F428922

General Info

Members Datasets Scaffolds Average Seq Length
381 179 379 296

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100002821|Ga0068863_10000282113
Length 338
Sequence MCGNFHFLRGWQVENGYKRLLKFCLILVSNHIMIKCLFSFPRCIYLTATLFLIPFILSSCAEQKNAMRSLKENIHQELSKQEGIFAVAFKDLSTGKELLINDTVTFHAASTMKTPVLVEVYKQAEEGKFSLSDSLIIKNEFKSIVDGSLFSLDSTDDSETELYKHIGEKRTISFLLYQMIIVSSNFATNLIIELVDAKNVSATMQQLGAKDIHVLRGVEDGKAFARGLNNTITAHGLMTLFEKMAKGKTVNPAASKAMIDILLDQKFNDIIPAELPAAVKVAHKTGFITGVHHDTGIIFLPNGKKYVLVLLSKNLKDEKAAIKAMAKVSKLIYEFVSR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
176 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 0.52
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10017715 3300003316 Bacteria 12699
2 rootH2_10015293 3300003320 Bacteria 9155
3 rootH2_10028817 3300003320 Bacteria 5897
4 rootH2_10051659 3300003320 Bacteria 3040
5 rootL2_10231775 3300003322 Bacteria 7631
6 rootL2_10268056 3300003322 Bacteria 2863
7 rootL2_10283606 3300003322 Unclassified 2289
8 rootH1_10015462 3300003323 Bacteria 13434
9 rootH1_10177446 3300003323 Bacteria 2596
10 Ga0055531_10001953 3300003794 Bacteria 14413
11 Ga0065712_10075156 3300005290 Bacteria 3918
12 Ga0065715_10114608 3300005293 Bacteria 2444
13 Ga0070658_10117879 3300005327 Bacteria 2204
14 Ga0070676_10011296 3300005328 Bacteria 4854
15 Ga0070683_100152268 3300005329 Bacteria 2193
16 Ga0070690_100046730 3300005330 Bacteria 2753
17 Ga0070670_100042006 3300005331 Bacteria 3930
18 Ga0070670_100071438 3300005331 Bacteria 2980
19 Ga0070670_100179248 3300005331 Bacteria 1839
20 Ga0068869_100017075 3300005334 Bacteria 4910
21 Ga0070666_10031380 3300005335 Bacteria 3507
22 Ga0070666_10105344 3300005335 Bacteria 1948
23 Ga0068868_100010727 3300005338 Bacteria 6641
24 Ga0068868_100017955 3300005338 Bacteria 5279
25 Ga0068868_100080275 3300005338 Unclassified 2614
26 Ga0068868_100318571 3300005338 Bacteria 1324
27 Ga0070660_100221719 3300005339 Bacteria 1537
28 Ga0070689_100029484 3300005340 Bacteria 4154
29 Ga0070689_100128734 3300005340 Bacteria 2028
30 Ga0070689_100229312 3300005340 Bacteria 1526
31 Ga0070687_100028516 3300005343 Bacteria 2709
32 Ga0070661_100003203 3300005344 Bacteria 11276
33 Ga0070661_100010992 3300005344 Bacteria 6308
34 Ga0070668_100074872 3300005347 Unclassified 2642
35 Ga0070669_100152805 3300005353 Bacteria 1788
36 Ga0070669_100231678 3300005353 Bacteria 1464
37 Ga0070675_100055432 3300005354 Bacteria 3263
38 Ga0070671_100078478 3300005355 Bacteria 2760
39 Ga0070671_100379107 3300005355 Bacteria 1209
40 Ga0070674_100246049 3300005356 Bacteria 1402
41 Ga0070673_100032993 3300005364 Bacteria 3904
42 Ga0070673_100034212 3300005364 Bacteria 3843
43 Ga0070673_100046959 3300005364 Bacteria 3357
44 Ga0070673_100249183 3300005364 Bacteria 1547
45 Ga0070673_100342572 3300005364 Bacteria 1325
46 Ga0070688_100008942 3300005365 Bacteria 5455
47 Ga0070688_100066713 3300005365 Bacteria 2290
48 Ga0070659_100025301 3300005366 Bacteria 4557
49 Ga0070659_100031300 3300005366 Bacteria 4120
50 Ga0070659_100428252 3300005366 Bacteria 1120
51 Ga0070667_100114218 3300005367 Bacteria 2344
52 Ga0070705_100273048 3300005440 Bacteria 1198
53 Ga0070678_100002435 3300005456 Bacteria 10194
54 Ga0070662_100021920 3300005457 Bacteria 4366
55 Ga0070662_100043003 3300005457 Bacteria 3229
56 Ga0070662_100063186 3300005457 Unclassified 2708
57 Ga0070681_10203203 3300005458 Bacteria 1899
58 Ga0068867_100029608 3300005459 Bacteria 3945
59 Ga0070685_10013499 3300005466 Bacteria 4309
60 Ga0070685_10073499 3300005466 Bacteria 2032
61 Ga0070685_10114477 3300005466 Bacteria 1667
62 Ga0070698_100013020 3300005471 Bacteria 8805
63 Ga0070698_100034146 3300005471 Bacteria 5269
64 Ga0070679_100000454 3300005530 Bacteria 34670
65 Ga0070679_100114312 3300005530 Bacteria 2684
66 Ga0070684_100000880 3300005535 Bacteria 21214
67 Ga0068853_100002867 3300005539 Bacteria 13082
68 Ga0068853_100052447 3300005539 Bacteria 3514
69 Ga0068853_100100230 3300005539 Bacteria 2560
70 Ga0068853_100105912 3300005539 Bacteria 2491
71 Ga0068853_100589496 3300005539 Bacteria 1055
72 Ga0068853_100651714 3300005539 Unclassified 1002
73 Ga0070672_100031631 3300005543 Bacteria 3985
74 Ga0070672_100120636 3300005543 Bacteria 2146
75 Ga0070693_100243883 3300005547 Bacteria 1188
76 Ga0070665_100000009 3300005548 Bacteria 562640
77 Ga0070665_100401235 3300005548 Unclassified 1379
78 Ga0068855_100004391 3300005563 Bacteria 17233
79 Ga0068855_100065598 3300005563 Bacteria 4233
80 Ga0068855_100147805 3300005563 Bacteria 2674
81 Ga0070664_100015208 3300005564 Bacteria 6289
82 Ga0070664_100028525 3300005564 Bacteria 4644
83 Ga0070664_100075165 3300005564 Bacteria 2901
84 Ga0070664_100079315 3300005564 Bacteria 2826
85 Ga0070664_100134759 3300005564 Bacteria 2171
86 Ga0068857_100004008 3300005577 Bacteria 12408
87 Ga0068857_100008896 3300005577 Bacteria 8697
88 Ga0068854_100099293 3300005578 Unclassified 2180
89 Ga0068854_100159270 3300005578 Bacteria 1747
90 Ga0068856_100053331 3300005614 Bacteria 3986
91 Ga0068856_100133575 3300005614 Bacteria 2487
92 Ga0068852_100002380 3300005616 Bacteria 12950
93 Ga0068852_100096861 3300005616 Bacteria 2653
94 Ga0068852_100129377 3300005616 Bacteria 2323
95 Ga0068852_100473619 3300005616 Unclassified 1243
96 Ga0068859_100046370 3300005617 Bacteria 4365
97 Ga0068859_100051078 3300005617 Bacteria 4155
98 Ga0068859_100094435 3300005617 Unclassified 3043
99 Ga0068861_100044518 3300005719 Bacteria 3338
