446115 231
157 3300005289 Ga0065704_10070251 Ga0065704_1007025127 231
158 3300005289 Ga0065704_10070264 Ga0065704_1007026423 231
159 3300005289 Ga0065704_10074701 Ga0065704_100747012 231
160 3300005289 Ga0065704_10083829 Ga0065704_100838292 231
161 3300005327 Ga0070658_10152781 Ga0070658_101527812 231
162 3300005327 Ga0070658_10236031 Ga0070658_102360312 231
163 3300005327 Ga0070658_10249902 Ga0070658_102499022 231
164 3300005336 Ga0070680_100034152 Ga0070680_1000341523 231
165 3300005336 Ga0070680_100041219 Ga0070680_1000412192 231
166 3300005336 Ga0070680_100044817 Ga0070680_1000448172 231
167 3300005339 Ga0070660_100000248 Ga0070660_10000024823 231
168 3300005339 Ga0070660_100032917 Ga0070660_1000329172 231
169 3300005339 Ga0070660_100075330 Ga0070660_1000753302 231
170 3300005339 Ga0070660_100121747 Ga0070660_1001217472 231
171 3300005339 Ga0070660_100386844 Ga0070660_1003868442 231
172 3300005339 Ga0070660_100685691 Ga0070660_1006856911 231
173 3300005345 Ga0070692_10075166 Ga0070692_100751663 231
174 3300005345 Ga0070692_10294762 Ga0070692_102947621 231
175 3300005366 Ga0070659_100016252 Ga0070659_1000162522 231
176 3300005366 Ga0070659_100191689 Ga0070659_1001916892 231
177 3300005366 Ga0070659_100214917 Ga0070659_1002149171 231
178 3300005366 Ga0070659_100456738 Ga0070659_1004567381 231
179 3300005435 Ga0070714_100241043 Ga0070714_1002410432 231
180 3300005455 Ga0070663_100056455 Ga0070663_1000564552 231
181 3300005455 Ga0070663_100488379 Ga0070663_1004883791 231
182 3300005458 Ga0070681_10038735 Ga0070681_100387353 231
183 3300005458 Ga0070681_10090849 Ga0070681_100908492 231
184 3300005458 Ga0070681_10095446 Ga0070681_100954462 231
185 3300005458 Ga0070681_10127416 Ga0070681_101274162 231
186 3300005530 Ga0070679_100005261 Ga0070679_1000052613 231
187 3300005530 Ga0070679_100041922 Ga0070679_1000419224 231
188 3300005530 Ga0070679_100483233 Ga0070679_1004832331 231
189 3300005535 Ga0070684_100112308 Ga0070684_1001123082 231
190 3300005535 Ga0070684_100662108 Ga0070684_1006621081 231
191 3300005539 Ga0068853_100036668 Ga0068853_1000366684 231
192 3300005563 Ga0068855_100000133 Ga0068855_10000013347 231
193 3300005563 Ga0068855_100013163 Ga0068855_1000131632 231
194 3300005563 Ga0068855_100015792 Ga0068855_1000157922 231
195 3300005563 Ga0068855_100034910 Ga0068855_1000349102 231
196 3300005563 Ga0068855_100084165 Ga0068855_1000841653 231
197 3300005563 Ga0068855_100177928 Ga0068855_1001779284 231
198 3300005563 Ga0068855_100293363 Ga0068855_1002933632 231
199 3300005563 Ga0068855_100332762 Ga0068855_1003327621 231
200 3300005563 Ga0068855_100504063 Ga0068855_1005040631 231
201 3300005577 Ga0068857_100005425 Ga0068857_1000054252 231
202 3300005577 Ga0068857_100308106 Ga0068857_1003081062 231
203 3300005577 Ga0068857_100756013 Ga0068857_1007560132 231
204 3300005578 Ga0068854_100052660 Ga0068854_1000526604 231
205 3300005578 Ga0068854_100601720 Ga0068854_1006017201 231
206 3300005614 Ga0068856_100026443 Ga0068856_1000264433 231
207 3300005614 Ga0068856_100056937 Ga0068856_1000569372 231
208 3300005614 Ga0068856_100160544 Ga0068856_1001605442 231
209 3300005616 Ga0068852_100000379 Ga0068852_10000037910 231
210 3300005616 Ga0068852_100009701 Ga0068852_1000097012 231
211 3300005616 Ga0068852_100010691 Ga0068852_1000106912 231
212 3300005616 Ga0068852_100138890 Ga0068852_1001388901 231
