F428922
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 381 | 179 | 379 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100002821|Ga0068863_10000282113 |
| Length | 338 |
| Sequence | MCGNFHFLRGWQVENGYKRLLKFCLILVSNHIMIKCLFSFPRCIYLTATLFLIPFILSSCAEQKNAMRSLKENIHQELSKQEGIFAVAFKDLSTGKELLINDTVTFHAASTMKTPVLVEVYKQAEEGKFSLSDSLIIKNEFKSIVDGSLFSLDSTDDSETELYKHIGEKRTISFLLYQMIIVSSNFATNLIIELVDAKNVSATMQQLGAKDIHVLRGVEDGKAFARGLNNTITAHGLMTLFEKMAKGKTVNPAASKAMIDILLDQKFNDIIPAELPAAVKVAHKTGFITGVHHDTGIIFLPNGKKYVLVLLSKNLKDEKAAIKAMAKVSKLIYEFVSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 150 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 151 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 154 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 176 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 179 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0 |
| Isolates | 0.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.1 |
| Nodule | 0 |
| Rhizoplane | 0.52 |
| Rhizosphere | 93.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10017715 | 3300003316 | Bacteria | 12699 |
| 2 | rootH2_10015293 | 3300003320 | Bacteria | 9155 |
| 3 | rootH2_10028817 | 3300003320 | Bacteria | 5897 |
| 4 | rootH2_10051659 | 3300003320 | Bacteria | 3040 |
| 5 | rootL2_10231775 | 3300003322 | Bacteria | 7631 |
| 6 | rootL2_10268056 | 3300003322 | Bacteria | 2863 |
| 7 | rootL2_10283606 | 3300003322 | Unclassified | 2289 |
| 8 | rootH1_10015462 | 3300003323 | Bacteria | 13434 |
| 9 | rootH1_10177446 | 3300003323 | Bacteria | 2596 |
| 10 | Ga0055531_10001953 | 3300003794 | Bacteria | 14413 |
| 11 | Ga0065712_10075156 | 3300005290 | Bacteria | 3918 |
| 12 | Ga0065715_10114608 | 3300005293 | Bacteria | 2444 |
| 13 | Ga0070658_10117879 | 3300005327 | Bacteria | 2204 |
| 14 | Ga0070676_10011296 | 3300005328 | Bacteria | 4854 |
| 15 | Ga0070683_100152268 | 3300005329 | Bacteria | 2193 |
| 16 | Ga0070690_100046730 | 3300005330 | Bacteria | 2753 |
| 17 | Ga0070670_100042006 | 3300005331 | Bacteria | 3930 |
| 18 | Ga0070670_100071438 | 3300005331 | Bacteria | 2980 |
| 19 | Ga0070670_100179248 | 3300005331 | Bacteria | 1839 |
| 20 | Ga0068869_100017075 | 3300005334 | Bacteria | 4910 |
| 21 | Ga0070666_10031380 | 3300005335 | Bacteria | 3507 |
| 22 | Ga0070666_10105344 | 3300005335 | Bacteria | 1948 |
| 23 | Ga0068868_100010727 | 3300005338 | Bacteria | 6641 |
| 24 | Ga0068868_100017955 | 3300005338 | Bacteria | 5279 |
| 25 | Ga0068868_100080275 | 3300005338 | Unclassified | 2614 |
| 26 | Ga0068868_100318571 | 3300005338 | Bacteria | 1324 |
| 27 | Ga0070660_100221719 | 3300005339 | Bacteria | 1537 |
| 28 | Ga0070689_100029484 | 3300005340 | Bacteria | 4154 |
| 29 | Ga0070689_100128734 | 3300005340 | Bacteria | 2028 |
| 30 | Ga0070689_100229312 | 3300005340 | Bacteria | 1526 |
| 31 | Ga0070687_100028516 | 3300005343 | Bacteria | 2709 |
| 32 | Ga0070661_100003203 | 3300005344 | Bacteria | 11276 |
| 33 | Ga0070661_100010992 | 3300005344 | Bacteria | 6308 |
| 34 | Ga0070668_100074872 | 3300005347 | Unclassified | 2642 |
| 35 | Ga0070669_100152805 | 3300005353 | Bacteria | 1788 |
| 36 | Ga0070669_100231678 | 3300005353 | Bacteria | 1464 |
| 37 | Ga0070675_100055432 | 3300005354 | Bacteria | 3263 |
| 38 | Ga0070671_100078478 | 3300005355 | Bacteria | 2760 |
| 39 | Ga0070671_100379107 | 3300005355 | Bacteria | 1209 |
| 40 | Ga0070674_100246049 | 3300005356 | Bacteria | 1402 |
| 41 | Ga0070673_100032993 | 3300005364 | Bacteria | 3904 |
| 42 | Ga0070673_100034212 | 3300005364 | Bacteria | 3843 |
| 43 | Ga0070673_100046959 | 3300005364 | Bacteria | 3357 |
| 44 | Ga0070673_100249183 | 3300005364 | Bacteria | 1547 |
| 45 | Ga0070673_100342572 | 3300005364 | Bacteria | 1325 |
| 46 | Ga0070688_100008942 | 3300005365 | Bacteria | 5455 |
| 47 | Ga0070688_100066713 | 3300005365 | Bacteria | 2290 |
| 48 | Ga0070659_100025301 | 3300005366 | Bacteria | 4557 |
| 49 | Ga0070659_100031300 | 3300005366 | Bacteria | 4120 |
| 50 | Ga0070659_100428252 | 3300005366 | Bacteria | 1120 |
| 51 | Ga0070667_100114218 | 3300005367 | Bacteria | 2344 |
| 52 | Ga0070705_100273048 | 3300005440 | Bacteria | 1198 |
| 53 | Ga0070678_100002435 | 3300005456 | Bacteria | 10194 |
| 54 | Ga0070662_100021920 | 3300005457 | Bacteria | 4366 |
| 55 | Ga0070662_100043003 | 3300005457 | Bacteria | 3229 |
| 56 | Ga0070662_100063186 | 3300005457 | Unclassified | 2708 |
| 57 | Ga0070681_10203203 | 3300005458 | Bacteria | 1899 |
| 58 | Ga0068867_100029608 | 3300005459 | Bacteria | 3945 |
| 59 | Ga0070685_10013499 | 3300005466 | Bacteria | 4309 |
| 60 | Ga0070685_10073499 | 3300005466 | Bacteria | 2032 |
| 61 | Ga0070685_10114477 | 3300005466 | Bacteria | 1667 |
| 62 | Ga0070698_100013020 | 3300005471 | Bacteria | 8805 |
| 63 | Ga0070698_100034146 | 3300005471 | Bacteria | 5269 |
| 64 | Ga0070679_100000454 | 3300005530 | Bacteria | 34670 |
| 65 | Ga0070679_100114312 | 3300005530 | Bacteria | 2684 |
| 66 | Ga0070684_100000880 | 3300005535 | Bacteria | 21214 |
| 67 | Ga0068853_100002867 | 3300005539 | Bacteria | 13082 |
| 68 | Ga0068853_100052447 | 3300005539 | Bacteria | 3514 |
| 69 | Ga0068853_100100230 | 3300005539 | Bacteria | 2560 |
| 70 | Ga0068853_100105912 | 3300005539 | Bacteria | 2491 |
| 71 | Ga0068853_100589496 | 3300005539 | Bacteria | 1055 |
| 72 | Ga0068853_100651714 | 3300005539 | Unclassified | 1002 |
| 73 | Ga0070672_100031631 | 3300005543 | Bacteria | 3985 |
| 74 | Ga0070672_100120636 | 3300005543 | Bacteria | 2146 |
| 75 | Ga0070693_100243883 | 3300005547 | Bacteria | 1188 |
| 76 | Ga0070665_100000009 | 3300005548 | Bacteria | 562640 |
| 77 | Ga0070665_100401235 | 3300005548 | Unclassified | 1379 |
| 78 | Ga0068855_100004391 | 3300005563 | Bacteria | 17233 |
| 79 | Ga0068855_100065598 | 3300005563 | Bacteria | 4233 |
| 80 | Ga0068855_100147805 | 3300005563 | Bacteria | 2674 |
| 81 | Ga0070664_100015208 | 3300005564 | Bacteria | 6289 |
| 82 | Ga0070664_100028525 | 3300005564 | Bacteria | 4644 |
| 83 | Ga0070664_100075165 | 3300005564 | Bacteria | 2901 |
| 84 | Ga0070664_100079315 | 3300005564 | Bacteria | 2826 |
| 85 | Ga0070664_100134759 | 3300005564 | Bacteria | 2171 |
| 86 | Ga0068857_100004008 | 3300005577 | Bacteria | 12408 |
| 87 | Ga0068857_100008896 | 3300005577 | Bacteria | 8697 |
| 88 | Ga0068854_100099293 | 3300005578 | Unclassified | 2180 |
| 89 | Ga0068854_100159270 | 3300005578 | Bacteria | 1747 |
| 90 | Ga0068856_100053331 | 3300005614 | Bacteria | 3986 |
| 91 | Ga0068856_100133575 | 3300005614 | Bacteria | 2487 |
| 92 | Ga0068852_100002380 | 3300005616 | Bacteria | 12950 |
| 93 | Ga0068852_100096861 | 3300005616 | Bacteria | 2653 |