100 Ga0068870_10051269 3300005840 Bacteria 2184
101 Ga0068870_10192833 3300005840 Bacteria 1231
102 Ga0068863_100002821 3300005841 Bacteria 17205
103 Ga0068863_100030063 3300005841 Bacteria 5189
104 Ga0068858_100070948 3300005842 Bacteria 3229
105 Ga0068858_100148526 3300005842 Bacteria 2202
106 Ga0068860_100000103 3300005843 Bacteria 139076
107 Ga0068860_100015123 3300005843 Bacteria 7542
108 Ga0068860_100047253 3300005843 Unclassified 4103
109 Ga0068862_100197746 3300005844 Bacteria 1811
110 Ga0068862_100472012 3300005844 Bacteria 1186
111 Ga0075366_10069475 3300006195 Bacteria 2096
112 Ga0097621_100021648 3300006237 Bacteria 4978
113 Ga0097621_100326352 3300006237 Bacteria 1360
114 Ga0097621_100359990 3300006237 Bacteria 1296
115 Ga0068871_100105158 3300006358 Unclassified 2368
116 Ga0075428_100103811 3300006844 Unclassified 3099
117 Ga0068865_100005051 3300006881 Bacteria 7986
118 Ga0097620_100046370 3300006931 Bacteria 4365
119 Ga0097620_100051079 3300006931 Bacteria 4155
120 Ga0097620_100094437 3300006931 Unclassified 3043
121 Ga0097620_100378536 3300006931 Unclassified 1511
122 Ga0105251_10134793 3300009011 Bacteria 1118
123 Ga0105240_10001038 3300009093 Bacteria 49382
124 Ga0105240_10021390 3300009093 Bacteria 8604
125 Ga0105240_10145535 3300009093 Bacteria 2828
126 Ga0111539_10040835 3300009094 Bacteria 5583
127 Ga0111539_10147262 3300009094 Bacteria 2757
128 Ga0114129_10034924 3300009147 Bacteria 7103
129 Ga0105243_10194406 3300009148 Bacteria 1774
130 Ga0105241_10018452 3300009174 Bacteria 5132
131 Ga0105241_10078148 3300009174 Bacteria 2585
132 Ga0105241_10084798 3300009174 Bacteria 2488
133 Ga0105241_10148878 3300009174 Bacteria 1913
134 Ga0105242_10003279 3300009176 Bacteria 12616
135 Ga0105242_10010443 3300009176 Bacteria 7125
136 Ga0105242_10034895 3300009176 Bacteria 4032
137 Ga0105242_10051105 3300009176 Bacteria 3367
138 Ga0105242_10156077 3300009176 Bacteria 1994
139 Ga0105242_10601461 3300009176 Unclassified 1062
140 Ga0105248_10199294 3300009177 Bacteria 2255
141 Ga0105248_10344715 3300009177 Bacteria 1677
142 Ga0105248_10378192 3300009177 Bacteria 1594
143 Ga0105237_10002841 3300009545 Bacteria 21059
144 Ga0105237_10033226 3300009545 Bacteria 5226
145 Ga0105237_10042796 3300009545 Unclassified 4565
146 Ga0105237_10158857 3300009545 Unclassified 2258
147 Ga0105238_10018417 3300009551 Bacteria 7108
148 Ga0105249_10000440 3300009553 Bacteria 39169
149 Ga0105249_10006991 3300009553 Bacteria 9845
150 Ga0105249_10064186 3300009553 Bacteria 3375
151 Ga0105249_10131621 3300009553 Bacteria 2389
152 Ga0105249_10269808 3300009553 Bacteria 1695
153 Ga0105239_10003441 3300010375 Bacteria 19384
154 Ga0105239_10011622 3300010375 Bacteria 9824
155 Ga0105239_10011881 3300010375 Bacteria 9716
156 Ga0105246_10020305 3300011119 Bacteria 4259
157 Ga0105246_10195807 3300011119 Bacteria 1567
158 Ga0105246_10312339 3300011119 Bacteria 1274
159 Ga0157373_10041465 3300013100 Bacteria 3293
160 Ga0157373_10064535 3300013100 Bacteria 2592
161 Ga0157373_10123402 3300013100 Bacteria 1821
162 Ga0157373_10167769 3300013100 Bacteria 1545
163 Ga0157371_10001203 3300013102 Bacteria 27690
164 Ga0157371_10002353 3300013102 Bacteria 18087
165 Ga0157371_10003304 3300013102 Bacteria 14752
166 Ga0157371_10006217 3300013102 Bacteria 9899
167 Ga0157371_10025928 3300013102 Bacteria 4265
168 Ga0157371_10113565 3300013102 Unclassified 1924
169 Ga0157370_10001268 3300013104 Bacteria 31549
170 Ga0157370_10028440 3300013104 Bacteria 5498
171 Ga0157370_10060169 3300013104 Bacteria 3607
172 Ga0157370_10303406 3300013104 Bacteria 1474
173 Ga0157369_10055078 3300013105 Bacteria 4293
174 Ga0157374_10000768 3300013296 Bacteria 28045
175 Ga0157374_10028526 3300013296 Bacteria 5043
176 Ga0157374_10244642 3300013296 Bacteria 1764
177 Ga0157378_10019725 3300013297 Bacteria 5928
178 Ga0157378_10131156 3300013297 Unclassified 2320
179 Ga0157378_10415499 3300013297 Bacteria 1328
180 Ga0163162_10003116 3300013306 Bacteria 15834
181 Ga0163162_10016333 3300013306 Bacteria 7257
182 Ga0163162_10047969 3300013306 Bacteria 4279
183 Ga0163162_10049721 3300013306 Unclassified 4202
184 Ga0163162_10088944 3300013306 Bacteria 3168
185 Ga0163162_10206342 3300013306 Unclassified 2094
186 Ga0163162_10244605 3300013306 Bacteria 1925
187 Ga0157372_10002622 3300013307 Bacteria 19467
188 Ga0157372_10012697 3300013307 Bacteria 8971
189 Ga0157372_10180998 3300013307 Bacteria 2440
190 Ga0157372_10369937 3300013307 Unclassified 1670
191 Ga0157372_10618109 3300013307 Bacteria 1263
192 Ga0157375_10014775 3300013308 Bacteria 6977
193 Ga0157375_10048684 3300013308 Bacteria 4148
194 Ga0157375_10067045 3300013308 Bacteria 3585
195 Ga0157375_10180946 3300013308 Bacteria 2259
196 Ga0157375_10538232 3300013308 Bacteria 1330
197 Ga0163163_10004390 3300014325 Bacteria 12017
198 Ga0163163_10154981 3300014325 Unclassified 2335
199 Ga0157380_10122351 3300014326 Bacteria 2206
200 Ga0157377_10008926 3300014745 Bacteria 4904
201 Ga0157377_10010118 3300014745 Bacteria 4654
202 Ga0157377_10016643 3300014745 Bacteria 3786
203 Ga0157377_10046295 3300014745 Bacteria 2432
204 Ga0157379_10076189 3300014968 Bacteria 3004
205 Ga0157379_10081969 3300014968 Bacteria 2890
206 Ga0157376_10072563 3300014969 Unclassified 2928
207 Ga0157376_10355426 3300014969 Bacteria 1403
208 Ga0157376_10448933 3300014969 Bacteria 1257
209 Ga0163161_10028517 3300017792 Bacteria 3965