213 3300005616 Ga0068852_100160428 Ga0068852_1001604282 231
214 3300005616 Ga0068852_100162089 Ga0068852_1001620892 231
215 3300009093 Ga0105240_10000398 Ga0105240_1000039823 231
216 3300009093 Ga0105240_10003613 Ga0105240_100036136 231
217 3300009093 Ga0105240_10018469 Ga0105240_100184695 231
218 3300009174 Ga0105241_10430544 Ga0105241_104305441 231
219 3300009174 Ga0105241_10510836 Ga0105241_105108361 231
220 3300009545 Ga0105237_10002634 Ga0105237_100026346 231
221 3300009545 Ga0105237_10527315 Ga0105237_105273152 231
222 3300010375 Ga0105239_10451983 Ga0105239_104519831 231
223 3300010375 Ga0105239_10549740 Ga0105239_105497402 231
224 3300013100 Ga0157373_10000043 Ga0157373_1000004347 231
225 3300013100 Ga0157373_10000601 Ga0157373_100006019 231
226 3300013100 Ga0157373_10001097 Ga0157373_100010974 231
227 3300013100 Ga0157373_10036689 Ga0157373_100366893 231
228 3300013100 Ga0157373_10071380 Ga0157373_100713803 231
229 3300013100 Ga0157373_10082703 Ga0157373_100827032 231
230 3300013100 Ga0157373_10144127 Ga0157373_101441272 231
231 3300013100 Ga0157373_10264921 Ga0157373_102649211 231
232 3300013102 Ga0157371_10000416 Ga0157371_1000041613 231
233 3300013102 Ga0157371_10000486 Ga0157371_1000048626 231
234 3300013102 Ga0157371_10002197 Ga0157371_100021973 231
235 3300013102 Ga0157371_10006268 Ga0157371_100062687 231
236 3300013102 Ga0157371_10006997 Ga0157371_100069972 231
237 3300013102 Ga0157371_10008009 Ga0157371_100080099 231
238 3300013102 Ga0157371_10044900 Ga0157371_100449002 231
239 3300013102 Ga0157371_10054230 Ga0157371_100542302 231
240 3300013102 Ga0157371_10063488 Ga0157371_100634883 231
241 3300013102 Ga0157371_10080996 Ga0157371_100809962 231
242 3300013102 Ga0157371_10105100 Ga0157371_101051002 231
243 3300013104 Ga0157370_10001110 Ga0157370_100011102 231
244 3300013104 Ga0157370_10003868 Ga0157370_100038688 231
245 3300013104 Ga0157370_10009399 Ga0157370_100093992 231
246 3300013104 Ga0157370_10027947 Ga0157370_100279473 231
247 3300013104 Ga0157370_10033765 Ga0157370_100337652 231
248 3300013104 Ga0157370_10039979 Ga0157370_100399792 231
249 3300013104 Ga0157370_10077212 Ga0157370_100772122 231
250 3300013104 Ga0157370_10096371 Ga0157370_100963714 231
251 3300013104 Ga0157370_10128511 Ga0157370_101285111 231
252 3300013104 Ga0157370_10264738 Ga0157370_102647381 231
253 3300013104 Ga0157370_10497078 Ga0157370_104970781 231
254 3300013105 Ga0157369_10029992 Ga0157369_100299921 231
255 3300013105 Ga0157369_10031013 Ga0157369_100310133 231
256 3300013105 Ga0157369_10059136 Ga0157369_100591363 231
257 3300013105 Ga0157369_10232885 Ga0157369_102328852 231
258 3300013105 Ga0157369_10374131 Ga0157369_103741312 231
259 3300013105 Ga0157369_10578149 Ga0157369_105781491 231
260 3300013307 Ga0157372_10000231 Ga0157372_1000023162 231
261 3300013307 Ga0157372_10006539 Ga0157372_100065396 231
262 3300013307 Ga0157372_10030816 Ga0157372_100308162 231
263 3300013307 Ga0157372_10041576 Ga0157372_100415762 231
264 3300013307 Ga0157372_10050249 Ga0157372_100502496 231
265 3300013307 Ga0157372_10051149 Ga0157372_100511492 231
266 3300013307 Ga0157372_10052906 Ga0157372_100529062 231
267 3300013307 Ga0157372_10064620 Ga0157372_100646202 231
268 3300013307 Ga0157372_10097277 Ga0157372_100972772 231
269 3300013307 Ga0157372_10605419 Ga0157372_106054191 231
270 3300013307 Ga0157372_10664324 Ga0157372_106643241 231