| 94 | Ga0068852_100129377 | 3300005616 | Bacteria | 2323 |
| 95 | Ga0068852_100473619 | 3300005616 | Unclassified | 1243 |
| 96 | Ga0068859_100046370 | 3300005617 | Bacteria | 4365 |
| 97 | Ga0068859_100051078 | 3300005617 | Bacteria | 4155 |
| 98 | Ga0068859_100094435 | 3300005617 | Unclassified | 3043 |
| 99 | Ga0068861_100044518 | 3300005719 | Bacteria | 3338 |
| 100 | Ga0068870_10051269 | 3300005840 | Bacteria | 2184 |
| 101 | Ga0068870_10192833 | 3300005840 | Bacteria | 1231 |
| 102 | Ga0068863_100002821 | 3300005841 | Bacteria | 17205 |
| 103 | Ga0068863_100030063 | 3300005841 | Bacteria | 5189 |
| 104 | Ga0068858_100070948 | 3300005842 | Bacteria | 3229 |
| 105 | Ga0068858_100148526 | 3300005842 | Bacteria | 2202 |
| 106 | Ga0068860_100000103 | 3300005843 | Bacteria | 139076 |
| 107 | Ga0068860_100015123 | 3300005843 | Bacteria | 7542 |
| 108 | Ga0068860_100047253 | 3300005843 | Unclassified | 4103 |
| 109 | Ga0068862_100197746 | 3300005844 | Bacteria | 1811 |
| 110 | Ga0068862_100472012 | 3300005844 | Bacteria | 1186 |
| 111 | Ga0075366_10069475 | 3300006195 | Bacteria | 2096 |
| 112 | Ga0097621_100021648 | 3300006237 | Bacteria | 4978 |
| 113 | Ga0097621_100326352 | 3300006237 | Bacteria | 1360 |
| 114 | Ga0097621_100359990 | 3300006237 | Bacteria | 1296 |
| 115 | Ga0068871_100105158 | 3300006358 | Unclassified | 2368 |
| 116 | Ga0075428_100103811 | 3300006844 | Unclassified | 3099 |
| 117 | Ga0068865_100005051 | 3300006881 | Bacteria | 7986 |
| 118 | Ga0097620_100046370 | 3300006931 | Bacteria | 4365 |
| 119 | Ga0097620_100051079 | 3300006931 | Bacteria | 4155 |
| 120 | Ga0097620_100094437 | 3300006931 | Unclassified | 3043 |
| 121 | Ga0097620_100378536 | 3300006931 | Unclassified | 1511 |
| 122 | Ga0105251_10134793 | 3300009011 | Bacteria | 1118 |
| 123 | Ga0105240_10001038 | 3300009093 | Bacteria | 49382 |
| 124 | Ga0105240_10021390 | 3300009093 | Bacteria | 8604 |
| 125 | Ga0105240_10145535 | 3300009093 | Bacteria | 2828 |
| 126 | Ga0111539_10040835 | 3300009094 | Bacteria | 5583 |
| 127 | Ga0111539_10147262 | 3300009094 | Bacteria | 2757 |
| 128 | Ga0114129_10034924 | 3300009147 | Bacteria | 7103 |
| 129 | Ga0105243_10194406 | 3300009148 | Bacteria | 1774 |
| 130 | Ga0105241_10018452 | 3300009174 | Bacteria | 5132 |
| 131 | Ga0105241_10078148 | 3300009174 | Bacteria | 2585 |
| 132 | Ga0105241_10084798 | 3300009174 | Bacteria | 2488 |
| 133 | Ga0105241_10148878 | 3300009174 | Bacteria | 1913 |
| 134 | Ga0105242_10003279 | 3300009176 | Bacteria | 12616 |
| 135 | Ga0105242_10010443 | 3300009176 | Bacteria | 7125 |
| 136 | Ga0105242_10034895 | 3300009176 | Bacteria | 4032 |
| 137 | Ga0105242_10051105 | 3300009176 | Bacteria | 3367 |
| 138 | Ga0105242_10156077 | 3300009176 | Bacteria | 1994 |
| 139 | Ga0105242_10601461 | 3300009176 | Unclassified | 1062 |
| 140 | Ga0105248_10199294 | 3300009177 | Bacteria | 2255 |
| 141 | Ga0105248_10344715 | 3300009177 | Bacteria | 1677 |
| 142 | Ga0105248_10378192 | 3300009177 | Bacteria | 1594 |
| 143 | Ga0105237_10002841 | 3300009545 | Bacteria | 21059 |
| 144 | Ga0105237_10033226 | 3300009545 | Bacteria | 5226 |
| 145 | Ga0105237_10042796 | 3300009545 | Unclassified | 4565 |
| 146 | Ga0105237_10158857 | 3300009545 | Unclassified | 2258 |
| 147 | Ga0105238_10018417 | 3300009551 | Bacteria | 7108 |
| 148 | Ga0105249_10000440 | 3300009553 | Bacteria | 39169 |
| 149 | Ga0105249_10006991 | 3300009553 | Bacteria | 9845 |
| 150 | Ga0105249_10064186 | 3300009553 | Bacteria | 3375 |
| 151 | Ga0105249_10131621 | 3300009553 | Bacteria | 2389 |
| 152 | Ga0105249_10269808 | 3300009553 | Bacteria | 1695 |
| 153 | Ga0105239_10003441 | 3300010375 | Bacteria | 19384 |
| 154 | Ga0105239_10011622 | 3300010375 | Bacteria | 9824 |
| 155 | Ga0105239_10011881 | 3300010375 | Bacteria | 9716 |
| 156 | Ga0105246_10020305 | 3300011119 | Bacteria | 4259 |
| 157 | Ga0105246_10195807 | 3300011119 | Bacteria | 1567 |
| 158 | Ga0105246_10312339 | 3300011119 | Bacteria | 1274 |
| 159 | Ga0157373_10041465 | 3300013100 | Bacteria | 3293 |
| 160 | Ga0157373_10064535 | 3300013100 | Bacteria | 2592 |
| 161 | Ga0157373_10123402 | 3300013100 | Bacteria | 1821 |
| 162 | Ga0157373_10167769 | 3300013100 | Bacteria | 1545 |
| 163 | Ga0157371_10001203 | 3300013102 | Bacteria | 27690 |
| 164 | Ga0157371_10002353 | 3300013102 | Bacteria | 18087 |
| 165 | Ga0157371_10003304 | 3300013102 | Bacteria | 14752 |
| 166 | Ga0157371_10006217 | 3300013102 | Bacteria | 9899 |
| 167 | Ga0157371_10025928 | 3300013102 | Bacteria | 4265 |
| 168 | Ga0157371_10113565 | 3300013102 | Unclassified | 1924 |
| 169 | Ga0157370_10001268 | 3300013104 | Bacteria | 31549 |
| 170 | Ga0157370_10028440 | 3300013104 | Bacteria | 5498 |
| 171 | Ga0157370_10060169 | 3300013104 | Bacteria | 3607 |
| 172 | Ga0157370_10303406 | 3300013104 | Bacteria | 1474 |
| 173 | Ga0157369_10055078 | 3300013105 | Bacteria | 4293 |
| 174 | Ga0157374_10000768 | 3300013296 | Bacteria | 28045 |
| 175 | Ga0157374_10028526 | 3300013296 | Bacteria | 5043 |
| 176 | Ga0157374_10244642 | 3300013296 | Bacteria | 1764 |
| 177 | Ga0157378_10019725 | 3300013297 | Bacteria | 5928 |
| 178 | Ga0157378_10131156 | 3300013297 | Unclassified | 2320 |
| 179 | Ga0157378_10415499 | 3300013297 | Bacteria | 1328 |
| 180 | Ga0163162_10003116 | 3300013306 | Bacteria | 15834 |
| 181 | Ga0163162_10016333 | 3300013306 | Bacteria | 7257 |
| 182 | Ga0163162_10047969 | 3300013306 | Bacteria | 4279 |
| 183 | Ga0163162_10049721 | 3300013306 | Unclassified | 4202 |
| 184 | Ga0163162_10088944 | 3300013306 | Bacteria | 3168 |
| 185 | Ga0163162_10206342 | 3300013306 | Unclassified | 2094 |
| 186 | Ga0163162_10244605 | 3300013306 | Bacteria | 1925 |
| 187 | Ga0157372_10002622 | 3300013307 | Bacteria | 19467 |
| 188 | Ga0157372_10012697 | 3300013307 | Bacteria | 8971 |
| 189 | Ga0157372_10180998 | 3300013307 | Bacteria | 2440 |
| 190 | Ga0157372_10369937 | 3300013307 | Unclassified | 1670 |
| 191 | Ga0157372_10618109 | 3300013307 | Bacteria | 1263 |
| 192 | Ga0157375_10014775 | 3300013308 | Bacteria | 6977 |
| 193 | Ga0157375_10048684 | 3300013308 | Bacteria | 4148 |
| 194 | Ga0157375_10067045 | 3300013308 | Bacteria | 3585 |
| 195 | Ga0157375_10180946 | 3300013308 | Bacteria | 2259 |
| 196 | Ga0157375_10538232 | 3300013308 | Bacteria | 1330 |
| 197 | Ga0163163_10004390 | 3300014325 | Bacteria | 12017 |
| 198 | Ga0163163_10154981 | 3300014325 | Unclassified | 2335 |
| 199 | Ga0157380_10122351 | 3300014326 | Bacteria | 2206 |
| 200 | Ga0157377_10008926 | 3300014745 | Bacteria | 4904 |
| 201 | Ga0157377_10010118 | 3300014745 | Bacteria | 4654 |