210 Ga0163161_10029879 3300017792 Bacteria 3874
211 Ga0209257_1000007 3300025304 Bacteria 1564415
212 Ga0207697_10145289 3300025315 Bacteria 1030
213 Ga0207647_10041571 3300025904 Bacteria 2890
214 Ga0207647_10072898 3300025904 Bacteria 2070
215 Ga0207647_10195540 3300025904 Bacteria 1171
216 Ga0207685_10053370 3300025905 Bacteria 1570
217 Ga0207645_10000219 3300025907 Bacteria 47364
218 Ga0207645_10030770 3300025907 Bacteria 3459
219 Ga0207645_10049503 3300025907 Bacteria 2683
220 Ga0207645_10324500 3300025907 Bacteria 1027
221 Ga0207643_10037867 3300025908 Bacteria 2707
222 Ga0207643_10106784 3300025908 Bacteria 1646
223 Ga0207705_10212099 3300025909 Bacteria 1469
224 Ga0207654_10041162 3300025911 Bacteria 2607
225 Ga0207654_10058639 3300025911 Unclassified 2242
226 Ga0207654_10293473 3300025911 Bacteria 1103
227 Ga0207707_10297503 3300025912 Bacteria 1396
228 Ga0207695_10007537 3300025913 Bacteria 13795
229 Ga0207695_10019538 3300025913 Bacteria 7795
230 Ga0207695_10024993 3300025913 Bacteria 6702
231 Ga0207695_10334446 3300025913 Bacteria 1403
232 Ga0207671_10005789 3300025914 Bacteria 11251
233 Ga0207671_10016030 3300025914 Bacteria 5840
234 Ga0207671_10096828 3300025914 Unclassified 2230
235 Ga0207671_10188579 3300025914 Unclassified 1607
236 Ga0207657_10220214 3300025919 Bacteria 1521
237 Ga0207649_10013357 3300025920 Bacteria 4583
238 Ga0207649_10030617 3300025920 Bacteria 3189
239 Ga0207652_10000064 3300025921 Bacteria 111997
240 Ga0207652_10053816 3300025921 Bacteria 3458
241 Ga0207694_10075211 3300025924 Bacteria 2644
242 Ga0207650_10094666 3300025925 Bacteria 2288
243 Ga0207650_10499066 3300025925 Bacteria 1017
244 Ga0207659_10099925 3300025926 Bacteria 2185
245 Ga0207644_10370025 3300025931 Bacteria 1167
246 Ga0207644_10495559 3300025931 Bacteria 1007
247 Ga0207690_10013435 3300025932 Bacteria 4920
248 Ga0207706_10004613 3300025933 Bacteria 12927
249 Ga0207706_10041293 3300025933 Bacteria 4090
250 Ga0207706_10113264 3300025933 Bacteria 2386
251 Ga0207706_10147638 3300025933 Bacteria 2068
252 Ga0207686_10001725 3300025934 Bacteria 12168
253 Ga0207686_10013705 3300025934 Bacteria 4493
254 Ga0207686_10164757 3300025934 Bacteria 1557
255 Ga0207709_10374796 3300025935 Unclassified 1081
256 Ga0207670_10064765 3300025936 Bacteria 2506
257 Ga0207704_10138312 3300025938 Bacteria 1699
258 Ga0207704_10170279 3300025938 Bacteria 1561
259 Ga0207691_10026863 3300025940 Bacteria 5401
260 Ga0207691_10041145 3300025940 Bacteria 4268
261 Ga0207691_10415423 3300025940 Bacteria 1147
262 Ga0207689_10005499 3300025942 Bacteria 11332
263 Ga0207689_10007418 3300025942 Bacteria 9617
264 Ga0207689_10012591 3300025942 Bacteria 7225
265 Ga0207689_10052143 3300025942 Bacteria 3371
266 Ga0207689_10179983 3300025942 Unclassified 1743
267 Ga0207689_10394765 3300025942 Bacteria 1153
268 Ga0207661_10006521 3300025944 Bacteria 8251
269 Ga0207679_10008333 3300025945 Bacteria 6602
270 Ga0207679_10012269 3300025945 Bacteria 5582
271 Ga0207667_10002492 3300025949 Bacteria 22948
272 Ga0207667_10128355 3300025949 Bacteria 2612
273 Ga0207651_10068302 3300025960 Bacteria 2505
274 Ga0207651_10115259 3300025960 Unclassified 2026
275 Ga0207651_10364346 3300025960 Bacteria 1221
276 Ga0207712_10006329 3300025961 Bacteria 7469
277 Ga0207712_10008783 3300025961 Bacteria 6389
278 Ga0207668_10021341 3300025972 Unclassified 4130
279 Ga0207668_10022772 3300025972 Bacteria 4015
280 Ga0207668_10173644 3300025972 Bacteria 1693
281 Ga0207668_10188387 3300025972 Unclassified 1633
282 Ga0207640_10110085 3300025981 Bacteria 1950
283 Ga0207640_10242138 3300025981 Bacteria 1394
284 Ga0207658_10109645 3300025986 Unclassified 2180
285 Ga0207658_10153877 3300025986 Bacteria 1877
286 Ga0207677_10044312 3300026023 Bacteria 2963
287 Ga0207677_10060201 3300026023 Unclassified 2623
288 Ga0207677_10115394 3300026023 Unclassified 2009
289 Ga0207677_10314205 3300026023 Bacteria 1299
290 Ga0207703_10018755 3300026035 Bacteria 5404
291 Ga0207703_10126349 3300026035 Bacteria 2202
292 Ga0207639_10023865 3300026041 Bacteria 4420
293 Ga0207678_10047462 3300026067 Bacteria 3714
294 Ga0207708_10014273 3300026075 Bacteria 5942
295 Ga0207702_10199320 3300026078 Bacteria 1854
296 Ga0207641_10000331 3300026088 Bacteria 57928
297 Ga0207641_10010813 3300026088 Bacteria 7479
298 Ga0207641_10170550 3300026088 Bacteria 1986
299 Ga0207641_10348620 3300026088 Bacteria 1411
300 Ga0207648_10001733 3300026089 Bacteria 23873
301 Ga0207648_10043484 3300026089 Bacteria 3943
302 Ga0207648_10108630 3300026089 Unclassified 2435
303 Ga0207648_10219668 3300026089 Bacteria 1689
304 Ga0207676_10088814 3300026095 Bacteria 2531
305 Ga0207676_10115079 3300026095 Unclassified 2257
306 Ga0207676_10116793 3300026095 Bacteria 2243
307 Ga0207676_10147136 3300026095 Unclassified 2024
308 Ga0207674_10001043 3300026116 Bacteria 36010
309 Ga0207674_10007811 3300026116 Bacteria 12434
310 Ga0207675_100053459 3300026118 Bacteria 3768
311 Ga0207675_100158386 3300026118 Bacteria 2158
312 Ga0207675_100266287 3300026118 Bacteria 1662
313 Ga0207698_10023391 3300026142 Bacteria 4315
314 Ga0207698_10122754 3300026142 Bacteria 2202
315 Ga0207698_10523727 3300026142 Unclassified 1157
316 Ga0268266_10000105 3300028379 Bacteria 176691
317 Ga0268266_10333366 3300028379 Bacteria 1422
318 Ga0268264_10000013 3300028381 Bacteria 513859
319 Ga0268264_10010697 3300028381 Bacteria 7579
320 Ga0268264_10020469 3300028381 Bacteria 5406
321 Ga0307515_10000009 3300028794 Bacteria 653206