271 3300014497 Ga0182008_10020046 Ga0182008_100200462 231
272 3300014497 Ga0182008_10053850 Ga0182008_100538502 231
273 3300014497 Ga0182008_10164783 Ga0182008_101647831 231
274 3300015261 Ga0182006_1001890 Ga0182006_10018907 231
275 3300015262 Ga0182007_10002417 Ga0182007_100024175 231
276 3300015262 Ga0182007_10006207 Ga0182007_100062073 231
277 3300015262 Ga0182007_10010010 Ga0182007_100100102 231
278 3300015262 Ga0182007_10033678 Ga0182007_100336781 231
279 3300025292 Ga0209676_1000584 Ga0209676_100058428 231
280 3300025298 Ga0209050_1021200 Ga0209050_10212002 231
281 3300025904 Ga0207647_10001340 Ga0207647_1000134011 231
282 3300025904 Ga0207647_10001627 Ga0207647_1000162717 231
283 3300025904 Ga0207647_10015743 Ga0207647_100157434 231
284 3300025909 Ga0207705_10055498 Ga0207705_100554981 231
285 3300025909 Ga0207705_10184471 Ga0207705_101844712 231
286 3300025909 Ga0207705_10214811 Ga0207705_102148111 231
287 3300025911 Ga0207654_10022968 Ga0207654_100229684 231
288 3300025912 Ga0207707_10010112 Ga0207707_100101122 231
289 3300025912 Ga0207707_10044580 Ga0207707_100445802 231
290 3300025912 Ga0207707_10077699 Ga0207707_100776992 231
291 3300025912 Ga0207707_10250489 Ga0207707_102504891 231
292 3300025913 Ga0207695_10000076 Ga0207695_1000007684 231
293 3300025913 Ga0207695_10000090 Ga0207695_1000009083 231
294 3300025913 Ga0207695_10022607 Ga0207695_100226072 231
295 3300025913 Ga0207695_10049043 Ga0207695_100490433 231
296 3300025913 Ga0207695_10217409 Ga0207695_102174092 231
297 3300025914 Ga0207671_10003364 Ga0207671_100033645 231
298 3300025914 Ga0207671_10269179 Ga0207671_102691792 231
299 3300025914 Ga0207671_10366505 Ga0207671_103665052 231
300 3300025917 Ga0207660_10024530 Ga0207660_100245302 231
301 3300025917 Ga0207660_10102087 Ga0207660_101020872 231
302 3300025919 Ga0207657_10005835 Ga0207657_100058357 231
303 3300025919 Ga0207657_10012918 Ga0207657_100129182 231
304 3300025919 Ga0207657_10039289 Ga0207657_100392893 231
305 3300025919 Ga0207657_10056361 Ga0207657_100563612 231
306 3300025919 Ga0207657_10110544 Ga0207657_101105442 231
307 3300025919 Ga0207657_10350445 Ga0207657_103504451 231
308 3300025921 Ga0207652_10000074 Ga0207652_100000744 231
309 3300025921 Ga0207652_10001161 Ga0207652_1000116118 231
310 3300025921 Ga0207652_10006665 Ga0207652_100066654 231
311 3300025921 Ga0207652_10058952 Ga0207652_100589522 231
312 3300025932 Ga0207690_10039609 Ga0207690_100396094 231
313 3300025932 Ga0207690_10399516 Ga0207690_103995161 231
314 3300025949 Ga0207667_10000100 Ga0207667_1000010064 231
315 3300025949 Ga0207667_10000453 Ga0207667_1000045311 231
316 3300025949 Ga0207667_10007036 Ga0207667_100070363 231
317 3300025949 Ga0207667_10031568 Ga0207667_100315682 231
318 3300025949 Ga0207667_10078643 Ga0207667_100786433 231
319 3300025949 Ga0207667_10202045 Ga0207667_102020452 231
320 3300025949 Ga0207667_10393940 Ga0207667_103939401 231
321 3300025981 Ga0207640_10002604 Ga0207640_100026043 231
322 3300025981 Ga0207640_10036485 Ga0207640_100364854 231
323 3300025981 Ga0207640_10070442 Ga0207640_100704422 231
324 3300025981 Ga0207640_10110572 Ga0207640_101105722 231
325 3300026041 Ga0207639_10071515 Ga0207639_100715152 231
326 3300026041 Ga0207639_10074848 Ga0207639_100748483 231
327 3300026067 Ga0207678_10010312 Ga0207678_100103126 231
328 3300026067 Ga0207678_10508729 Ga0207678_105087291 231