| 202 | Ga0157377_10016643 | 3300014745 | Bacteria | 3786 |
| 203 | Ga0157377_10046295 | 3300014745 | Bacteria | 2432 |
| 204 | Ga0157379_10076189 | 3300014968 | Bacteria | 3004 |
| 205 | Ga0157379_10081969 | 3300014968 | Bacteria | 2890 |
| 206 | Ga0157376_10072563 | 3300014969 | Unclassified | 2928 |
| 207 | Ga0157376_10355426 | 3300014969 | Bacteria | 1403 |
| 208 | Ga0157376_10448933 | 3300014969 | Bacteria | 1257 |
| 209 | Ga0163161_10028517 | 3300017792 | Bacteria | 3965 |
| 210 | Ga0163161_10029879 | 3300017792 | Bacteria | 3874 |
| 211 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 212 | Ga0207697_10145289 | 3300025315 | Bacteria | 1030 |
| 213 | Ga0207647_10041571 | 3300025904 | Bacteria | 2890 |
| 214 | Ga0207647_10072898 | 3300025904 | Bacteria | 2070 |
| 215 | Ga0207647_10195540 | 3300025904 | Bacteria | 1171 |
| 216 | Ga0207685_10053370 | 3300025905 | Bacteria | 1570 |
| 217 | Ga0207645_10000219 | 3300025907 | Bacteria | 47364 |
| 218 | Ga0207645_10030770 | 3300025907 | Bacteria | 3459 |
| 219 | Ga0207645_10049503 | 3300025907 | Bacteria | 2683 |
| 220 | Ga0207645_10324500 | 3300025907 | Bacteria | 1027 |
| 221 | Ga0207643_10037867 | 3300025908 | Bacteria | 2707 |
| 222 | Ga0207643_10106784 | 3300025908 | Bacteria | 1646 |
| 223 | Ga0207705_10212099 | 3300025909 | Bacteria | 1469 |
| 224 | Ga0207654_10041162 | 3300025911 | Bacteria | 2607 |
| 225 | Ga0207654_10058639 | 3300025911 | Unclassified | 2242 |
| 226 | Ga0207654_10293473 | 3300025911 | Bacteria | 1103 |
| 227 | Ga0207707_10297503 | 3300025912 | Bacteria | 1396 |
| 228 | Ga0207695_10007537 | 3300025913 | Bacteria | 13795 |
| 229 | Ga0207695_10019538 | 3300025913 | Bacteria | 7795 |
| 230 | Ga0207695_10024993 | 3300025913 | Bacteria | 6702 |
| 231 | Ga0207695_10334446 | 3300025913 | Bacteria | 1403 |
| 232 | Ga0207671_10005789 | 3300025914 | Bacteria | 11251 |
| 233 | Ga0207671_10016030 | 3300025914 | Bacteria | 5840 |
| 234 | Ga0207671_10096828 | 3300025914 | Unclassified | 2230 |
| 235 | Ga0207671_10188579 | 3300025914 | Unclassified | 1607 |
| 236 | Ga0207657_10220214 | 3300025919 | Bacteria | 1521 |
| 237 | Ga0207649_10013357 | 3300025920 | Bacteria | 4583 |
| 238 | Ga0207649_10030617 | 3300025920 | Bacteria | 3189 |
| 239 | Ga0207652_10000064 | 3300025921 | Bacteria | 111997 |
| 240 | Ga0207652_10053816 | 3300025921 | Bacteria | 3458 |
| 241 | Ga0207694_10075211 | 3300025924 | Bacteria | 2644 |
| 242 | Ga0207650_10094666 | 3300025925 | Bacteria | 2288 |
| 243 | Ga0207650_10499066 | 3300025925 | Bacteria | 1017 |
| 244 | Ga0207659_10099925 | 3300025926 | Bacteria | 2185 |
| 245 | Ga0207644_10370025 | 3300025931 | Bacteria | 1167 |
| 246 | Ga0207644_10495559 | 3300025931 | Bacteria | 1007 |
| 247 | Ga0207690_10013435 | 3300025932 | Bacteria | 4920 |
| 248 | Ga0207706_10004613 | 3300025933 | Bacteria | 12927 |
| 249 | Ga0207706_10041293 | 3300025933 | Bacteria | 4090 |
| 250 | Ga0207706_10113264 | 3300025933 | Bacteria | 2386 |
| 251 | Ga0207706_10147638 | 3300025933 | Bacteria | 2068 |
| 252 | Ga0207686_10001725 | 3300025934 | Bacteria | 12168 |
| 253 | Ga0207686_10013705 | 3300025934 | Bacteria | 4493 |
| 254 | Ga0207686_10164757 | 3300025934 | Bacteria | 1557 |
| 255 | Ga0207709_10374796 | 3300025935 | Unclassified | 1081 |
| 256 | Ga0207670_10064765 | 3300025936 | Bacteria | 2506 |
| 257 | Ga0207704_10138312 | 3300025938 | Bacteria | 1699 |
| 258 | Ga0207704_10170279 | 3300025938 | Bacteria | 1561 |
| 259 | Ga0207691_10026863 | 3300025940 | Bacteria | 5401 |
| 260 | Ga0207691_10041145 | 3300025940 | Bacteria | 4268 |
| 261 | Ga0207691_10415423 | 3300025940 | Bacteria | 1147 |
| 262 | Ga0207689_10005499 | 3300025942 | Bacteria | 11332 |
| 263 | Ga0207689_10007418 | 3300025942 | Bacteria | 9617 |
| 264 | Ga0207689_10012591 | 3300025942 | Bacteria | 7225 |
| 265 | Ga0207689_10052143 | 3300025942 | Bacteria | 3371 |
| 266 | Ga0207689_10179983 | 3300025942 | Unclassified | 1743 |
| 267 | Ga0207689_10394765 | 3300025942 | Bacteria | 1153 |
| 268 | Ga0207661_10006521 | 3300025944 | Bacteria | 8251 |
| 269 | Ga0207679_10008333 | 3300025945 | Bacteria | 6602 |
| 270 | Ga0207679_10012269 | 3300025945 | Bacteria | 5582 |
| 271 | Ga0207667_10002492 | 3300025949 | Bacteria | 22948 |
| 272 | Ga0207667_10128355 | 3300025949 | Bacteria | 2612 |
| 273 | Ga0207651_10068302 | 3300025960 | Bacteria | 2505 |
| 274 | Ga0207651_10115259 | 3300025960 | Unclassified | 2026 |
| 275 | Ga0207651_10364346 | 3300025960 | Bacteria | 1221 |
| 276 | Ga0207712_10006329 | 3300025961 | Bacteria | 7469 |
| 277 | Ga0207712_10008783 | 3300025961 | Bacteria | 6389 |
| 278 | Ga0207668_10021341 | 3300025972 | Unclassified | 4130 |
| 279 | Ga0207668_10022772 | 3300025972 | Bacteria | 4015 |
| 280 | Ga0207668_10173644 | 3300025972 | Bacteria | 1693 |
| 281 | Ga0207668_10188387 | 3300025972 | Unclassified | 1633 |
| 282 | Ga0207640_10110085 | 3300025981 | Bacteria | 1950 |
| 283 | Ga0207640_10242138 | 3300025981 | Bacteria | 1394 |
| 284 | Ga0207658_10109645 | 3300025986 | Unclassified | 2180 |
| 285 | Ga0207658_10153877 | 3300025986 | Bacteria | 1877 |
| 286 | Ga0207677_10044312 | 3300026023 | Bacteria | 2963 |
| 287 | Ga0207677_10060201 | 3300026023 | Unclassified | 2623 |
| 288 | Ga0207677_10115394 | 3300026023 | Unclassified | 2009 |
| 289 | Ga0207677_10314205 | 3300026023 | Bacteria | 1299 |
| 290 | Ga0207703_10018755 | 3300026035 | Bacteria | 5404 |
| 291 | Ga0207703_10126349 | 3300026035 | Bacteria | 2202 |
| 292 | Ga0207639_10023865 | 3300026041 | Bacteria | 4420 |
| 293 | Ga0207678_10047462 | 3300026067 | Bacteria | 3714 |
| 294 | Ga0207708_10014273 | 3300026075 | Bacteria | 5942 |
| 295 | Ga0207702_10199320 | 3300026078 | Bacteria | 1854 |
| 296 | Ga0207641_10000331 | 3300026088 | Bacteria | 57928 |
| 297 | Ga0207641_10010813 | 3300026088 | Bacteria | 7479 |
| 298 | Ga0207641_10170550 | 3300026088 | Bacteria | 1986 |
| 299 | Ga0207641_10348620 | 3300026088 | Bacteria | 1411 |
| 300 | Ga0207648_10001733 | 3300026089 | Bacteria | 23873 |
| 301 | Ga0207648_10043484 | 3300026089 | Bacteria | 3943 |
| 302 | Ga0207648_10108630 | 3300026089 | Unclassified | 2435 |
| 303 | Ga0207648_10219668 | 3300026089 | Bacteria | 1689 |
| 304 | Ga0207676_10088814 | 3300026095 | Bacteria | 2531 |
| 305 | Ga0207676_10115079 | 3300026095 | Unclassified | 2257 |
| 306 | Ga0207676_10116793 | 3300026095 | Bacteria | 2243 |
| 307 | Ga0207676_10147136 | 3300026095 | Unclassified | 2024 |
| 308 | Ga0207674_10001043 | 3300026116 | Bacteria | 36010 |
| 309 | Ga0207674_10007811 | 3300026116 | Bacteria | 12434 |
| 310 | Ga0207675_100053459 | 3300026118 | Bacteria | 3768 |