322 Ga0307511_10000135 3300030521 Bacteria 67934
323 Ga0307513_10106135 3300031456 Bacteria 2816
324 Ga0316576_10319869 3300031727 Bacteria 1158
325 Ga0307414_10007227 3300032004 Bacteria 6235
326 Ga0307414_10097167 3300032004 Unclassified 2206
327 Ga0316583_10022148 3300032133 Bacteria 2277
328 Ga0395899_0022859 3300037312 Bacteria 4737
329 Ga0395899_0027215 3300037312 Bacteria 4312
330 Ga0395900_0004748 3300037418 Bacteria 14328
331 Ga0395900_0017121 3300037418 Bacteria 7399
332 Ga0395900_0146685 3300037418 Bacteria 2412
333 Ga0395898_0002029 3300037466 Bacteria 25368
334 Ga0395898_0007863 3300037466 Bacteria 11312
335 Ga0395898_0106677 3300037466 Bacteria 2687
336 Ga0395901_0022671 3300038443 Bacteria 6438
337 Ga0395901_0028239 3300038443 Bacteria 5772
338 Ga0451807_2749233 3300041486 Bacteria 1344
339 Ga0439449_0015171 3300042007 Bacteria 2895
340 Ga0439457_000008 3300042014 Bacteria 42068
341 Ga0451577_0004582 3300042876 Bacteria 14524
342 Ga0451577_0041024 3300042876 Bacteria 4156
343 Ga0466969_0000114 3300044656 Bacteria 42943
344 Ga0466972_0000028 3300044658 Bacteria 171140
345 Ga0466972_0006551 3300044658 Bacteria 5852
346 Ga0466972_0026034 3300044658 Bacteria 2897
347 Ga0466961_0127346 3300044693 Bacteria 1597
348 Ga0453684_0000004 3300044712 Bacteria 1469893
349 Ga0453684_0003205 3300044712 Bacteria 37500
350 Ga0466968_0012293 3300044735 Bacteria 3348
351 Ga0466970_0301528 3300044765 Bacteria 904
352 Ga0466957_0001154 3300044842 Bacteria 13664
353 Ga0466957_0003127 3300044842 Bacteria 9016
354 Ga0466957_0354595 3300044842 Bacteria 996
355 Ga0466959_0000031 3300045049 Bacteria 111271
356 Ga0451576_0150218 3300045051 Bacteria 2430
357 Ga0495638_0000025 3300046460 Bacteria 353356
358 Ga0495638_0082256 3300046460 Bacteria 1953
359 Ga0495608_0114636 3300046511 Bacteria 1731
360 Ga0495608_0351698 3300046511 Bacteria 907
361 Ga0495648_0001451 3300046524 Bacteria 23185
362 Ga0495621_0010839 3300046539 Unclassified 2804
363 Ga0495667_0202927 3300046559 Bacteria 1269
364 Ga0495625_0181892 3300046660 Bacteria 1397
365 Ga0495658_0161823 3300046683 Bacteria 1381
366 Ga0495687_000010 3300047443 Bacteria 413735
367 Ga0496110_0057931 3300048913 Bacteria 3412
368 Ga0501047_0158311 3300049581 Bacteria 2137
369 Ga0501236_000236 3300049670 Bacteria 5907
370 nmdc:mga05p37_14505_c1 3300050507 Bacteria 9462
371 nmdc:mga08y16_121308_c1 3300050511 Bacteria 2720
372 nmdc:mga08y16_198402_c1 3300050511 Unclassified 2080
373 nmdc:mga08y16_361289_c1 3300050511 Bacteria 1491
374 Ga0500578_0077960 3300053086 Bacteria 2109
375 Ga0500589_009300 3300053147 Bacteria 4151
376 Ga0500616_0000024 3300053153 Bacteria 455811
377 Ga0500616_0025515 3300053153 Bacteria 3278
378 Ga0500622_0003469 3300053156 Bacteria 10500
379 Ga0466962_0236150 3300061719 Unclassified 897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100013020 Ga0070698_1000130204 272
2 3300005471 Ga0070698_100034146 Ga0070698_1000341464 272
3 3300005539 Ga0068853_100651714 Ga0068853_1006517141 272
4 3300009176 Ga0105242_10156077 Ga0105242_101560772 272
5 3300013102 Ga0157371_10006217 Ga0157371_100062178 272
6 3300013102 Ga0157371_10025928 Ga0157371_100259282 272
7 3300013104 Ga0157370_10060169 Ga0157370_100601693 272
8 3300013104 Ga0157370_10303406 Ga0157370_103034061 272
9 3300014745 Ga0157377_10016643 Ga0157377_100166434 272
10 3300025942 Ga0207689_10007418 Ga0207689_100074186 272
11 3300025961 Ga0207712_10006329 Ga0207712_100063295 272
12 3300026075 Ga0207708_10014273 Ga0207708_100142732 272
13 3300026095 Ga0207676_10115079 Ga0207676_101150792 272
14 3300026118 Ga0207675_100266287 Ga0207675_1002662872 272
15 3300037466 Ga0395898_0106677 Ga0395898_0106677_991_1809 272
16 3300046511 Ga0495608_0351698 Ga0495608_0351698_26_844 272
17 3300050511 nmdc:mga08y16_361289_c1 nmdc:mga08y16_361289_c1_96_914 272
18 3300025315 Ga0207697_10145289 Ga0207697_101452892 273
19 3300005614 Ga0068856_100053331 Ga0068856_1000533313 274
20 3300009545 Ga0105237_10033226 Ga0105237_100332264 274
21 3300010375 Ga0105239_10011881 Ga0105239_100118815 274
22 3300025914 Ga0207671_10188579 Ga0207671_101885792 274
23 3300026078 Ga0207702_10199320 Ga0207702_101993201 274
24 3300009147 Ga0114129_10034924 Ga0114129_100349245 276
25 3300042007 Ga0439449_0015171 Ga0439449_0015171_1807_2637 276
26 3300042014 Ga0439457_000008 Ga0439457_000008_26659_27489 276
27 3300044658 Ga0466972_0026034 Ga0466972_0026034_100_930 276
28 3300061719 Ga0466962_0236150 Ga0466962_0236150_20_850 276
29 3300005563 Ga0068855_100147805 Ga0068855_1001478052 277
30 3300009174 Ga0105241_10018452 Ga0105241_100184524 277
31 3300032133 Ga0316583_10022148 Ga0316583_100221482 277
32 3300044656 Ga0466969_0000114 Ga0466969_0000114_21097_21930 277
33 3300044693 Ga0466961_0127346 Ga0466961_0127346_163_996 277
34 3300044765 Ga0466970_0301528 Ga0466970_0301528_33_875 277
35 3300044842 Ga0466957_0003127 Ga0466957_0003127_3825_4658 277
36 3300045049 Ga0466959_0000031 Ga0466959_0000031_95157_95990 277
37 3300053147 Ga0500589_009300 Ga0500589_009300_1106_1939 277
38 3300003322 rootL2_10283606 rootL2_102836064 278
39 3300042876 Ga0451577_0004582 Ga0451577_0004582_6313_7155 278
40 3300044712 Ga0453684_0000004 Ga0453684_0000004_610790_611632 278
41 3300025931 Ga0207644_10495559 Ga0207644_104955591 281
42 3300003794 Ga0055531_10001953 Ga0055531_100019532 282
43 3300005330 Ga0070690_100046730 Ga0070690_1000467302 282