329 3300026078 Ga0207702_10158511 Ga0207702_101585112 231
330 3300026078 Ga0207702_10309263 Ga0207702_103092632 231
331 3300026078 Ga0207702_10389866 Ga0207702_103898662 231
332 3300026078 Ga0207702_10675196 Ga0207702_106751961 231
333 3300026116 Ga0207674_10009127 Ga0207674_100091278 231
334 3300026142 Ga0207698_10002846 Ga0207698_100028464 231
335 3300026142 Ga0207698_10076191 Ga0207698_100761912 231
336 3300026142 Ga0207698_10086925 Ga0207698_100869252 231
337 3300026142 Ga0207698_10098785 Ga0207698_100987852 231
338 3300026142 Ga0207698_10424064 Ga0207698_104240641 231
339 3300026142 Ga0207698_10624459 Ga0207698_106244591 231
340 3300028794 Ga0307515_10000493 Ga0307515_1000049336 231
341 3300031456 Ga0307513_10638751 Ga0307513_106387511 231
342 3300031911 Ga0307412_10000043 Ga0307412_1000004334 231
343 3300031911 Ga0307412_10000075 Ga0307412_1000007536 231
344 3300032004 Ga0307414_10002997 Ga0307414_100029972 231
345 3300032004 Ga0307414_10007108 Ga0307414_100071084 231
346 3300037312 Ga0395899_0006589 Ga0395899_0006589_549_1256 231
347 3300037312 Ga0395899_0033699 Ga0395899_0033699_2868_3575 231
348 3300037312 Ga0395899_0299052 Ga0395899_0299052_291_998 231
349 3300037418 Ga0395900_0007567 Ga0395900_0007567_7107_7814 231
350 3300037418 Ga0395900_0010663 Ga0395900_0010663_4055_4762 231
351 3300037418 Ga0395900_0276504 Ga0395900_0276504_736_1443 231
352 3300037466 Ga0395898_0001381 Ga0395898_0001381_8847_9554 231
353 3300037466 Ga0395898_0016533 Ga0395898_0016533_5710_6417 231
354 3300037466 Ga0395898_0032678 Ga0395898_0032678_3955_4662 231
355 3300037471 Ga0395905_0288055 Ga0395905_0288055_561_1268 231
356 3300037471 Ga0395905_0372563 Ga0395905_0372563_477_1184 231
357 3300038443 Ga0395901_0437233 Ga0395901_0437233_487_1194 231
358 3300038443 Ga0395901_0437876 Ga0395901_0437876_71_778 231
359 3300038443 Ga0395901_0461149 Ga0395901_0461149_515_1222 231
360 3300042876 Ga0451577_0000061 Ga0451577_0000061_129387_130103 231
361 3300044712 Ga0453684_0000084 Ga0453684_0000084_265325_266041 231
362 3300045051 Ga0451576_0000179 Ga0451576_0000179_88069_88785 231
363 3300047446 Ga0495679_041808 Ga0495679_041808_223_930 231
364 3300048919 Ga0496116_0015738 Ga0496116_0015738_4983_5711 231
365 3300048920 Ga0496117_0006685 Ga0496117_0006685_991_1719 231
366 3300048925 Ga0496122_0012107 Ga0496122_0012107_7399_8127 231
367 3300048926 Ga0496123_0027164 Ga0496123_0027164_3295_4023 231
368 3300049569 Ga0501032_0242806 Ga0501032_0242806_246_956 231
369 3300049570 Ga0501033_0429251 Ga0501033_0429251_42_752 231
370 3300049571 Ga0501034_0022633 Ga0501034_0022633_563_1273 231
371 3300049571 Ga0501034_0125138 Ga0501034_0125138_870_1577 231
372 3300049571 Ga0501034_0420785 Ga0501034_0420785_215_922 231
373 3300049586 Ga0501070_0194112 Ga0501070_0194112_22_729 231
374 3300049586 Ga0501070_0251565 Ga0501070_0251565_596_1306 231
375 3300049822 Ga0501035_0172033 Ga0501035_0172033_721_1428 231
376 3300049823 Ga0501044_0315007 Ga0501044_0315007_102_812 231
377 3300053093 Ga0500651_0000625 Ga0500651_0000625_232_936 231
378 3300053094 Ga0500566_0202241 Ga0500566_0202241_89_793 231
379 3300053139 Ga0500568_0048983 Ga0500568_0048983_144_839 231
380 3300053157 Ga0500624_000108 Ga0500624_000108_25779_26486 231
381 iso_pu_bacteria 2721755487 2722726718 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