| 311 | Ga0207675_100158386 | 3300026118 | Bacteria | 2158 |
| 312 | Ga0207675_100266287 | 3300026118 | Bacteria | 1662 |
| 313 | Ga0207698_10023391 | 3300026142 | Bacteria | 4315 |
| 314 | Ga0207698_10122754 | 3300026142 | Bacteria | 2202 |
| 315 | Ga0207698_10523727 | 3300026142 | Unclassified | 1157 |
| 316 | Ga0268266_10000105 | 3300028379 | Bacteria | 176691 |
| 317 | Ga0268266_10333366 | 3300028379 | Bacteria | 1422 |
| 318 | Ga0268264_10000013 | 3300028381 | Bacteria | 513859 |
| 319 | Ga0268264_10010697 | 3300028381 | Bacteria | 7579 |
| 320 | Ga0268264_10020469 | 3300028381 | Bacteria | 5406 |
| 321 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 322 | Ga0307511_10000135 | 3300030521 | Bacteria | 67934 |
| 323 | Ga0307513_10106135 | 3300031456 | Bacteria | 2816 |
| 324 | Ga0316576_10319869 | 3300031727 | Bacteria | 1158 |
| 325 | Ga0307414_10007227 | 3300032004 | Bacteria | 6235 |
| 326 | Ga0307414_10097167 | 3300032004 | Unclassified | 2206 |
| 327 | Ga0316583_10022148 | 3300032133 | Bacteria | 2277 |
| 328 | Ga0395899_0022859 | 3300037312 | Bacteria | 4737 |
| 329 | Ga0395899_0027215 | 3300037312 | Bacteria | 4312 |
| 330 | Ga0395900_0004748 | 3300037418 | Bacteria | 14328 |
| 331 | Ga0395900_0017121 | 3300037418 | Bacteria | 7399 |
| 332 | Ga0395900_0146685 | 3300037418 | Bacteria | 2412 |
| 333 | Ga0395898_0002029 | 3300037466 | Bacteria | 25368 |
| 334 | Ga0395898_0007863 | 3300037466 | Bacteria | 11312 |
| 335 | Ga0395898_0106677 | 3300037466 | Bacteria | 2687 |
| 336 | Ga0395901_0022671 | 3300038443 | Bacteria | 6438 |
| 337 | Ga0395901_0028239 | 3300038443 | Bacteria | 5772 |
| 338 | Ga0451807_2749233 | 3300041486 | Bacteria | 1344 |
| 339 | Ga0439449_0015171 | 3300042007 | Bacteria | 2895 |
| 340 | Ga0439457_000008 | 3300042014 | Bacteria | 42068 |
| 341 | Ga0451577_0004582 | 3300042876 | Bacteria | 14524 |
| 342 | Ga0451577_0041024 | 3300042876 | Bacteria | 4156 |
| 343 | Ga0466969_0000114 | 3300044656 | Bacteria | 42943 |
| 344 | Ga0466972_0000028 | 3300044658 | Bacteria | 171140 |
| 345 | Ga0466972_0006551 | 3300044658 | Bacteria | 5852 |
| 346 | Ga0466972_0026034 | 3300044658 | Bacteria | 2897 |
| 347 | Ga0466961_0127346 | 3300044693 | Bacteria | 1597 |
| 348 | Ga0453684_0000004 | 3300044712 | Bacteria | 1469893 |
| 349 | Ga0453684_0003205 | 3300044712 | Bacteria | 37500 |
| 350 | Ga0466968_0012293 | 3300044735 | Bacteria | 3348 |
| 351 | Ga0466970_0301528 | 3300044765 | Bacteria | 904 |
| 352 | Ga0466957_0001154 | 3300044842 | Bacteria | 13664 |
| 353 | Ga0466957_0003127 | 3300044842 | Bacteria | 9016 |
| 354 | Ga0466957_0354595 | 3300044842 | Bacteria | 996 |
| 355 | Ga0466959_0000031 | 3300045049 | Bacteria | 111271 |
| 356 | Ga0451576_0150218 | 3300045051 | Bacteria | 2430 |
| 357 | Ga0495638_0000025 | 3300046460 | Bacteria | 353356 |
| 358 | Ga0495638_0082256 | 3300046460 | Bacteria | 1953 |
| 359 | Ga0495608_0114636 | 3300046511 | Bacteria | 1731 |
| 360 | Ga0495608_0351698 | 3300046511 | Bacteria | 907 |
| 361 | Ga0495648_0001451 | 3300046524 | Bacteria | 23185 |
| 362 | Ga0495621_0010839 | 3300046539 | Unclassified | 2804 |
| 363 | Ga0495667_0202927 | 3300046559 | Bacteria | 1269 |
| 364 | Ga0495625_0181892 | 3300046660 | Bacteria | 1397 |
| 365 | Ga0495658_0161823 | 3300046683 | Bacteria | 1381 |
| 366 | Ga0495687_000010 | 3300047443 | Bacteria | 413735 |
| 367 | Ga0496110_0057931 | 3300048913 | Bacteria | 3412 |
| 368 | Ga0501047_0158311 | 3300049581 | Bacteria | 2137 |
| 369 | Ga0501236_000236 | 3300049670 | Bacteria | 5907 |
| 370 | nmdc:mga05p37_14505_c1 | 3300050507 | Bacteria | 9462 |
| 371 | nmdc:mga08y16_121308_c1 | 3300050511 | Bacteria | 2720 |
| 372 | nmdc:mga08y16_198402_c1 | 3300050511 | Unclassified | 2080 |
| 373 | nmdc:mga08y16_361289_c1 | 3300050511 | Bacteria | 1491 |
| 374 | Ga0500578_0077960 | 3300053086 | Bacteria | 2109 |
| 375 | Ga0500589_009300 | 3300053147 | Bacteria | 4151 |
| 376 | Ga0500616_0000024 | 3300053153 | Bacteria | 455811 |
| 377 | Ga0500616_0025515 | 3300053153 | Bacteria | 3278 |
| 378 | Ga0500622_0003469 | 3300053156 | Bacteria | 10500 |
| 379 | Ga0466962_0236150 | 3300061719 | Unclassified | 897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_100013020 | Ga0070698_1000130204 | 272 |
| 2 | 3300005471 | Ga0070698_100034146 | Ga0070698_1000341464 | 272 |
| 3 | 3300005539 | Ga0068853_100651714 | Ga0068853_1006517141 | 272 |
| 4 | 3300009176 | Ga0105242_10156077 | Ga0105242_101560772 | 272 |
| 5 | 3300013102 | Ga0157371_10006217 | Ga0157371_100062178 | 272 |
| 6 | 3300013102 | Ga0157371_10025928 | Ga0157371_100259282 | 272 |
| 7 | 3300013104 | Ga0157370_10060169 | Ga0157370_100601693 | 272 |
| 8 | 3300013104 | Ga0157370_10303406 | Ga0157370_103034061 | 272 |
| 9 | 3300014745 | Ga0157377_10016643 | Ga0157377_100166434 | 272 |
| 10 | 3300025942 | Ga0207689_10007418 | Ga0207689_100074186 | 272 |
| 11 | 3300025961 | Ga0207712_10006329 | Ga0207712_100063295 | 272 |
| 12 | 3300026075 | Ga0207708_10014273 | Ga0207708_100142732 | 272 |
| 13 | 3300026095 | Ga0207676_10115079 | Ga0207676_101150792 | 272 |
| 14 | 3300026118 | Ga0207675_100266287 | Ga0207675_1002662872 | 272 |
| 15 | 3300037466 | Ga0395898_0106677 | Ga0395898_0106677_991_1809 | 272 |
| 16 | 3300046511 | Ga0495608_0351698 | Ga0495608_0351698_26_844 | 272 |
| 17 | 3300050511 | nmdc:mga08y16_361289_c1 | nmdc:mga08y16_361289_c1_96_914 | 272 |
| 18 | 3300025315 | Ga0207697_10145289 | Ga0207697_101452892 | 273 |
| 19 | 3300005614 | Ga0068856_100053331 | Ga0068856_1000533313 | 274 |
| 20 | 3300009545 | Ga0105237_10033226 | Ga0105237_100332264 | 274 |
| 21 | 3300010375 | Ga0105239_10011881 | Ga0105239_100118815 | 274 |
| 22 | 3300025914 | Ga0207671_10188579 | Ga0207671_101885792 | 274 |
| 23 | 3300026078 | Ga0207702_10199320 | Ga0207702_101993201 | 274 |
| 24 | 3300009147 | Ga0114129_10034924 | Ga0114129_100349245 | 276 |
| 25 | 3300042007 | Ga0439449_0015171 | Ga0439449_0015171_1807_2637 | 276 |
| 26 | 3300042014 | Ga0439457_000008 | Ga0439457_000008_26659_27489 | 276 |
| 27 | 3300044658 | Ga0466972_0026034 | Ga0466972_0026034_100_930 | 276 |
| 28 | 3300061719 | Ga0466962_0236150 | Ga0466962_0236150_20_850 | 276 |
| 29 | 3300005563 | Ga0068855_100147805 | Ga0068855_1001478052 | 277 |
| 30 | 3300009174 | Ga0105241_10018452 | Ga0105241_100184524 | 277 |
| 31 | 3300032133 | Ga0316583_10022148 | Ga0316583_100221482 | 277 |
| 32 | 3300044656 | Ga0466969_0000114 | Ga0466969_0000114_21097_21930 | 277 |
| 33 | 3300044693 | Ga0466961_0127346 | Ga0466961_0127346_163_996 | 277 |
| 34 | 3300044765 | Ga0466970_0301528 | Ga0466970_0301528_33_875 | 277 |
| 35 | 3300044842 | Ga0466957_0003127 | Ga0466957_0003127_3825_4658 | 277 |