44 3300005364 Ga0070673_100249183 Ga0070673_1002491832 282
45 3300006237 Ga0097621_100359990 Ga0097621_1003599901 282
46 3300013297 Ga0157378_10019725 Ga0157378_100197254 282
47 3300025304 Ga0209257_1000007 Ga0209257_1000007388 282
48 3300025907 Ga0207645_10049503 Ga0207645_100495032 282
49 3300025940 Ga0207691_10415423 Ga0207691_104154231 282
50 3300026095 Ga0207676_10116793 Ga0207676_101167931 282
51 3300013100 Ga0157373_10064535 Ga0157373_100645352 284
52 3300006358 Ga0068871_100105158 Ga0068871_1001051584 285
53 3300009176 Ga0105242_10010443 Ga0105242_100104434 285
54 3300009177 Ga0105248_10378192 Ga0105248_103781922 285
55 3300009545 Ga0105237_10002841 Ga0105237_1000284111 285
56 3300013297 Ga0157378_10415499 Ga0157378_104154992 285
57 3300013306 Ga0163162_10049721 Ga0163162_100497214 285
58 3300013306 Ga0163162_10244605 Ga0163162_102446052 285
59 3300014968 Ga0157379_10081969 Ga0157379_100819692 285
60 3300014969 Ga0157376_10072563 Ga0157376_100725633 285
61 3300025904 Ga0207647_10195540 Ga0207647_101955401 285
62 3300025911 Ga0207654_10041162 Ga0207654_100411621 285
63 3300025914 Ga0207671_10005789 Ga0207671_100057893 285
64 3300025914 Ga0207671_10016030 Ga0207671_100160303 285
65 3300025934 Ga0207686_10001725 Ga0207686_100017257 285
66 3300053153 Ga0500616_0025515 Ga0500616_0025515_622_1485 287
67 3300005564 Ga0070664_100028525 Ga0070664_1000285253 288
68 3300009094 Ga0111539_10040835 Ga0111539_100408352 288
69 3300014325 Ga0163163_10004390 Ga0163163_100043904 288
70 3300025945 Ga0207679_10008333 Ga0207679_100083334 288
71 3300050511 nmdc:mga08y16_121308_c1 nmdc:mga08y16_121308_c1_1761_2633 288
72 3300009553 Ga0105249_10269808 Ga0105249_102698082 290
73 3300009093 Ga0105240_10001038 Ga0105240_1000103819 292
74 3300009545 Ga0105237_10042796 Ga0105237_100427965 292
75 3300009551 Ga0105238_10018417 Ga0105238_100184173 292
76 3300013307 Ga0157372_10618109 Ga0157372_106181092 292
77 3300025913 Ga0207695_10007537 Ga0207695_1000753712 292
78 3300025924 Ga0207694_10075211 Ga0207694_100752112 292
79 3300009148 Ga0105243_10194406 Ga0105243_101944061 293
80 3300013308 Ga0157375_10048684 Ga0157375_100486846 293
81 3300014745 Ga0157377_10010118 Ga0157377_100101182 293
82 3300028794 Ga0307515_10000009 Ga0307515_1000000984 293
83 3300032004 Ga0307414_10097167 Ga0307414_100971671 293
84 3300044842 Ga0466957_0354595 Ga0466957_0354595_73_966 293
85 3300003320 rootH2_10028817 rootH2_100288172 294
86 3300003322 rootL2_10231775 rootL2_102317755 294
87 3300003322 rootL2_10268056 rootL2_102680562 294
88 3300005327 Ga0070658_10117879 Ga0070658_101178791 294
89 3300005338 Ga0068868_100318571 Ga0068868_1003185711 294
90 3300005339 Ga0070660_100221719 Ga0070660_1002217191 294
91 3300005366 Ga0070659_100025301 Ga0070659_1000253013 294
92 3300005530 Ga0070679_100000454 Ga0070679_10000045424 294
93 3300005530 Ga0070679_100114312 Ga0070679_1001143122 294
94 3300005539 Ga0068853_100100230 Ga0068853_1001002303 294
95 3300005548 Ga0070665_100000009 Ga0070665_10000000964 294
96 3300005563 Ga0068855_100004391 Ga0068855_10000439114 294
97 3300005577 Ga0068857_100008896 Ga0068857_1000088962 294
98 3300005578 Ga0068854_100159270 Ga0068854_1001592702 294
99 3300005614 Ga0068856_100133575 Ga0068856_1001335753 294
100 3300005616 Ga0068852_100002380 Ga0068852_1000023805 294
101 3300005843 Ga0068860_100000103 Ga0068860_10000010347 294
102 3300006844 Ga0075428_100103811 Ga0075428_1001038113 294
103 3300009093 Ga0105240_10145535 Ga0105240_101455351 294
104 3300009094 Ga0111539_10147262 Ga0111539_101472622 294
105 3300013100 Ga0157373_10167769 Ga0157373_101677692 294
106 3300013102 Ga0157371_10001203 Ga0157371_1000120317 294
107 3300013102 Ga0157371_10002353 Ga0157371_100023535 294
108 3300013104 Ga0157370_10001268 Ga0157370_100012688 294
109 3300013104 Ga0157370_10028440 Ga0157370_100284403 294
110 3300013306 Ga0163162_10003116 Ga0163162_100031167 294
111 3300013307 Ga0157372_10002622 Ga0157372_1000262214 294
112 3300013307 Ga0157372_10012697 Ga0157372_100126975 294
113 3300025904 Ga0207647_10041571 Ga0207647_100415712 294
114 3300025909 Ga0207705_10212099 Ga0207705_102120991 294
115 3300025911 Ga0207654_10058639 Ga0207654_100586392 294
116 3300025912 Ga0207707_10297503 Ga0207707_102975031 294
117 3300025919 Ga0207657_10220214 Ga0207657_102202142 294
118 3300025921 Ga0207652_10000064 Ga0207652_1000006440 294
119 3300025921 Ga0207652_10053816 Ga0207652_100538163 294
120 3300025949 Ga0207667_10002492 Ga0207667_1000249220 294
121 3300025949 Ga0207667_10128355 Ga0207667_101283551 294
122 3300025981 Ga0207640_10110085 Ga0207640_101100852 294
123 3300026116 Ga0207674_10001043 Ga0207674_1000104329 294
124 3300026142 Ga0207698_10023391 Ga0207698_100233913 294
125 3300028379 Ga0268266_10000105 Ga0268266_1000010581 294
126 3300028381 Ga0268264_10000013 Ga0268264_10000013273 294
127 3300032004 Ga0307414_10007227 Ga0307414_100072275 294
128 3300037312 Ga0395899_0022859 Ga0395899_0022859_1776_2663 294
129 3300037312 Ga0395899_0027215 Ga0395899_0027215_3264_4151 294
130 3300037418 Ga0395900_0004748 Ga0395900_0004748_3532_4419 294
131 3300037418 Ga0395900_0017121 Ga0395900_0017121_4278_5165 294
132 3300037466 Ga0395898_0002029 Ga0395898_0002029_23337_24224 294
133 3300037466 Ga0395898_0007863 Ga0395898_0007863_9610_10497 294
134 3300038443 Ga0395901_0022671 Ga0395901_0022671_2031_2918 294
135 3300038443 Ga0395901_0028239 Ga0395901_0028239_3830_4717 294
136 3300046460 Ga0495638_0082256 Ga0495638_0082256_472_1365 294