18

81

0.97

PF07729

FCD

FCD domain

106

228

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwg-assembly2.cif.gz_C-2 the crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168 0.8871 16 82
3f8m-assembly1.cif.gz_B crystal structure of phnf from mycobacterium smegmatis 0.8758 19 81
8b2l-assembly1.cif.gz_E1 cryo-em structure of the plant 80s ribosome 0.8756 51 80
3bwg-assembly1.cif.gz_B the crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168 0.865 13 80
3bwg-assembly1.cif.gz_A the crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168 0.8444 18 82
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9339 38 79 1.10.10.10
6az6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9159 15 80 1.10.10.10
af_P0ACL7_6_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9038 13 81 1.10.10.10
af_Q2G1B1_1_68_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8953 13 80 1.10.10.10
3bwgC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8842 16 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5B8VK12-F1-model_v4 FadR family transcriptional regulator 0.8643 9 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A2T5BXX9-F1-model_v4 DNA-binding FadR family transcriptional regulator 0.8559 9 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A1F3NEE3-F1-model_v4 GntR family transcriptional regulator 0.8554 1 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A4Q0XFH8-F1-model_v4 FadR family transcriptional regulator 0.8536 10 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A1F3NEE3-F1-model_v4 GntR family transcriptional regulator 0.8487 1 230 GO:0003677
GO:0003700
GO:0005737

Feature Viewer

pLDDT pTM Quality
88.91 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map