| 36 | 3300045049 | Ga0466959_0000031 | Ga0466959_0000031_95157_95990 | 277 |
| 37 | 3300053147 | Ga0500589_009300 | Ga0500589_009300_1106_1939 | 277 |
| 38 | 3300003322 | rootL2_10283606 | rootL2_102836064 | 278 |
| 39 | 3300042876 | Ga0451577_0004582 | Ga0451577_0004582_6313_7155 | 278 |
| 40 | 3300044712 | Ga0453684_0000004 | Ga0453684_0000004_610790_611632 | 278 |
| 41 | 3300025931 | Ga0207644_10495559 | Ga0207644_104955591 | 281 |
| 42 | 3300003794 | Ga0055531_10001953 | Ga0055531_100019532 | 282 |
| 43 | 3300005330 | Ga0070690_100046730 | Ga0070690_1000467302 | 282 |
| 44 | 3300005364 | Ga0070673_100249183 | Ga0070673_1002491832 | 282 |
| 45 | 3300006237 | Ga0097621_100359990 | Ga0097621_1003599901 | 282 |
| 46 | 3300013297 | Ga0157378_10019725 | Ga0157378_100197254 | 282 |
| 47 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007388 | 282 |
| 48 | 3300025907 | Ga0207645_10049503 | Ga0207645_100495032 | 282 |
| 49 | 3300025940 | Ga0207691_10415423 | Ga0207691_104154231 | 282 |
| 50 | 3300026095 | Ga0207676_10116793 | Ga0207676_101167931 | 282 |
| 51 | 3300013100 | Ga0157373_10064535 | Ga0157373_100645352 | 284 |
| 52 | 3300006358 | Ga0068871_100105158 | Ga0068871_1001051584 | 285 |
| 53 | 3300009176 | Ga0105242_10010443 | Ga0105242_100104434 | 285 |
| 54 | 3300009177 | Ga0105248_10378192 | Ga0105248_103781922 | 285 |
| 55 | 3300009545 | Ga0105237_10002841 | Ga0105237_1000284111 | 285 |
| 56 | 3300013297 | Ga0157378_10415499 | Ga0157378_104154992 | 285 |
| 57 | 3300013306 | Ga0163162_10049721 | Ga0163162_100497214 | 285 |
| 58 | 3300013306 | Ga0163162_10244605 | Ga0163162_102446052 | 285 |
| 59 | 3300014968 | Ga0157379_10081969 | Ga0157379_100819692 | 285 |
| 60 | 3300014969 | Ga0157376_10072563 | Ga0157376_100725633 | 285 |
| 61 | 3300025904 | Ga0207647_10195540 | Ga0207647_101955401 | 285 |
| 62 | 3300025911 | Ga0207654_10041162 | Ga0207654_100411621 | 285 |
| 63 | 3300025914 | Ga0207671_10005789 | Ga0207671_100057893 | 285 |
| 64 | 3300025914 | Ga0207671_10016030 | Ga0207671_100160303 | 285 |
| 65 | 3300025934 | Ga0207686_10001725 | Ga0207686_100017257 | 285 |
| 66 | 3300053153 | Ga0500616_0025515 | Ga0500616_0025515_622_1485 | 287 |
| 67 | 3300005564 | Ga0070664_100028525 | Ga0070664_1000285253 | 288 |
| 68 | 3300009094 | Ga0111539_10040835 | Ga0111539_100408352 | 288 |
| 69 | 3300014325 | Ga0163163_10004390 | Ga0163163_100043904 | 288 |
| 70 | 3300025945 | Ga0207679_10008333 | Ga0207679_100083334 | 288 |
| 71 | 3300050511 | nmdc:mga08y16_121308_c1 | nmdc:mga08y16_121308_c1_1761_2633 | 288 |
| 72 | 3300009553 | Ga0105249_10269808 | Ga0105249_102698082 | 290 |
| 73 | 3300009093 | Ga0105240_10001038 | Ga0105240_1000103819 | 292 |
| 74 | 3300009545 | Ga0105237_10042796 | Ga0105237_100427965 | 292 |
| 75 | 3300009551 | Ga0105238_10018417 | Ga0105238_100184173 | 292 |
| 76 | 3300013307 | Ga0157372_10618109 | Ga0157372_106181092 | 292 |
| 77 | 3300025913 | Ga0207695_10007537 | Ga0207695_1000753712 | 292 |
| 78 | 3300025924 | Ga0207694_10075211 | Ga0207694_100752112 | 292 |
| 79 | 3300009148 | Ga0105243_10194406 | Ga0105243_101944061 | 293 |
| 80 | 3300013308 | Ga0157375_10048684 | Ga0157375_100486846 | 293 |
| 81 | 3300014745 | Ga0157377_10010118 | Ga0157377_100101182 | 293 |
| 82 | 3300028794 | Ga0307515_10000009 | Ga0307515_1000000984 | 293 |
| 83 | 3300032004 | Ga0307414_10097167 | Ga0307414_100971671 | 293 |
| 84 | 3300044842 | Ga0466957_0354595 | Ga0466957_0354595_73_966 | 293 |
| 85 | 3300003320 | rootH2_10028817 | rootH2_100288172 | 294 |
| 86 | 3300003322 | rootL2_10231775 | rootL2_102317755 | 294 |
| 87 | 3300003322 | rootL2_10268056 | rootL2_102680562 | 294 |
| 88 | 3300005327 | Ga0070658_10117879 | Ga0070658_101178791 | 294 |
| 89 | 3300005338 | Ga0068868_100318571 | Ga0068868_1003185711 | 294 |
| 90 | 3300005339 | Ga0070660_100221719 | Ga0070660_1002217191 | 294 |
| 91 | 3300005366 | Ga0070659_100025301 | Ga0070659_1000253013 | 294 |
| 92 | 3300005530 | Ga0070679_100000454 | Ga0070679_10000045424 | 294 |
| 93 | 3300005530 | Ga0070679_100114312 | Ga0070679_1001143122 | 294 |
| 94 | 3300005539 | Ga0068853_100100230 | Ga0068853_1001002303 | 294 |
| 95 | 3300005548 | Ga0070665_100000009 | Ga0070665_10000000964 | 294 |
| 96 | 3300005563 | Ga0068855_100004391 | Ga0068855_10000439114 | 294 |
| 97 | 3300005577 | Ga0068857_100008896 | Ga0068857_1000088962 | 294 |
| 98 | 3300005578 | Ga0068854_100159270 | Ga0068854_1001592702 | 294 |
| 99 | 3300005614 | Ga0068856_100133575 | Ga0068856_1001335753 | 294 |
| 100 | 3300005616 | Ga0068852_100002380 | Ga0068852_1000023805 | 294 |
| 101 | 3300005843 | Ga0068860_100000103 | Ga0068860_10000010347 | 294 |
| 102 | 3300006844 | Ga0075428_100103811 | Ga0075428_1001038113 | 294 |
| 103 | 3300009093 | Ga0105240_10145535 | Ga0105240_101455351 | 294 |
| 104 | 3300009094 | Ga0111539_10147262 | Ga0111539_101472622 | 294 |
| 105 | 3300013100 | Ga0157373_10167769 | Ga0157373_101677692 | 294 |
| 106 | 3300013102 | Ga0157371_10001203 | Ga0157371_1000120317 | 294 |
| 107 | 3300013102 | Ga0157371_10002353 | Ga0157371_100023535 | 294 |
| 108 | 3300013104 | Ga0157370_10001268 | Ga0157370_100012688 | 294 |
| 109 | 3300013104 | Ga0157370_10028440 | Ga0157370_100284403 | 294 |
| 110 | 3300013306 | Ga0163162_10003116 | Ga0163162_100031167 | 294 |
| 111 | 3300013307 | Ga0157372_10002622 | Ga0157372_1000262214 | 294 |
| 112 | 3300013307 | Ga0157372_10012697 | Ga0157372_100126975 | 294 |
| 113 | 3300025904 | Ga0207647_10041571 | Ga0207647_100415712 | 294 |
| 114 | 3300025909 | Ga0207705_10212099 | Ga0207705_102120991 | 294 |
| 115 | 3300025911 | Ga0207654_10058639 | Ga0207654_100586392 | 294 |
| 116 | 3300025912 | Ga0207707_10297503 | Ga0207707_102975031 | 294 |
| 117 | 3300025919 | Ga0207657_10220214 | Ga0207657_102202142 | 294 |
| 118 | 3300025921 | Ga0207652_10000064 | Ga0207652_1000006440 | 294 |
| 119 | 3300025921 | Ga0207652_10053816 | Ga0207652_100538163 | 294 |
| 120 | 3300025949 | Ga0207667_10002492 | Ga0207667_1000249220 | 294 |
| 121 | 3300025949 | Ga0207667_10128355 | Ga0207667_101283551 | 294 |
| 122 | 3300025981 | Ga0207640_10110085 | Ga0207640_101100852 | 294 |
| 123 | 3300026116 | Ga0207674_10001043 | Ga0207674_1000104329 | 294 |
| 124 | 3300026142 | Ga0207698_10023391 | Ga0207698_100233913 | 294 |
| 125 | 3300028379 | Ga0268266_10000105 | Ga0268266_1000010581 | 294 |
| 126 | 3300028381 | Ga0268264_10000013 | Ga0268264_10000013273 | 294 |
| 127 | 3300032004 | Ga0307414_10007227 | Ga0307414_100072275 | 294 |
| 128 | 3300037312 | Ga0395899_0022859 | Ga0395899_0022859_1776_2663 | 294 |