137 3300046524 Ga0495648_0001451 Ga0495648_0001451_6725_7618 294
138 3300046660 Ga0495625_0181892 Ga0495625_0181892_384_1274 294
139 3300047443 Ga0495687_000010 Ga0495687_000010_37159_38052 294
140 3300050511 nmdc:mga08y16_198402_c1 nmdc:mga08y16_198402_c1_209_1099 294
141 3300053156 Ga0500622_0003469 Ga0500622_0003469_2908_3801 294
142 3300003320 rootH2_10051659 rootH2_100516592 295
143 3300005338 Ga0068868_100080275 Ga0068868_1000802751 295
144 3300005843 Ga0068860_100015123 Ga0068860_1000151232 295
145 3300009093 Ga0105240_10021390 Ga0105240_100213904 295
146 3300009545 Ga0105237_10158857 Ga0105237_101588573 295
147 3300010375 Ga0105239_10003441 Ga0105239_100034418 295
148 3300025913 Ga0207695_10024993 Ga0207695_100249932 295
149 3300025914 Ga0207671_10096828 Ga0207671_100968282 295
150 3300025986 Ga0207658_10109645 Ga0207658_101096452 295
151 3300026023 Ga0207677_10115394 Ga0207677_101153941 295
152 3300028379 Ga0268266_10333366 Ga0268266_103333662 295
153 3300028381 Ga0268264_10020469 Ga0268264_100204692 295
154 3300049670 Ga0501236_000236 Ga0501236_000236_4107_5003 295
155 iso_pu_bacteria 2911138879 2911142156 295
156 3300005290 Ga0065712_10075156 Ga0065712_100751562 296
157 3300005293 Ga0065715_10114608 Ga0065715_101146082 296
158 3300005328 Ga0070676_10011296 Ga0070676_100112962 296
159 3300005329 Ga0070683_100152268 Ga0070683_1001522682 296
160 3300005331 Ga0070670_100042006 Ga0070670_1000420063 296
161 3300005331 Ga0070670_100071438 Ga0070670_1000714384 296
162 3300005331 Ga0070670_100179248 Ga0070670_1001792482 296
163 3300005335 Ga0070666_10031380 Ga0070666_100313802 296
164 3300005335 Ga0070666_10105344 Ga0070666_101053442 296
165 3300005338 Ga0068868_100017955 Ga0068868_1000179556 296
166 3300005340 Ga0070689_100029484 Ga0070689_1000294842 296
167 3300005340 Ga0070689_100128734 Ga0070689_1001287343 296
168 3300005340 Ga0070689_100229312 Ga0070689_1002293122 296
169 3300005343 Ga0070687_100028516 Ga0070687_1000285162 296
170 3300005353 Ga0070669_100152805 Ga0070669_1001528052 296
171 3300005353 Ga0070669_100231678 Ga0070669_1002316781 296
172 3300005355 Ga0070671_100078478 Ga0070671_1000784782 296
173 3300005356 Ga0070674_100246049 Ga0070674_1002460492 296
174 3300005364 Ga0070673_100032993 Ga0070673_1000329932 296
175 3300005364 Ga0070673_100046959 Ga0070673_1000469592 296
176 3300005365 Ga0070688_100008942 Ga0070688_1000089428 296
177 3300005365 Ga0070688_100066713 Ga0070688_1000667132 296
178 3300005367 Ga0070667_100114218 Ga0070667_1001142182 296
179 3300005440 Ga0070705_100273048 Ga0070705_1002730481 296
180 3300005456 Ga0070678_100002435 Ga0070678_1000024355 296
181 3300005457 Ga0070662_100021920 Ga0070662_1000219202 296
182 3300005458 Ga0070681_10203203 Ga0070681_102032032 296
183 3300005466 Ga0070685_10013499 Ga0070685_100134995 296
184 3300005466 Ga0070685_10114477 Ga0070685_101144772 296
185 3300005539 Ga0068853_100105912 Ga0068853_1001059122 296
186 3300005539 Ga0068853_100589496 Ga0068853_1005894961 296
187 3300005543 Ga0070672_100031631 Ga0070672_1000316313 296
188 3300005564 Ga0070664_100079315 Ga0070664_1000793153 296
189 3300005564 Ga0070664_100134759 Ga0070664_1001347592 296
190 3300005616 Ga0068852_100096861 Ga0068852_1000968614 296
191 3300005617 Ga0068859_100046370 Ga0068859_1000463708 296
192 3300005617 Ga0068859_100051078 Ga0068859_1000510782 296
193 3300005719 Ga0068861_100044518 Ga0068861_1000445183 296
194 3300005840 Ga0068870_10051269 Ga0068870_100512692 296
195 3300005840 Ga0068870_10192833 Ga0068870_101928332 296
196 3300005841 Ga0068863_100002821 Ga0068863_10000282113 296
197 3300005841 Ga0068863_100030063 Ga0068863_1000300634 296
198 3300005842 Ga0068858_100070948 Ga0068858_1000709484 296
199 3300005842 Ga0068858_100148526 Ga0068858_1001485263 296
200 3300005844 Ga0068862_100197746 Ga0068862_1001977461 296
201 3300006237 Ga0097621_100021648 Ga0097621_1000216484 296
202 3300006881 Ga0068865_100005051 Ga0068865_1000050512 296
203 3300006931 Ga0097620_100046370 Ga0097620_1000463708 296
204 3300006931 Ga0097620_100051079 Ga0097620_1000510792 296
205 3300006931 Ga0097620_100378536 Ga0097620_1003785361 296
206 3300009174 Ga0105241_10078148 Ga0105241_100781481 296
207 3300009176 Ga0105242_10034895 Ga0105242_100348953 296
208 3300009176 Ga0105242_10051105 Ga0105242_100511052 296
209 3300009177 Ga0105248_10199294 Ga0105248_101992943 296
210 3300009177 Ga0105248_10344715 Ga0105248_103447152 296
211 3300009553 Ga0105249_10000440 Ga0105249_1000044024 296
212 3300009553 Ga0105249_10006991 Ga0105249_100069917 296
213 3300009553 Ga0105249_10131621 Ga0105249_101316213 296
214 3300011119 Ga0105246_10020305 Ga0105246_100203052 296
215 3300013296 Ga0157374_10244642 Ga0157374_102446422 296
216 3300013306 Ga0163162_10016333 Ga0163162_100163335 296
217 3300013306 Ga0163162_10088944 Ga0163162_100889443 296
218 3300013308 Ga0157375_10180946 Ga0157375_101809463 296
219 3300014969 Ga0157376_10448933 Ga0157376_104489332 296
220 3300017792 Ga0163161_10028517 Ga0163161_100285171 296
221 3300025907 Ga0207645_10000219 Ga0207645_1000021936 296
222 3300025907 Ga0207645_10324500 Ga0207645_103245001 296
223 3300025908 Ga0207643_10037867 Ga0207643_100378673 296
224 3300025908 Ga0207643_10106784 Ga0207643_101067842 296
225 3300025911 Ga0207654_10293473 Ga0207654_102934731 296
226 3300025913 Ga0207695_10334446 Ga0207695_103344462 296
227 3300025925 Ga0207650_10094666 Ga0207650_100946662 296
228 3300025925 Ga0207650_10499066 Ga0207650_104990661 296
229 3300025926 Ga0207659_10099925 Ga0207659_100999251 296
230 3300025931 Ga0207644_10370025 Ga0207644_103700252 296
231 3300025933 Ga0207706_10113264 Ga0207706_101132643 296
232 3300025933 Ga0207706_10147638 Ga0207706_101476382 296
233 3300025934 Ga0207686_10013705 Ga0207686_100137057 296
234 3300025934 Ga0207686_10164757 Ga0207686_101647571 296
235 3300025938 Ga0207704_10138312 Ga0207704_101383122 296
236 3300025940 Ga0207691_10026863 Ga0207691_100268632 296
237 3300025940 Ga0207691_10041145 Ga0207691_100411453 296
238 3300025942 Ga0207689_10012591 Ga0207689_100125917 296
239 3300025942 Ga0207689_10052143 Ga0207689_100521432 296
240 3300025960 Ga0207651_10068302 Ga0207651_100683022 296
241 3300025961 Ga0207712_10008783 Ga0207712_100087833 296
242 3300025972 Ga0207668_10021341 Ga0207668_100213412 296
243 3300025972 Ga0207668_10022772 Ga0207668_100227722 296
244 3300025981 Ga0207640_10242138 Ga0207640_102421381 296
245 3300025986 Ga0207658_10153877 Ga0207658_101538772 296
246 3300026023 Ga0207677_10314205 Ga0207677_103142051 296
247 3300026035 Ga0207703_10018755 Ga0207703_100187556 296
248 3300026035 Ga0207703_10126349 Ga0207703_101263491 296
249 3300026088 Ga0207641_10000331 Ga0207641_1000033149 296
250 3300026088 Ga0207641_10010813 Ga0207641_100108139 296
251 3300026088 Ga0207641_10170550 Ga0207641_101705503 296
252 3300026089 Ga0207648_10001733 Ga0207648_100017337 296
253 3300026095 Ga0207676_10088814 Ga0207676_100888143 296
254 3300026118 Ga0207675_100053459 Ga0207675_1000534593 296
255 3300026142 Ga0207698_10122754 Ga0207698_101227543 296
256 3300028381 Ga0268264_10010697 Ga0268264_100106971 296
257 3300030521 Ga0307511_10000135 Ga0307511_1000013528 296
258 3300041486 Ga0451807_2749233 Ga0451807_2749233_289_1206 296
259 3300042876 Ga0451577_0041024 Ga0451577_0041024_514_1404 296
260 3300044712 Ga0453684_0003205 Ga0453684_0003205_33_923 296
261 3300044735 Ga0466968_0012293 Ga0466968_0012293_1190_2086 296
262 3300046539 Ga0495621_0010839 Ga0495621_0010839_1724_2677 296
263 3300048913 Ga0496110_0057931 Ga0496110_0057931_1515_2408 296
264 iso_pu_bacteria 2738541278 2738729084 296
265 3300005334 Ga0068869_100017075 Ga0068869_1000170751 297
266 3300005338 Ga0068868_100010727 Ga0068868_10001072710 297
267 3300005344 Ga0070661_100003203 Ga0070661_1000032034 297
268 3300005344 Ga0070661_100010992 Ga0070661_1000109927 297
269 3300005347 Ga0070668_100074872 Ga0070668_1000748723 297
270 3300005354 Ga0070675_100055432 Ga0070675_1000554324 297
271 3300005355 Ga0070671_100379107 Ga0070671_1003791071 297
272 3300005364 Ga0070673_100034212 Ga0070673_1000342126 297
273 3300005364 Ga0070673_100342572 Ga0070673_1003425722 297
274 3300005366 Ga0070659_100031300 Ga0070659_1000313001 297
275 3300005366 Ga0070659_100428252 Ga0070659_1004282521 297
276 3300005457 Ga0070662_100043003 Ga0070662_1000430034 297
277 3300005457 Ga0070662_100063186 Ga0070662_1000631863 297
278 3300005459 Ga0068867_100029608 Ga0068867_1000296081 297
279 3300005466 Ga0070685_10073499 Ga0070685_100734993 297
280 3300005535 Ga0070684_100000880 Ga0070684_10000088019 297
281 3300005539 Ga0068853_100002867 Ga0068853_10000286717 297
282 3300005539 Ga0068853_100052447 Ga0068853_1000524472 297
283 3300005543 Ga0070672_100120636 Ga0070672_1001206362 297
284 3300005547 Ga0070693_100243883 Ga0070693_1002438832 297
285 3300005548 Ga0070665_100401235 Ga0070665_1004012352 297
286 3300005563 Ga0068855_100065598 Ga0068855_1000655984 297
287 3300005564 Ga0070664_100015208 Ga0070664_10001520810 297
288 3300005564 Ga0070664_100075165 Ga0070664_1000751653 297
289 3300005577 Ga0068857_100004008 Ga0068857_1000040083 297
290 3300005578 Ga0068854_100099293 Ga0068854_1000992932 297
291 3300005616 Ga0068852_100129377 Ga0068852_1001293771 297
292 3300005616 Ga0068852_100473619 Ga0068852_1004736192 297
293 3300006237 Ga0097621_100326352 Ga0097621_1003263522 297
294 3300009011 Ga0105251_10134793 Ga0105251_101347931 297
295 3300009174 Ga0105241_10084798 Ga0105241_100847983 297
296 3300009174 Ga0105241_10148878 Ga0105241_101488782 297
297 3300009176 Ga0105242_10601461 Ga0105242_106014611 297
298 3300009553 Ga0105249_10064186 Ga0105249_100641862 297
299 3300011119 Ga0105246_10312339 Ga0105246_103123392 297
300 3300013100 Ga0157373_10041465 Ga0157373_100414653 297
301 3300013100 Ga0157373_10123402 Ga0157373_101234023 297
302 3300013102 Ga0157371_10003304 Ga0157371_100033047 297
303 3300013102 Ga0157371_10113565 Ga0157371_101135652 297
304 3300013105 Ga0157369_10055078 Ga0157369_100550783 297
305 3300013296 Ga0157374_10000768 Ga0157374_1000076821 297
306 3300013296 Ga0157374_10028526 Ga0157374_100285262 297
307 3300013297 Ga0157378_10131156 Ga0157378_101311562 297
308 3300013306 Ga0163162_10047969 Ga0163162_100479697 297
309 3300013306 Ga0163162_10206342 Ga0163162_102063423 297
310 3300013307 Ga0157372_10180998 Ga0157372_101809981 297
311 3300013307 Ga0157372_10369937 Ga0157372_103699373 297
312 3300013308 Ga0157375_10014775 Ga0157375_100147753 297
313 3300013308 Ga0157375_10067045 Ga0157375_100670455 297
314 3300013308 Ga0157375_10538232 Ga0157375_105382322 297
315 3300014325 Ga0163163_10154981 Ga0163163_101549813 297
316 3300014326 Ga0157380_10122351 Ga0157380_101223511 297
317 3300014745 Ga0157377_10008926 Ga0157377_100089266 297
318 3300014745 Ga0157377_10046295 Ga0157377_100462952 297
319 3300014968 Ga0157379_10076189 Ga0157379_100761893 297