| 129 | 3300037312 | Ga0395899_0027215 | Ga0395899_0027215_3264_4151 | 294 |
| 130 | 3300037418 | Ga0395900_0004748 | Ga0395900_0004748_3532_4419 | 294 |
| 131 | 3300037418 | Ga0395900_0017121 | Ga0395900_0017121_4278_5165 | 294 |
| 132 | 3300037466 | Ga0395898_0002029 | Ga0395898_0002029_23337_24224 | 294 |
| 133 | 3300037466 | Ga0395898_0007863 | Ga0395898_0007863_9610_10497 | 294 |
| 134 | 3300038443 | Ga0395901_0022671 | Ga0395901_0022671_2031_2918 | 294 |
| 135 | 3300038443 | Ga0395901_0028239 | Ga0395901_0028239_3830_4717 | 294 |
| 136 | 3300046460 | Ga0495638_0082256 | Ga0495638_0082256_472_1365 | 294 |
| 137 | 3300046524 | Ga0495648_0001451 | Ga0495648_0001451_6725_7618 | 294 |
| 138 | 3300046660 | Ga0495625_0181892 | Ga0495625_0181892_384_1274 | 294 |
| 139 | 3300047443 | Ga0495687_000010 | Ga0495687_000010_37159_38052 | 294 |
| 140 | 3300050511 | nmdc:mga08y16_198402_c1 | nmdc:mga08y16_198402_c1_209_1099 | 294 |
| 141 | 3300053156 | Ga0500622_0003469 | Ga0500622_0003469_2908_3801 | 294 |
| 142 | 3300003320 | rootH2_10051659 | rootH2_100516592 | 295 |
| 143 | 3300005338 | Ga0068868_100080275 | Ga0068868_1000802751 | 295 |
| 144 | 3300005843 | Ga0068860_100015123 | Ga0068860_1000151232 | 295 |
| 145 | 3300009093 | Ga0105240_10021390 | Ga0105240_100213904 | 295 |
| 146 | 3300009545 | Ga0105237_10158857 | Ga0105237_101588573 | 295 |
| 147 | 3300010375 | Ga0105239_10003441 | Ga0105239_100034418 | 295 |
| 148 | 3300025913 | Ga0207695_10024993 | Ga0207695_100249932 | 295 |
| 149 | 3300025914 | Ga0207671_10096828 | Ga0207671_100968282 | 295 |
| 150 | 3300025986 | Ga0207658_10109645 | Ga0207658_101096452 | 295 |
| 151 | 3300026023 | Ga0207677_10115394 | Ga0207677_101153941 | 295 |
| 152 | 3300028379 | Ga0268266_10333366 | Ga0268266_103333662 | 295 |
| 153 | 3300028381 | Ga0268264_10020469 | Ga0268264_100204692 | 295 |
| 154 | 3300049670 | Ga0501236_000236 | Ga0501236_000236_4107_5003 | 295 |
| 155 | iso_pu_bacteria | 2911138879 | 2911142156 | 295 |
| 156 | 3300005290 | Ga0065712_10075156 | Ga0065712_100751562 | 296 |
| 157 | 3300005293 | Ga0065715_10114608 | Ga0065715_101146082 | 296 |
| 158 | 3300005328 | Ga0070676_10011296 | Ga0070676_100112962 | 296 |
| 159 | 3300005329 | Ga0070683_100152268 | Ga0070683_1001522682 | 296 |
| 160 | 3300005331 | Ga0070670_100042006 | Ga0070670_1000420063 | 296 |
| 161 | 3300005331 | Ga0070670_100071438 | Ga0070670_1000714384 | 296 |
| 162 | 3300005331 | Ga0070670_100179248 | Ga0070670_1001792482 | 296 |
| 163 | 3300005335 | Ga0070666_10031380 | Ga0070666_100313802 | 296 |
| 164 | 3300005335 | Ga0070666_10105344 | Ga0070666_101053442 | 296 |
| 165 | 3300005338 | Ga0068868_100017955 | Ga0068868_1000179556 | 296 |
| 166 | 3300005340 | Ga0070689_100029484 | Ga0070689_1000294842 | 296 |
| 167 | 3300005340 | Ga0070689_100128734 | Ga0070689_1001287343 | 296 |
| 168 | 3300005340 | Ga0070689_100229312 | Ga0070689_1002293122 | 296 |
| 169 | 3300005343 | Ga0070687_100028516 | Ga0070687_1000285162 | 296 |
| 170 | 3300005353 | Ga0070669_100152805 | Ga0070669_1001528052 | 296 |
| 171 | 3300005353 | Ga0070669_100231678 | Ga0070669_1002316781 | 296 |
| 172 | 3300005355 | Ga0070671_100078478 | Ga0070671_1000784782 | 296 |
| 173 | 3300005356 | Ga0070674_100246049 | Ga0070674_1002460492 | 296 |
| 174 | 3300005364 | Ga0070673_100032993 | Ga0070673_1000329932 | 296 |
| 175 | 3300005364 | Ga0070673_100046959 | Ga0070673_1000469592 | 296 |
| 176 | 3300005365 | Ga0070688_100008942 | Ga0070688_1000089428 | 296 |
| 177 | 3300005365 | Ga0070688_100066713 | Ga0070688_1000667132 | 296 |
| 178 | 3300005367 | Ga0070667_100114218 | Ga0070667_1001142182 | 296 |
| 179 | 3300005440 | Ga0070705_100273048 | Ga0070705_1002730481 | 296 |
| 180 | 3300005456 | Ga0070678_100002435 | Ga0070678_1000024355 | 296 |
| 181 | 3300005457 | Ga0070662_100021920 | Ga0070662_1000219202 | 296 |
| 182 | 3300005458 | Ga0070681_10203203 | Ga0070681_102032032 | 296 |
| 183 | 3300005466 | Ga0070685_10013499 | Ga0070685_100134995 | 296 |
| 184 | 3300005466 | Ga0070685_10114477 | Ga0070685_101144772 | 296 |
| 185 | 3300005539 | Ga0068853_100105912 | Ga0068853_1001059122 | 296 |
| 186 | 3300005539 | Ga0068853_100589496 | Ga0068853_1005894961 | 296 |
| 187 | 3300005543 | Ga0070672_100031631 | Ga0070672_1000316313 | 296 |
| 188 | 3300005564 | Ga0070664_100079315 | Ga0070664_1000793153 | 296 |
| 189 | 3300005564 | Ga0070664_100134759 | Ga0070664_1001347592 | 296 |
| 190 | 3300005616 | Ga0068852_100096861 | Ga0068852_1000968614 | 296 |
| 191 | 3300005617 | Ga0068859_100046370 | Ga0068859_1000463708 | 296 |
| 192 | 3300005617 | Ga0068859_100051078 | Ga0068859_1000510782 | 296 |
| 193 | 3300005719 | Ga0068861_100044518 | Ga0068861_1000445183 | 296 |
| 194 | 3300005840 | Ga0068870_10051269 | Ga0068870_100512692 | 296 |
| 195 | 3300005840 | Ga0068870_10192833 | Ga0068870_101928332 | 296 |
| 196 | 3300005841 | Ga0068863_100002821 | Ga0068863_10000282113 | 296 |
| 197 | 3300005841 | Ga0068863_100030063 | Ga0068863_1000300634 | 296 |
| 198 | 3300005842 | Ga0068858_100070948 | Ga0068858_1000709484 | 296 |
| 199 | 3300005842 | Ga0068858_100148526 | Ga0068858_1001485263 | 296 |
| 200 | 3300005844 | Ga0068862_100197746 | Ga0068862_1001977461 | 296 |
| 201 | 3300006237 | Ga0097621_100021648 | Ga0097621_1000216484 | 296 |
| 202 | 3300006881 | Ga0068865_100005051 | Ga0068865_1000050512 | 296 |
| 203 | 3300006931 | Ga0097620_100046370 | Ga0097620_1000463708 | 296 |
| 204 | 3300006931 | Ga0097620_100051079 | Ga0097620_1000510792 | 296 |
| 205 | 3300006931 | Ga0097620_100378536 | Ga0097620_1003785361 | 296 |
| 206 | 3300009174 | Ga0105241_10078148 | Ga0105241_100781481 | 296 |
| 207 | 3300009176 | Ga0105242_10034895 | Ga0105242_100348953 | 296 |
| 208 | 3300009176 | Ga0105242_10051105 | Ga0105242_100511052 | 296 |
| 209 | 3300009177 | Ga0105248_10199294 | Ga0105248_101992943 | 296 |
| 210 | 3300009177 | Ga0105248_10344715 | Ga0105248_103447152 | 296 |
| 211 | 3300009553 | Ga0105249_10000440 | Ga0105249_1000044024 | 296 |
| 212 | 3300009553 | Ga0105249_10006991 | Ga0105249_100069917 | 296 |
| 213 | 3300009553 | Ga0105249_10131621 | Ga0105249_101316213 | 296 |
| 214 | 3300011119 | Ga0105246_10020305 | Ga0105246_100203052 | 296 |
| 215 | 3300013296 | Ga0157374_10244642 | Ga0157374_102446422 | 296 |
| 216 | 3300013306 | Ga0163162_10016333 | Ga0163162_100163335 | 296 |
| 217 | 3300013306 | Ga0163162_10088944 | Ga0163162_100889443 | 296 |
| 218 | 3300013308 | Ga0157375_10180946 | Ga0157375_101809463 | 296 |
| 219 | 3300014969 | Ga0157376_10448933 | Ga0157376_104489332 | 296 |
| 220 | 3300017792 | Ga0163161_10028517 | Ga0163161_100285171 | 296 |
| 221 | 3300025907 | Ga0207645_10000219 | Ga0207645_1000021936 | 296 |
| 222 | 3300025907 | Ga0207645_10324500 | Ga0207645_103245001 | 296 |
| 223 | 3300025908 | Ga0207643_10037867 | Ga0207643_100378673 | 296 |
| 224 | 3300025908 | Ga0207643_10106784 | Ga0207643_101067842 | 296 |
| 225 | 3300025911 | Ga0207654_10293473 | Ga0207654_102934731 | 296 |
| 226 | 3300025913 | Ga0207695_10334446 | Ga0207695_103344462 | 296 |
| 227 | 3300025925 | Ga0207650_10094666 | Ga0207650_100946662 | 296 |
| 228 | 3300025925 | Ga0207650_10499066 | Ga0207650_104990661 | 296 |
| 229 | 3300025926 | Ga0207659_10099925 | Ga0207659_100999251 | 296 |
| 230 | 3300025931 | Ga0207644_10370025 | Ga0207644_103700252 | 296 |
| 231 | 3300025933 | Ga0207706_10113264 | Ga0207706_101132643 | 296 |
| 232 | 3300025933 | Ga0207706_10147638 | Ga0207706_101476382 | 296 |
| 233 | 3300025934 | Ga0207686_10013705 | Ga0207686_100137057 | 296 |
| 234 | 3300025934 | Ga0207686_10164757 | Ga0207686_101647571 | 296 |
| 235 | 3300025938 | Ga0207704_10138312 | Ga0207704_101383122 | 296 |
| 236 | 3300025940 | Ga0207691_10026863 | Ga0207691_100268632 | 296 |
| 237 | 3300025940 | Ga0207691_10041145 | Ga0207691_100411453 | 296 |
| 238 | 3300025942 | Ga0207689_10012591 | Ga0207689_100125917 | 296 |
| 239 | 3300025942 | Ga0207689_10052143 | Ga0207689_100521432 | 296 |
| 240 | 3300025960 | Ga0207651_10068302 | Ga0207651_100683022 | 296 |
| 241 | 3300025961 | Ga0207712_10008783 | Ga0207712_100087833 | 296 |
| 242 | 3300025972 | Ga0207668_10021341 | Ga0207668_100213412 | 296 |
| 243 | 3300025972 | Ga0207668_10022772 | Ga0207668_100227722 | 296 |
| 244 | 3300025981 | Ga0207640_10242138 | Ga0207640_102421381 | 296 |
| 245 | 3300025986 | Ga0207658_10153877 | Ga0207658_101538772 | 296 |
| 246 | 3300026023 | Ga0207677_10314205 | Ga0207677_103142051 | 296 |
| 247 | 3300026035 | Ga0207703_10018755 | Ga0207703_100187556 | 296 |
| 248 | 3300026035 | Ga0207703_10126349 | Ga0207703_101263491 | 296 |
| 249 | 3300026088 | Ga0207641_10000331 | Ga0207641_1000033149 | 296 |
| 250 | 3300026088 | Ga0207641_10010813 | Ga0207641_100108139 | 296 |
| 251 | 3300026088 | Ga0207641_10170550 | Ga0207641_101705503 | 296 |
| 252 | 3300026089 | Ga0207648_10001733 | Ga0207648_100017337 | 296 |
| 253 | 3300026095 | Ga0207676_10088814 | Ga0207676_100888143 | 296 |
| 254 | 3300026118 | Ga0207675_100053459 | Ga0207675_1000534593 | 296 |
| 255 | 3300026142 | Ga0207698_10122754 | Ga0207698_101227543 | 296 |
| 256 | 3300028381 | Ga0268264_10010697 | Ga0268264_100106971 | 296 |
| 257 | 3300030521 | Ga0307511_10000135 | Ga0307511_1000013528 | 296 |
| 258 | 3300041486 | Ga0451807_2749233 | Ga0451807_2749233_289_1206 | 296 |
| 259 | 3300042876 | Ga0451577_0041024 | Ga0451577_0041024_514_1404 | 296 |
| 260 | 3300044712 | Ga0453684_0003205 | Ga0453684_0003205_33_923 | 296 |
| 261 | 3300044735 | Ga0466968_0012293 | Ga0466968_0012293_1190_2086 | 296 |
| 262 | 3300046539 | Ga0495621_0010839 | Ga0495621_0010839_1724_2677 | 296 |
| 263 | 3300048913 | Ga0496110_0057931 | Ga0496110_0057931_1515_2408 | 296 |
| 264 | iso_pu_bacteria | 2738541278 | 2738729084 | 296 |
| 265 | 3300005334 | Ga0068869_100017075 | Ga0068869_1000170751 | 297 |
| 266 | 3300005338 | Ga0068868_100010727 | Ga0068868_10001072710 | 297 |
| 267 | 3300005344 | Ga0070661_100003203 | Ga0070661_1000032034 | 297 |
| 268 | 3300005344 | Ga0070661_100010992 | Ga0070661_1000109927 | 297 |
| 269 | 3300005347 | Ga0070668_100074872 | Ga0070668_1000748723 | 297 |
| 270 | 3300005354 | Ga0070675_100055432 | Ga0070675_1000554324 | 297 |
| 271 | 3300005355 | Ga0070671_100379107 | Ga0070671_1003791071 | 297 |
| 272 | 3300005364 | Ga0070673_100034212 | Ga0070673_1000342126 | 297 |
| 273 | 3300005364 | Ga0070673_100342572 | Ga0070673_1003425722 | 297 |
| 274 | 3300005366 | Ga0070659_100031300 | Ga0070659_1000313001 | 297 |
| 275 | 3300005366 | Ga0070659_100428252 | Ga0070659_1004282521 | 297 |
| 276 | 3300005457 | Ga0070662_100043003 | Ga0070662_1000430034 | 297 |
| 277 | 3300005457 | Ga0070662_100063186 | Ga0070662_1000631863 | 297 |
| 278 | 3300005459 | Ga0068867_100029608 | Ga0068867_1000296081 | 297 |
| 279 | 3300005466 | Ga0070685_10073499 | Ga0070685_100734993 | 297 |
| 280 | 3300005535 | Ga0070684_100000880 | Ga0070684_10000088019 | 297 |
| 281 | 3300005539 | Ga0068853_100002867 | Ga0068853_10000286717 | 297 |
| 282 | 3300005539 | Ga0068853_100052447 | Ga0068853_1000524472 | 297 |
| 283 | 3300005543 | Ga0070672_100120636 | Ga0070672_1001206362 | 297 |
| 284 | 3300005547 | Ga0070693_100243883 | Ga0070693_1002438832 | 297 |
| 285 | 3300005548 | Ga0070665_100401235 | Ga0070665_1004012352 | 297 |
| 286 | 3300005563 | Ga0068855_100065598 | Ga0068855_1000655984 | 297 |
| 287 | 3300005564 | Ga0070664_100015208 | Ga0070664_10001520810 | 297 |
| 288 | 3300005564 | Ga0070664_100075165 | Ga0070664_1000751653 | 297 |
| 289 | 3300005577 | Ga0068857_100004008 | Ga0068857_1000040083 | 297 |
| 290 | 3300005578 | Ga0068854_100099293 | Ga0068854_1000992932 | 297 |
| 291 | 3300005616 | Ga0068852_100129377 | Ga0068852_1001293771 | 297 |
| 292 | 3300005616 | Ga0068852_100473619 | Ga0068852_1004736192 | 297 |
| 293 | 3300006237 | Ga0097621_100326352 | Ga0097621_1003263522 | 297 |
| 294 | 3300009011 | Ga0105251_10134793 | Ga0105251_101347931 | 297 |
| 295 | 3300009174 | Ga0105241_10084798 | Ga0105241_100847983 | 297 |
| 296 | 3300009174 | Ga0105241_10148878 | Ga0105241_101488782 | 297 |
| 297 | 3300009176 | Ga0105242_10601461 | Ga0105242_106014611 | 297 |
| 298 | 3300009553 | Ga0105249_10064186 | Ga0105249_100641862 | 297 |
| 299 | 3300011119 | Ga0105246_10312339 | Ga0105246_103123392 | 297 |
| 300 | 3300013100 | Ga0157373_10041465 | Ga0157373_100414653 | 297 |
| 301 | 3300013100 | Ga0157373_10123402 | Ga0157373_101234023 | 297 |
| 302 | 3300013102 | Ga0157371_10003304 | Ga0157371_100033047 | 297 |
| 303 | 3300013102 | Ga0157371_10113565 | Ga0157371_101135652 | 297 |
| 304 | 3300013105 | Ga0157369_10055078 | Ga0157369_100550783 | 297 |
| 305 | 3300013296 | Ga0157374_10000768 | Ga0157374_1000076821 | 297 |
| 306 | 3300013296 | Ga0157374_10028526 | Ga0157374_100285262 | 297 |
| 307 | 3300013297 | Ga0157378_10131156 | Ga0157378_101311562 | 297 |
| 308 | 3300013306 | Ga0163162_10047969 | Ga0163162_100479697 | 297 |
| 309 | 3300013306 | Ga0163162_10206342 | Ga0163162_102063423 | 297 |
| 310 | 3300013307 | Ga0157372_10180998 | Ga0157372_101809981 | 297 |
| 311 | 3300013307 | Ga0157372_10369937 | Ga0157372_103699373 | 297 |
| 312 | 3300013308 | Ga0157375_10014775 | Ga0157375_100147753 | 297 |
| 313 | 3300013308 | Ga0157375_10067045 | Ga0157375_100670455 | 297 |