320 3300014969 Ga0157376_10355426 Ga0157376_103554261 297
321 3300017792 Ga0163161_10029879 Ga0163161_100298793 297
322 3300025904 Ga0207647_10072898 Ga0207647_100728983 297
323 3300025905 Ga0207685_10053370 Ga0207685_100533702 297
324 3300025907 Ga0207645_10030770 Ga0207645_100307704 297
325 3300025913 Ga0207695_10019538 Ga0207695_100195386 297
326 3300025920 Ga0207649_10013357 Ga0207649_100133573 297
327 3300025920 Ga0207649_10030617 Ga0207649_100306173 297
328 3300025932 Ga0207690_10013435 Ga0207690_100134359 297
329 3300025933 Ga0207706_10004613 Ga0207706_100046133 297
330 3300025933 Ga0207706_10041293 Ga0207706_100412935 297
331 3300025936 Ga0207670_10064765 Ga0207670_100647652 297
332 3300025938 Ga0207704_10170279 Ga0207704_101702791 297
333 3300025942 Ga0207689_10005499 Ga0207689_1000549916 297
334 3300025942 Ga0207689_10179983 Ga0207689_101799831 297
335 3300025942 Ga0207689_10394765 Ga0207689_103947652 297
336 3300025944 Ga0207661_10006521 Ga0207661_100065216 297
337 3300025945 Ga0207679_10012269 Ga0207679_100122696 297
338 3300025960 Ga0207651_10115259 Ga0207651_101152592 297
339 3300025960 Ga0207651_10364346 Ga0207651_103643461 297
340 3300025972 Ga0207668_10188387 Ga0207668_101883871 297
341 3300026023 Ga0207677_10044312 Ga0207677_100443122 297
342 3300026023 Ga0207677_10060201 Ga0207677_100602012 297
343 3300026041 Ga0207639_10023865 Ga0207639_100238658 297
344 3300026067 Ga0207678_10047462 Ga0207678_100474622 297
345 3300026088 Ga0207641_10348620 Ga0207641_103486201 297
346 3300026089 Ga0207648_10043484 Ga0207648_100434845 297
347 3300026089 Ga0207648_10108630 Ga0207648_101086302 297
348 3300026089 Ga0207648_10219668 Ga0207648_102196683 297
349 3300026095 Ga0207676_10147136 Ga0207676_101471361 297
350 3300026116 Ga0207674_10007811 Ga0207674_100078112 297
351 3300026118 Ga0207675_100158386 Ga0207675_1001583863 297
352 3300026142 Ga0207698_10523727 Ga0207698_105237271 297
353 3300031456 Ga0307513_10106135 Ga0307513_101061351 297
354 3300031727 Ga0316576_10319869 Ga0316576_103198692 297
355 3300037418 Ga0395900_0146685 Ga0395900_0146685_594_1490 297
356 3300045051 Ga0451576_0150218 Ga0451576_0150218_825_1718 297
357 3300046460 Ga0495638_0000025 Ga0495638_0000025_302564_303460 297
358 3300046511 Ga0495608_0114636 Ga0495608_0114636_478_1374 297
359 3300046559 Ga0495667_0202927 Ga0495667_0202927_344_1240 297
360 3300046683 Ga0495658_0161823 Ga0495658_0161823_66_962 297
361 3300053153 Ga0500616_0000024 Ga0500616_0000024_309574_310470 297
362 3300003320 rootH2_10015293 rootH2_1001529310 298
363 3300005617 Ga0068859_100094435 Ga0068859_1000944352 298
364 3300005843 Ga0068860_100047253 Ga0068860_1000472532 298
365 3300005844 Ga0068862_100472012 Ga0068862_1004720121 298
366 3300006195 Ga0075366_10069475 Ga0075366_100694753 298
367 3300006931 Ga0097620_100094437 Ga0097620_1000944373 298
368 3300009176 Ga0105242_10003279 Ga0105242_100032793 298
369 3300010375 Ga0105239_10011622 Ga0105239_100116227 298
370 3300011119 Ga0105246_10195807 Ga0105246_101958071 298
371 3300025935 Ga0207709_10374796 Ga0207709_103747961 298
372 3300025972 Ga0207668_10173644 Ga0207668_101736441 298
373 3300050507 nmdc:mga05p37_14505_c1 nmdc:mga05p37_14505_c1_1115_2014 299
374 3300053086 Ga0500578_0077960 Ga0500578_0077960_93_995 299
375 3300003316 rootH1_10017715 rootH1_1001771511 300
376 3300003323 rootH1_10015462 rootH1_100154628 300
377 3300003323 rootH1_10177446 rootH1_101774461 300
378 3300044658 Ga0466972_0000028 Ga0466972_0000028_165315_166220 300
379 3300044658 Ga0466972_0006551 Ga0466972_0006551_852_1757 300
380 3300044842 Ga0466957_0001154 Ga0466957_0001154_8140_9045 300
381 3300049581 Ga0501047_0158311 Ga0501047_0158311_1072_1977 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13354

Beta-lactamase2

Beta-lactamase enzyme family

86

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jbf-assembly3.cif.gz_C structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g. 0.9124 26 293
2j8y-assembly2.cif.gz_B structure of pbp-a acyl-enzyme complex with penicillin-g 0.9124 26 293
7tbx-assembly2.cif.gz_B crystal structure of d179y kpc-2 beta-lactamase 0.9013 27 294
7tbx-assembly1.cif.gz_A crystal structure of d179y kpc-2 beta-lactamase 0.8987 27 294
8eo7-assembly2.cif.gz_B crystal structure of metagenomic beta-lactamase lra-5 y69q/v166e mutant at 2.15 angstrom resolution 0.8958 25 297
ID Description Score Start End Superfamily
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9146 26 293 3.40.710.10
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8818 26 293 3.40.710.10
5hw3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8742 22 298 3.40.710.10
1mfoA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.874 29 291 3.40.710.10
1g6aA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8732 27 297 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A1G9LU15-F1-model_v4 Beta-lactamase class A 0.9967 27 294 GO:0008800
GO:0030655
GO:0046677
AF-A0A059X8Z5-F1-model_v4 ClassA_beta_lactamase 0.9954 126 294 GO:0008800
GO:0030655
GO:0046677
AF-A0A4Q5RDR7-F1-model_v4 DUF3471 domain-containing protein 0.9932 22 295 GO:0008800
GO:0030655
GO:0046677
AF-A0A514CMB5-F1-model_v4 Serine hydrolase 0.9894 26 300 GO:0008800
GO:0030655
GO:0046677
AF-A0A521MSD1-F1-model_v4 Serine hydrolase 0.988 23 296 GO:0008800
GO:0030655
GO:0046677

Feature Viewer

pLDDT pTM Quality
93.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map