| 314 | 3300013308 | Ga0157375_10538232 | Ga0157375_105382322 | 297 |
| 315 | 3300014325 | Ga0163163_10154981 | Ga0163163_101549813 | 297 |
| 316 | 3300014326 | Ga0157380_10122351 | Ga0157380_101223511 | 297 |
| 317 | 3300014745 | Ga0157377_10008926 | Ga0157377_100089266 | 297 |
| 318 | 3300014745 | Ga0157377_10046295 | Ga0157377_100462952 | 297 |
| 319 | 3300014968 | Ga0157379_10076189 | Ga0157379_100761893 | 297 |
| 320 | 3300014969 | Ga0157376_10355426 | Ga0157376_103554261 | 297 |
| 321 | 3300017792 | Ga0163161_10029879 | Ga0163161_100298793 | 297 |
| 322 | 3300025904 | Ga0207647_10072898 | Ga0207647_100728983 | 297 |
| 323 | 3300025905 | Ga0207685_10053370 | Ga0207685_100533702 | 297 |
| 324 | 3300025907 | Ga0207645_10030770 | Ga0207645_100307704 | 297 |
| 325 | 3300025913 | Ga0207695_10019538 | Ga0207695_100195386 | 297 |
| 326 | 3300025920 | Ga0207649_10013357 | Ga0207649_100133573 | 297 |
| 327 | 3300025920 | Ga0207649_10030617 | Ga0207649_100306173 | 297 |
| 328 | 3300025932 | Ga0207690_10013435 | Ga0207690_100134359 | 297 |
| 329 | 3300025933 | Ga0207706_10004613 | Ga0207706_100046133 | 297 |
| 330 | 3300025933 | Ga0207706_10041293 | Ga0207706_100412935 | 297 |
| 331 | 3300025936 | Ga0207670_10064765 | Ga0207670_100647652 | 297 |
| 332 | 3300025938 | Ga0207704_10170279 | Ga0207704_101702791 | 297 |
| 333 | 3300025942 | Ga0207689_10005499 | Ga0207689_1000549916 | 297 |
| 334 | 3300025942 | Ga0207689_10179983 | Ga0207689_101799831 | 297 |
| 335 | 3300025942 | Ga0207689_10394765 | Ga0207689_103947652 | 297 |
| 336 | 3300025944 | Ga0207661_10006521 | Ga0207661_100065216 | 297 |
| 337 | 3300025945 | Ga0207679_10012269 | Ga0207679_100122696 | 297 |
| 338 | 3300025960 | Ga0207651_10115259 | Ga0207651_101152592 | 297 |
| 339 | 3300025960 | Ga0207651_10364346 | Ga0207651_103643461 | 297 |
| 340 | 3300025972 | Ga0207668_10188387 | Ga0207668_101883871 | 297 |
| 341 | 3300026023 | Ga0207677_10044312 | Ga0207677_100443122 | 297 |
| 342 | 3300026023 | Ga0207677_10060201 | Ga0207677_100602012 | 297 |
| 343 | 3300026041 | Ga0207639_10023865 | Ga0207639_100238658 | 297 |
| 344 | 3300026067 | Ga0207678_10047462 | Ga0207678_100474622 | 297 |
| 345 | 3300026088 | Ga0207641_10348620 | Ga0207641_103486201 | 297 |
| 346 | 3300026089 | Ga0207648_10043484 | Ga0207648_100434845 | 297 |
| 347 | 3300026089 | Ga0207648_10108630 | Ga0207648_101086302 | 297 |
| 348 | 3300026089 | Ga0207648_10219668 | Ga0207648_102196683 | 297 |
| 349 | 3300026095 | Ga0207676_10147136 | Ga0207676_101471361 | 297 |
| 350 | 3300026116 | Ga0207674_10007811 | Ga0207674_100078112 | 297 |
| 351 | 3300026118 | Ga0207675_100158386 | Ga0207675_1001583863 | 297 |
| 352 | 3300026142 | Ga0207698_10523727 | Ga0207698_105237271 | 297 |
| 353 | 3300031456 | Ga0307513_10106135 | Ga0307513_101061351 | 297 |
| 354 | 3300031727 | Ga0316576_10319869 | Ga0316576_103198692 | 297 |
| 355 | 3300037418 | Ga0395900_0146685 | Ga0395900_0146685_594_1490 | 297 |
| 356 | 3300045051 | Ga0451576_0150218 | Ga0451576_0150218_825_1718 | 297 |
| 357 | 3300046460 | Ga0495638_0000025 | Ga0495638_0000025_302564_303460 | 297 |
| 358 | 3300046511 | Ga0495608_0114636 | Ga0495608_0114636_478_1374 | 297 |
| 359 | 3300046559 | Ga0495667_0202927 | Ga0495667_0202927_344_1240 | 297 |
| 360 | 3300046683 | Ga0495658_0161823 | Ga0495658_0161823_66_962 | 297 |
| 361 | 3300053153 | Ga0500616_0000024 | Ga0500616_0000024_309574_310470 | 297 |
| 362 | 3300003320 | rootH2_10015293 | rootH2_1001529310 | 298 |
| 363 | 3300005617 | Ga0068859_100094435 | Ga0068859_1000944352 | 298 |
| 364 | 3300005843 | Ga0068860_100047253 | Ga0068860_1000472532 | 298 |
| 365 | 3300005844 | Ga0068862_100472012 | Ga0068862_1004720121 | 298 |
| 366 | 3300006195 | Ga0075366_10069475 | Ga0075366_100694753 | 298 |
| 367 | 3300006931 | Ga0097620_100094437 | Ga0097620_1000944373 | 298 |
| 368 | 3300009176 | Ga0105242_10003279 | Ga0105242_100032793 | 298 |
| 369 | 3300010375 | Ga0105239_10011622 | Ga0105239_100116227 | 298 |
| 370 | 3300011119 | Ga0105246_10195807 | Ga0105246_101958071 | 298 |
| 371 | 3300025935 | Ga0207709_10374796 | Ga0207709_103747961 | 298 |
| 372 | 3300025972 | Ga0207668_10173644 | Ga0207668_101736441 | 298 |
| 373 | 3300050507 | nmdc:mga05p37_14505_c1 | nmdc:mga05p37_14505_c1_1115_2014 | 299 |
| 374 | 3300053086 | Ga0500578_0077960 | Ga0500578_0077960_93_995 | 299 |
| 375 | 3300003316 | rootH1_10017715 | rootH1_1001771511 | 300 |
| 376 | 3300003323 | rootH1_10015462 | rootH1_100154628 | 300 |
| 377 | 3300003323 | rootH1_10177446 | rootH1_101774461 | 300 |
| 378 | 3300044658 | Ga0466972_0000028 | Ga0466972_0000028_165315_166220 | 300 |
| 379 | 3300044658 | Ga0466972_0006551 | Ga0466972_0006551_852_1757 | 300 |
| 380 | 3300044842 | Ga0466957_0001154 | Ga0466957_0001154_8140_9045 | 300 |
| 381 | 3300049581 | Ga0501047_0158311 | Ga0501047_0158311_1072_1977 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jbf-assembly3.cif.gz_C | structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g. | 0.9124 | 26 | 293 |
| 2j8y-assembly2.cif.gz_B | structure of pbp-a acyl-enzyme complex with penicillin-g | 0.9124 | 26 | 293 |
| 7tbx-assembly2.cif.gz_B | crystal structure of d179y kpc-2 beta-lactamase | 0.9013 | 27 | 294 |
| 7tbx-assembly1.cif.gz_A | crystal structure of d179y kpc-2 beta-lactamase | 0.8987 | 27 | 294 |
| 8eo7-assembly2.cif.gz_B | crystal structure of metagenomic beta-lactamase lra-5 y69q/v166e mutant at 2.15 angstrom resolution | 0.8958 | 25 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j7vB01 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9146 | 26 | 293 | 3.40.710.10 |
| 2j7vB01 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8818 | 26 | 293 | 3.40.710.10 |
| 5hw3A00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8742 | 22 | 298 | 3.40.710.10 |
| 1mfoA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.874 | 29 | 291 | 3.40.710.10 |
| 1g6aA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8732 | 27 | 297 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G9LU15-F1-model_v4 | Beta-lactamase class A | 0.9967 | 27 | 294 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A059X8Z5-F1-model_v4 | ClassA_beta_lactamase | 0.9954 | 126 | 294 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A4Q5RDR7-F1-model_v4 | DUF3471 domain-containing protein | 0.9932 | 22 | 295 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A514CMB5-F1-model_v4 | Serine hydrolase | 0.9894 | 26 | 300 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A521MSD1-F1-model_v4 | Serine hydrolase | 0.988 | 23 | 296 |
GO:0008800
GO:0030655 GO:0046677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar