F428764

General Info

Members Datasets Scaffolds Average Seq Length
380 299 760 210

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0374098|Ga0495628_0374098_114_890
Length 239
Sequence LLRFARNDTDEAAIGSCHCEERSDKATPVRPAAARTQNTEYDYLHDPAAIYRRSFALIRAEADLARFPPALRPLAIRLAHAAGDVAVLDDLAWSRGAVAAGRRALAGGAAILVDSTMVAAGIALDRLPAGNQVVCTLRDPAVPALAASRNTTRSAAAVELWQAHLAGAVVAIGNAPTALFHLLEMLAAGAGRPALILGFPVGFVGAAEAKEALAGFGRGLHYVTLKGRRGGSALAAAPG

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
211 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2671180195 Frankia sp. CcI49 Isolate Nodule
294 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
295 2773857922 Frankia sp. CcI49 Isolate Nodule
296 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
297 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
298 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
299 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.53
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 0.53
Rhizoplane 10
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0374098 3300046516 Bacteria 1044
2 JGI24743J22301_10050853 3300001991 Bacteria 844
3 JGI24735J21928_10021852 3300002067 Bacteria 1951
4 JGI24750J21931_1001571 3300002070 Bacteria 2805
5 JGI24738J21930_10019288 3300002075 Bacteria 1422
6 JGI24742J22300_10036100 3300002244 Bacteria 873
7 JGI24751J29686_10020087 3300002459 Bacteria 1383
8 Ga0070658_10000503 3300005327 Bacteria 33889
9 Ga0070676_10003336 3300005328 Bacteria 8350
10 Ga0070683_100075565 3300005329 Bacteria 3148
11 Ga0070690_100000707 3300005330 Bacteria 17127
12 Ga0070670_100003181 3300005331 Bacteria 13552
13 Ga0070670_100200437 3300005331 Bacteria 1734
14 Ga0068869_100008488 3300005334 Bacteria 6627
15 Ga0070666_10006839 3300005335 Bacteria 7026
16 Ga0070680_100009490 3300005336 Bacteria 7474
17 Ga0070682_100002463 3300005337 Bacteria 10228
18 Ga0070660_100000470 3300005339 Bacteria 26899
19 Ga0070689_100001190 3300005340 Bacteria 16470
20 Ga0070691_10000513 3300005341 Bacteria 14607
21 Ga0070687_100003935 3300005343 Bacteria 5848
22 Ga0070661_100001065 3300005344 Bacteria 19450
23 Ga0070692_10000633 3300005345 Bacteria 11124
24 Ga0070668_100000473 3300005347 Bacteria 26614
25 Ga0070668_100313539 3300005347 Bacteria 1319
26 Ga0070669_100000673 3300005353 Bacteria 25075
27 Ga0070675_100001198 3300005354 Bacteria 18866
28 Ga0070671_100003806 3300005355 Bacteria 11840
29 Ga0070671_100415991 3300005355 Bacteria 1151
30 Ga0070674_100003588 3300005356 Bacteria 8727
31 Ga0070673_100001395 3300005364 Bacteria 14133
32 Ga0070688_100002647 3300005365 Bacteria 9086
33 Ga0070659_100032422 3300005366 Bacteria 4052
34 Ga0070667_100001078 3300005367 Bacteria 24978
35 Ga0070703_10003428 3300005406 Bacteria 4522
36 Ga0070709_10001042 3300005434 Bacteria 15351
37 Ga0070714_100006532 3300005435 Bacteria 9016
38 Ga0070713_100018107 3300005436 Bacteria 5351
39 Ga0070710_10006336 3300005437 Bacteria 5678
40 Ga0070711_100005900 3300005439 Bacteria 7352
41 Ga0070711_100093748 3300005439 Bacteria 2169
42 Ga0070705_100000456 3300005440 Bacteria 23498
43 Ga0070700_100000351 3300005441 Bacteria 23678
44 Ga0070694_100001206 3300005444 Bacteria 14913
45 Ga0070708_100229153 3300005445 Bacteria 1743
46 Ga0070663_100000509 3300005455 Bacteria 20587
47 Ga0070678_100016089 3300005456 Bacteria 4773
48 Ga0070662_100001211 3300005457 Bacteria 15839
49 Ga0070681_10348482 3300005458 Bacteria 1391
50 Ga0068867_100081639 3300005459 Bacteria 2438
51 Ga0070706_100069641 3300005467 Bacteria 3254
52 Ga0070698_100381941 3300005471 Bacteria 1341
53 Ga0070699_100213070 3300005518 Bacteria 1720
54 Ga0070679_100021478 3300005530 Bacteria 6303
55 Ga0070684_100078829 3300005535 Bacteria 2911
56 Ga0070697_100022224 3300005536 Bacteria 5034
57 Ga0068853_100009339 3300005539 Bacteria 7906
58 Ga0070672_100003875 3300005543 Bacteria 9738
59 Ga0070686_100001920 3300005544 Bacteria 11554
60 Ga0070695_100000490 3300005545 Bacteria 20675
61 Ga0070696_100002589 3300005546 Bacteria 11988
62 Ga0070696_100417793 3300005546 Bacteria 1052
63 Ga0070693_100000324 3300005547 Bacteria 21918
64 Ga0070665_100088687 3300005548 Bacteria 3099
65 Ga0070704_100000204 3300005549 Bacteria 24641
66 Ga0068855_100009596 3300005563 Bacteria 11677
67 Ga0068855_100064090 3300005563 Bacteria 4286
68 Ga0070664_100001010 3300005564 Bacteria 22089
69 Ga0068857_100005251 3300005577 Bacteria 11028
70 Ga0068854_100001153 3300005578 Bacteria 15892
71 Ga0068856_100027619 3300005614 Bacteria 5536
72 Ga0068856_100802143 3300005614 Bacteria 961
73 Ga0070702_100000297 3300005615 Bacteria 17062
74 Ga0068852_100032180 3300005616 Bacteria 4339
75 Ga0068859_100001497 3300005617 Bacteria 23796
76 Ga0068864_100002196 3300005618 Bacteria 16099
77 Ga0068861_100000388 3300005719 Bacteria 25344
78 Ga0068863_100035194 3300005841 Bacteria 4770
79 Ga0068858_100002039 3300005842 Bacteria 20578
80 Ga0068860_100005176 3300005843 Bacteria 13262
81 Ga0068862_100001181 3300005844 Bacteria 24633
82 Ga0081455_10238786 3300005937 Bacteria 1337
83 Ga0081455_10605604 3300005937 Bacteria 713
84 Ga0075365_10170276 3300006038 Bacteria 1520
85 Ga0075365_10360141 3300006038 Bacteria 1025
86 Ga0075368_10014246 3300006042 Bacteria 2934
87 Ga0075368_10184727 3300006042 Bacteria 879
88 Ga0070715_10002759 3300006163 Bacteria 5455
89 Ga0070716_100000413 3300006173 Bacteria 17580
90 Ga0070712_100000330 3300006175 Bacteria 26920
91 Ga0075367_10355010 3300006178 Bacteria 925
92 Ga0075367_10404447 3300006178 Bacteria 863
93 Ga0075366_10040683 3300006195 Bacteria 2750
94 Ga0068871_100082916 3300006358 Bacteria 2659
95 Ga0075428_100102516 3300006844 Bacteria 3120
96 Ga0075428_100159468 3300006844 Bacteria 2449
97 Ga0075431_100121820 3300006847 Bacteria 2691
98 Ga0075434_100158608 3300006871 Bacteria 2282
99 Ga0075429_100032823 3300006880 Bacteria 4512
100 Ga0068865_100004158 3300006881 Bacteria 8706
101 Ga0097620_100001497 3300006931 Bacteria 23796
102 Ga0075435_100031063 3300007076 Bacteria 4205
103 Ga0105240_10056739 3300009093 Bacteria 4898
104 Ga0105240_10182765 3300009093 Bacteria 2473
105 Ga0111539_10205364 3300009094 Bacteria 2296
106 Ga0105245_10004386 3300009098 Bacteria 12487
107 Ga0105245_10219987 3300009098 Bacteria 1832
108 Ga0105247_10000735 3300009101 Bacteria 25403
109 Ga0114129_10362286 3300009147 Bacteria 1918
110 Ga0105243_10001060 3300009148 Bacteria 25131
111 Ga0105241_10001136 3300009174 Bacteria 20268
112 Ga0105242_10006408 3300009176 Bacteria 9063
113 Ga0105248_10003525 3300009177 Bacteria 17354
114 Ga0105237_10002772 3300009545 Bacteria 21300
115 Ga0105237_10108319 3300009545 Bacteria 2770
116 Ga0105249_10001022 3300009553 Bacteria 24747
117 Ga0105239_10007393 3300010375 Bacteria 12606
118 Ga0105246_10003303 3300011119 Bacteria 9765
119 Ga0105246_10067930 3300011119 Bacteria 2498
120 Ga0157373_10035885 3300013100 Bacteria 3559
121 Ga0157371_10045768 3300013102 Bacteria 3113
122 Ga0157369_10006575 3300013105 Bacteria 13448
123 Ga0157374_10007909 3300013296 Bacteria 9077
124 Ga0157378_10001697 3300013297 Bacteria 19825
125 Ga0157372_10024590 3300013307 Bacteria 6545
126 Ga0157375_10001908 3300013308 Bacteria 17926
127 Ga0163163_10004831 3300014325 Bacteria 11579
128 Ga0157380_10025771 3300014326 Bacteria 4462
129 Ga0157380_10037180 3300014326 Bacteria 3770
130 Ga0157380_10107252 3300014326 Bacteria 2339
131 Ga0157377_10008062 3300014745 Bacteria 5123
132 Ga0157379_10002720 3300014968 Bacteria 14928
133 Ga0157376_10000963 3300014969 Bacteria 18761
134 Ga0163161_10001664 3300017792 Bacteria 16317
135 Ga0206353_10377187 3300020082 Bacteria 1642
136 Ga0213876_10092751 3300021384 Bacteria 1600
137 Ga0209130_1000449 3300025284 Bacteria 43219
138 Ga0209256_1000109 3300025299 Bacteria 184928
139 Ga0207653_10014217 3300025885 Bacteria 2497
140 Ga0207692_10022303 3300025898 Bacteria 2911
141 Ga0207692_10455907 3300025898 Bacteria 806
142 Ga0207642_10000714 3300025899 Bacteria 10286
143 Ga0207710_10001385 3300025900 Bacteria 12149
144 Ga0207688_10001407 3300025901 Bacteria 12553
145 Ga0207680_10010267 3300025903 Bacteria 4679
146 Ga0207647_10202024 3300025904 Bacteria 1149
147 Ga0207685_10000242 3300025905 Bacteria 8521
148 Ga0207699_10024009 3300025906 Bacteria 3327
149 Ga0207699_10387916 3300025906 Bacteria 993
150 Ga0207645_10009306 3300025907 Bacteria 6803
151 Ga0207705_10001861 3300025909 Bacteria 16558
152 Ga0207684_10325275 3300025910 Bacteria 1325
153 Ga0207654_10001705 3300025911 Bacteria 11463
154 Ga0207707_10399937 3300025912 Bacteria 1179
155 Ga0207671_10015254 3300025914 Bacteria 6031
156 Ga0207693_10000646 3300025915 Bacteria 31179
157 Ga0207663_10001337 3300025916 Bacteria 11411
158 Ga0207663_10092392 3300025916 Bacteria 2012
159 Ga0207662_10004799 3300025918 Bacteria 7146
160 Ga0207657_10001652 3300025919 Bacteria 24062
161 Ga0207649_10003301 3300025920 Bacteria 8830
162 Ga0207652_10063747 3300025921 Bacteria 3188
163 Ga0207650_10004026 3300025925 Bacteria 10052
164 Ga0207687_10013808 3300025927 Bacteria 5275
165 Ga0207687_10359119 3300025927 Bacteria 1189
166 Ga0207687_10884356 3300025927 Bacteria 764
167 Ga0207700_10012966 3300025928 Bacteria 5400
168 Ga0207664_10013806 3300025929 Bacteria 5814
169 Ga0207664_10018580 3300025929 Bacteria 5122
170 Ga0207690_10000954 3300025932 Bacteria 18519
171 Ga0207706_10000959 3300025933 Bacteria 29513
172 Ga0207686_10015152 3300025934 Bacteria 4306
173 Ga0207709_10007357 3300025935 Bacteria 6134
174 Ga0207669_10011656 3300025937 Bacteria 4288
175 Ga0207704_10007279 3300025938 Bacteria 5217
176 Ga0207704_10060354 3300025938 Bacteria 2346
177 Ga0207665_10000220 3300025939 Bacteria 38718
178 Ga0207665_10036140 3300025939 Bacteria 3283
179 Ga0207691_10001476 3300025940 Bacteria 23467
180 Ga0207689_10028163 3300025942 Bacteria 4699
181 Ga0207661_10097676 3300025944 Bacteria 2460
182 Ga0207679_10002786 3300025945 Bacteria 10825
183 Ga0207667_10021071 3300025949 Bacteria 7229
184 Ga0207651_10042228 3300025960 Bacteria 3033
185 Ga0207712_10026613 3300025961 Bacteria 3856
186 Ga0207712_10080702 3300025961 Bacteria 2367
187 Ga0207668_10001914 3300025972 Bacteria 12185
188 Ga0207668_10313639 3300025972 Bacteria 1299
189 Ga0207640_10003860 3300025981 Bacteria 8088
190 Ga0207677_10180688 3300026023 Bacteria 1659
191 Ga0207703_10009848 3300026035 Bacteria 7497
192 Ga0207639_10031502 3300026041 Bacteria 3898
193 Ga0207678_10000863 3300026067 Bacteria 27780
194 Ga0207708_10006714 3300026075 Bacteria 8512
195 Ga0207702_10451382 3300026078 Bacteria 1247
196 Ga0207702_10455298 3300026078 Bacteria 1242
197 Ga0207641_10005996 3300026088 Bacteria 10298
198 Ga0207648_10017313 3300026089 Bacteria 6563
199 Ga0207676_10003058 3300026095 Bacteria 11930
200 Ga0207674_10004164 3300026116 Bacteria 17494
201 Ga0207675_100001807 3300026118 Bacteria 21435
202 Ga0207683_10001463 3300026121 Bacteria 21295
203 Ga0207698_10068220 3300026142 Bacteria 2807
204 Ga0209974_10004404 3300027876 Bacteria 5008
205 Ga0207428_10058093 3300027907 Bacteria 3071
206 Ga0268266_10037956 3300028379 Bacteria 4102
207 Ga0268265_10010665 3300028380 Bacteria 6206
208 Ga0268264_10005536 3300028381 Bacteria 10709
209 Ga0265313_10245818 3300031595 Bacteria 731
210 Ga0307405_10458634 3300031731 Bacteria 1012
211 Ga0316580_10007313 3300032139 Bacteria 3285
212 Ga0373958_0002245 3300034819 Bacteria 2689
213 Ga0373929_0028682 3300035085 Bacteria 1177
214 Ga0373944_0000420 3300035089 Bacteria 9692
215 Ga0373949_0005045 3300035090 Bacteria 2972
216 Ga0373932_0024676 3300035112 Bacteria 1620
217 Ga0373936_0007712 3300035113 Bacteria 4042
218 Ga0373939_0006129 3300035114 Bacteria 2890
219 Ga0373941_0007489 3300035115 Bacteria 2672
220 Ga0373945_0009042 3300035116 Bacteria 3256
221 Ga0373945_0025636 3300035116 Bacteria 2049
222 Ga0373960_0006516 3300035121 Bacteria 2742
223 Ga0373943_0000132 3300035170 Bacteria 28317
224 Ga0373943_0004964 3300035170 Bacteria 6007
225 Ga0373943_0088678 3300035170 Bacteria 1599
226 Ga0373943_0194146 3300035170 Bacteria 1121
227 Ga0373946_0000910 3300035171 Bacteria 10160
228 Ga0373946_0010812 3300035171 Bacteria 3390
229 Ga0373955_0479932 3300035172 Bacteria 759
230 Ga0373942_0006337 3300035207 Bacteria 2733
231 Ga0373961_0027034 3300035241 Bacteria 1572
232 Ga0373962_0065526 3300035242 Bacteria 1075
233 Ga0373931_0001281 3300035691 Bacteria 10733
234 Ga0373931_0064993 3300035691 Bacteria 1976
235 Ga0373935_0029932 3300035692 Bacteria 3371
236 Ga0373927_0004911 3300035695 Bacteria 9282
237 Ga0373927_0048199 3300035695 Bacteria 2755
238 Ga0373947_0000777 3300035725 Bacteria 19156
239 Ga0373937_0217891 3300036401 Bacteria 1796
240 Ga0373925_0000706 3300037068 Bacteria 31254
241 Ga0373925_0022563 3300037068 Bacteria 4592
242 Ga0395900_0004974 3300037418 Bacteria 13976
243 Ga0395898_0072076 3300037466 Bacteria 3338
244 Ga0395905_0006126 3300037471 Bacteria 12144
245 Ga0395905_0588226 3300037471 Bacteria 1015
246 Ga0436364_1309468 3300037853 Bacteria 1369
247 Ga0395901_0007812 3300038443 Bacteria 10794
248 Ga0395901_0151352 3300038443 Bacteria 2438
249 Ga0237819_04623 3300038705 Bacteria 2245
250 Ga0400483_277465 3300039062 Bacteria 1119
251 Ga0436365_0493281 3300039437 Bacteria 3369
252 Ga0436361_1090566 3300039447 Bacteria 577
253 Ga0436362_0503844 3300039453 Bacteria 1314
254 Ga0451833_0447625 3300041491 Bacteria 1269
255 Ga0466965_0025300 3300044683 Bacteria 2873
256 Ga0466965_0390288 3300044683 Bacteria 768
257 Ga0453684_0000077 3300044712 Bacteria 435536
258 Ga0453684_0009982 3300044712 Bacteria 16365
259 Ga0453684_0022246 3300044712 Bacteria 9421
260 Ga0451576_0003688 3300045051 Bacteria 20773
261 Ga0466958_0140319 3300045836 Bacteria 1521
262 Ga0495592_0076783 3300046454 Bacteria 2423
263 Ga0495653_0006981 3300046463 Bacteria 9271
264 Ga0495639_0018973 3300046475 Bacteria 2999
265 Ga0495662_0000849 3300046476 Bacteria 14884
266 Ga0495662_0282826 3300046476 Bacteria 816
267 Ga0495664_0000887 3300046477 Bacteria 15386
268 Ga0495618_0084605 3300046514 Bacteria 2026
269 Ga0495630_0000853 3300046517 Bacteria 21461
270 Ga0495630_0012706 3300046517 Bacteria 6118
271 Ga0495648_0015822 3300046524 Bacteria 5453
272 Ga0495666_0018987 3300046526 Bacteria 3415
273 Ga0495665_0009066 3300046531 Bacteria 5396
274 Ga0495665_0174688 3300046531 Bacteria 1117
275 Ga0495640_0018791 3300046533 Bacteria 5115
276 Ga0495640_0067059 3300046533 Bacteria 2418
277 Ga0495586_0008127 3300046535 Bacteria 5595
278 Ga0495645_0135297 3300046543 Bacteria 1724
279 Ga0495634_0004645 3300046642 Bacteria 10700
280 Ga0495634_0034042 3300046642 Bacteria 3497
281 Ga0495635_0012783 3300046663 Bacteria 5879
282 Ga0495635_0028647 3300046663 Bacteria 3871
283 Ga0495657_0453335 3300046675 Bacteria 751
284 Ga0495624_0006377 3300046690 Bacteria 8371
285 Ga0495624_0011573 3300046690 Bacteria 6061
286 Ga0495600_0063097 3300046809 Bacteria 2421
287 Ga0495581_0128878 3300047315 Bacteria 1474
288 Ga0495604_0233134 3300047317 Bacteria 1262
289 Ga0495674_0002470 3300047319 Bacteria 18051
290 Ga0495674_0057827 3300047319 Bacteria 3393
291 Ga0495683_0000282 3300047323 Bacteria 43998
292 Ga0495684_0000264 3300047471 Bacteria 41677
293 Ga0495684_0015152 3300047471 Bacteria 5936
294 Ga0495593_0031687 3300047673 Bacteria 2886
295 Ga0496100_0074959 3300048903 Bacteria 2268
296 Ga0496100_0097654 3300048903 Bacteria 2017
297 Ga0496100_0496755 3300048903 Bacteria 940
298 Ga0496101_0102313 3300048904 Bacteria 2145
299 Ga0496102_0009225 3300048905 Bacteria 8467
300 Ga0496102_0070040 3300048905 Bacteria 3220
301 Ga0496104_0004168 3300048907 Bacteria 12547
302 Ga0496104_0092397 3300048907 Bacteria 2893
303 Ga0496104_0381699 3300048907 Bacteria 1322
304 Ga0496104_0501128 3300048907 Bacteria 1125
305 Ga0496104_0648244 3300048907 Bacteria 965
306 Ga0496105_0000139 3300048908 Bacteria 48427
307 Ga0496105_0039966 3300048908 Bacteria 3867
308 Ga0496105_0067778 3300048908 Bacteria 2947
309 Ga0496106_0354122 3300048909 Bacteria 1179
310 Ga0496107_0002549 3300048910 Bacteria 11874
311 Ga0496107_0202858 3300048910 Bacteria 1474
312 Ga0496108_0005824 3300048911 Bacteria 9989
313 Ga0496108_0018618 3300048911 Bacteria 5689
314 Ga0496108_0290096 3300048911 Bacteria 1424
315 Ga0496109_0003037 3300048912 Bacteria 13994
316 Ga0496109_0104143 3300048912 Bacteria 2634
317 Ga0496109_0296132 3300048912 Bacteria 1525
318 Ga0496110_0014960 3300048913 Bacteria 6450
319 Ga0496110_0027025 3300048913 Bacteria 4916
320 Ga0496110_0231700 3300048913 Bacteria 1680
321 Ga0496111_0011145 3300048914 Bacteria 6052
322 Ga0496111_0086355 3300048914 Bacteria 2295
323 Ga0496111_0087668 3300048914 Bacteria 2278
324 Ga0496112_0035679 3300048915 Bacteria 4846
325 Ga0496112_0388235 3300048915 Bacteria 1336
326 Ga0496113_0008269 3300048916 Bacteria 6767
327 Ga0496113_0015825 3300048916 Bacteria 5197
328 Ga0496114_0006386 3300048917 Bacteria 9281
329 Ga0496114_0083061 3300048917 Bacteria 2709
330 Ga0496115_0000902 3300048918 Bacteria 21551
331 Ga0496115_0094992 3300048918 Bacteria 2440
332 Ga0496115_0345668 3300048918 Bacteria 1214
333 Ga0496121_0027929 3300048924 Bacteria 5269
334 Ga0496122_0038251 3300048925 Bacteria 3848
335 Ga0496124_0021763 3300048927 Bacteria 5899
336 Ga0496125_0000040 3300048928 Bacteria 314478
337 Ga0496126_0813693 3300048929 Bacteria 716
338 Ga0501310_000063 3300049130 Bacteria 9924
339 Ga0501034_0021481 3300049571 Bacteria 6579
340 Ga0501034_0815974 3300049571 Bacteria 825
341 Ga0501036_0876001 3300049572 Bacteria 738
342 Ga0501038_0379408 3300049574 Bacteria 1097
343 Ga0501040_0174959 3300049576 Bacteria 1521
344 Ga0501043_0667285 3300049579 Bacteria 762
345 Ga0501046_0043550 3300049580 Bacteria 3574
346 Ga0501067_0036411 3300049583 Bacteria 2732
347 Ga0501068_0415585 3300049584 Bacteria 868
348 Ga0501075_0083150 3300049591 Bacteria 2425
349 Ga0501075_0642863 3300049591 Bacteria 809
350 Ga0501075_0876543 3300049591 Bacteria 683
351 Ga0501076_0064280 3300049592 Bacteria 2924
352 Ga0501079_0076402 3300049741 Bacteria 2591
353 Ga0501081_0225113 3300049743 Bacteria 1365
354 nmdc:mga0yw44_2155_c1 3300050492 Bacteria 8263
355 nmdc:mga0yw44_669542_c1 3300050492 Bacteria 705
356 nmdc:mga0k408_34777_c1 3300050493 Bacteria 2886
357 nmdc:mga06z11_28968_c1 3300050494 Bacteria 2663
358 nmdc:mga06z11_45236_c1 3300050494 Bacteria 2225
359 nmdc:mga04h51_124702_c1 3300050495 Bacteria 963
360 nmdc:mga05p37_67997_c1 3300050507 Bacteria 4382
361 nmdc:mga06r32_24791_c1 3300050510 Bacteria 5574
362 nmdc:mga0rr50_8159_c1 3300050513 Bacteria 6501
363 nmdc:mga08x19_22872_c1 3300050514 Bacteria 3875
364 nmdc:mga0a205_204580_c1 3300050515 Bacteria 1864
365 Ga0495601_0008352 3300053077 Bacteria 6116
366 Ga0495612_0001350 3300053078 Bacteria 10113
367 Ga0495655_0258649 3300053083 Bacteria 587
368 Ga0495595_0050530 3300053084 Bacteria 1926
369 Ga0495619_0077756 3300053085 Bacteria 2229
370 Ga0495619_0090373 3300053085 Bacteria 2073
371 Ga0495619_0134819 3300053085 Bacteria 1698
372 Ga0500591_076694 3300053115 Bacteria 1499
373 Ga0530510_0109833 3300061734 Bacteria 2019
374 2671833703 2671180195 Bacteria 9757215
375 2686540160 2684623035 Bacteria 8032739
376 2774851859 2773857922 Bacteria 9757215
377 2776259571 2775506901 Bacteria 9631051
378 2895885428 2895880812 Bacteria 11255272
379 2919714188 2919713450 Bacteria 7431245
380 2996340901 2996336353 Bacteria 5511628
381 Ga0495628_0374098
382 JGI24743J22301_10050853
383 JGI24735J21928_10021852
384 JGI24750J21931_1001571
385 JGI24738J21930_10019288
386 JGI24742J22300_10036100
387 JGI24751J29686_10020087
388 Ga0070658_10000503
389 Ga0070676_10003336
390 Ga0070683_100075565
391 Ga0070690_100000707
392 Ga0070670_100003181
393 Ga0070670_100200437
394 Ga0068869_100008488
395 Ga0070666_10006839
396 Ga0070680_100009490
397 Ga0070682_100002463
398 Ga0070660_100000470
399 Ga0070689_100001190
400 Ga0070691_10000513
401 Ga0070687_100003935
402 Ga0070661_100001065
403 Ga0070692_10000633
404 Ga0070668_100000473
405 Ga0070668_100313539
406 Ga0070669_100000673
407 Ga0070675_100001198
408 Ga0070671_100003806
409 Ga0070671_100415991
410 Ga0070674_100003588
411 Ga0070673_100001395
412 Ga0070688_100002647
413 Ga0070659_100032422
414 Ga0070667_100001078
415 Ga0070703_10003428
416 Ga0070709_10001042
417 Ga0070714_100006532
418 Ga0070713_100018107
419 Ga0070710_10006336
420 Ga0070711_100005900
421 Ga0070711_100093748
422 Ga0070705_100000456
423 Ga0070700_100000351
424 Ga0070694_100001206
425 Ga0070708_100229153
426 Ga0070663_100000509
427 Ga0070678_100016089
428 Ga0070662_100001211
429 Ga0070681_10348482
430 Ga0068867_100081639
431 Ga0070706_100069641
432 Ga0070698_100381941
433 Ga0070699_100213070
434 Ga0070679_100021478
435 Ga0070684_100078829
436 Ga0070697_100022224
437 Ga0068853_100009339
438 Ga0070672_100003875
439 Ga0070686_100001920
440 Ga0070695_100000490
441 Ga0070696_100002589
442 Ga0070696_100417793
443 Ga0070693_100000324
444 Ga0070665_100088687
445 Ga0070704_100000204
446 Ga0068855_100009596
447 Ga0068855_100064090
448 Ga0070664_100001010
449 Ga0068857_100005251
450 Ga0068854_100001153
451 Ga0068856_100027619
452 Ga0068856_100802143
453 Ga0070702_100000297
454 Ga0068852_100032180
455 Ga0068859_100001497
456 Ga0068864_100002196
457 Ga0068861_100000388
458 Ga0068863_100035194
459 Ga0068858_100002039
460 Ga0068860_100005176
461 Ga0068862_100001181
462 Ga0081455_10238786
463 Ga0081455_10605604
464 Ga0075365_10170276
465 Ga0075365_10360141
466 Ga0075368_10014246
467 Ga0075368_10184727
468 Ga0070715_10002759
469 Ga0070716_100000413
470 Ga0070712_100000330
471 Ga0075367_10355010
472 Ga0075367_10404447
473 Ga0075366_10040683
474 Ga0068871_100082916
475 Ga0075428_100102516
476 Ga0075428_100159468
477 Ga0075431_100121820
478 Ga0075434_100158608
479 Ga0075429_100032823
480 Ga0068865_100004158
481 Ga0097620_100001497
482 Ga0075435_100031063
483 Ga0105240_10056739
484 Ga0105240_10182765
485 Ga0111539_10205364
486 Ga0105245_10004386
487 Ga0105245_10219987
488 Ga0105247_10000735
489 Ga0114129_10362286
490 Ga0105243_10001060
491 Ga0105241_10001136
492 Ga0105242_10006408
493 Ga0105248_10003525
494 Ga0105237_10002772
495 Ga0105237_10108319
496 Ga0105249_10001022
497 Ga0105239_10007393
498 Ga0105246_10003303
499 Ga0105246_10067930
500 Ga0157373_10035885
501 Ga0157371_10045768
502 Ga0157369_10006575
503 Ga0157374_10007909
504 Ga0157378_10001697
505 Ga0157372_10024590
506 Ga0157375_10001908
507 Ga0163163_10004831
508 Ga0157380_10025771
509 Ga0157380_10037180
510 Ga0157380_10107252
511 Ga0157377_10008062
512 Ga0157379_10002720
513 Ga0157376_10000963
514 Ga0163161_10001664
515 Ga0206353_10377187
516 Ga0213876_10092751
517 Ga0209130_1000449
518 Ga0209256_1000109
519 Ga0207653_10014217
520 Ga0207692_10022303
521 Ga0207692_10455907
522 Ga0207642_10000714
523 Ga0207710_10001385
524 Ga0207688_10001407
525 Ga0207680_10010267
526 Ga0207647_10202024
527 Ga0207685_10000242
528 Ga0207699_10024009
529 Ga0207699_10387916
530 Ga0207645_10009306
531 Ga0207705_10001861
532 Ga0207684_10325275
533 Ga0207654_10001705
534 Ga0207707_10399937
535 Ga0207671_10015254
536 Ga0207693_10000646
537 Ga0207663_10001337
538 Ga0207663_10092392
539 Ga0207662_10004799
540 Ga0207657_10001652
541 Ga0207649_10003301
542 Ga0207652_10063747
543 Ga0207650_10004026
544 Ga0207687_10013808
545 Ga0207687_10359119
546 Ga0207687_10884356
547 Ga0207700_10012966
548 Ga0207664_10013806
549 Ga0207664_10018580
550 Ga0207690_10000954
551 Ga0207706_10000959
552 Ga0207686_10015152
553 Ga0207709_10007357
554 Ga0207669_10011656
555 Ga0207704_10007279
556 Ga0207704_10060354
557 Ga0207665_10000220
558 Ga0207665_10036140
559 Ga0207691_10001476
560 Ga0207689_10028163
561 Ga0207661_10097676
562 Ga0207679_10002786
563 Ga0207667_10021071
564 Ga0207651_10042228
565 Ga0207712_10026613
566 Ga0207712_10080702
567 Ga0207668_10001914
568 Ga0207668_10313639
569 Ga0207640_10003860
570 Ga0207677_10180688
571 Ga0207703_10009848
572 Ga0207639_10031502
573 Ga0207678_10000863
574 Ga0207708_10006714
575 Ga0207702_10451382
576 Ga0207702_10455298
577 Ga0207641_10005996
578 Ga0207648_10017313
579 Ga0207676_10003058
580 Ga0207674_10004164
581 Ga0207675_100001807
582 Ga0207683_10001463
583 Ga0207698_10068220
584 Ga0209974_10004404
585 Ga0207428_10058093
586 Ga0268266_10037956
587 Ga0268265_10010665
588 Ga0268264_10005536
589 Ga0265313_10245818
590 Ga0307405_10458634
591 Ga0316580_10007313
592 Ga0373958_0002245
593 Ga0373929_0028682
594 Ga0373944_0000420
595 Ga0373949_0005045
596 Ga0373932_0024676
597 Ga0373936_0007712
598 Ga0373939_0006129
599 Ga0373941_0007489
600 Ga0373945_0009042
601 Ga0373945_0025636
602 Ga0373960_0006516
603 Ga0373943_0000132
604 Ga0373943_0004964
605 Ga0373943_0088678
606 Ga0373943_0194146
607 Ga0373946_0000910
608 Ga0373946_0010812
609 Ga0373955_0479932
610 Ga0373942_0006337
611 Ga0373961_0027034
612 Ga0373962_0065526
613 Ga0373931_0001281
614 Ga0373931_0064993
615 Ga0373935_0029932
616 Ga0373927_0004911
617 Ga0373927_0048199
618 Ga0373947_0000777
619 Ga0373937_0217891
620 Ga0373925_0000706
621 Ga0373925_0022563
622 Ga0395900_0004974
623 Ga0395898_0072076
624 Ga0395905_0006126
625 Ga0395905_0588226
626 Ga0436364_1309468
627 Ga0395901_0007812
628 Ga0395901_0151352
629 Ga0237819_04623
630 Ga0400483_277465
631 Ga0436365_0493281
632 Ga0436361_1090566
633 Ga0436362_0503844
634 Ga0451833_0447625
635 Ga0466965_0025300
636 Ga0466965_0390288
637 Ga0453684_0000077
638 Ga0453684_0009982
639 Ga0453684_0022246
640 Ga0451576_0003688
641 Ga0466958_0140319
642 Ga0495592_0076783
643 Ga0495653_0006981
644 Ga0495639_0018973
645 Ga0495662_0000849
646 Ga0495662_0282826
647 Ga0495664_0000887
648 Ga0495618_0084605
649 Ga0495630_0000853
650 Ga0495630_0012706
651 Ga0495648_0015822
652 Ga0495666_0018987
653 Ga0495665_0009066
654 Ga0495665_0174688
655 Ga0495640_0018791
656 Ga0495640_0067059
657 Ga0495586_0008127
658 Ga0495645_0135297
659 Ga0495634_0004645
660 Ga0495634_0034042
661 Ga0495635_0012783
662 Ga0495635_0028647
663 Ga0495657_0453335
664 Ga0495624_0006377
665 Ga0495624_0011573
666 Ga0495600_0063097
667 Ga0495581_0128878
668 Ga0495604_0233134
669 Ga0495674_0002470
670 Ga0495674_0057827
671 Ga0495683_0000282
672 Ga0495684_0000264
673 Ga0495684_0015152
674 Ga0495593_0031687
675 Ga0496100_0074959
676 Ga0496100_0097654
677 Ga0496100_0496755
678 Ga0496101_0102313
679 Ga0496102_0009225
680 Ga0496102_0070040
681 Ga0496104_0004168
682 Ga0496104_0092397
683 Ga0496104_0381699
684 Ga0496104_0501128
685 Ga0496104_0648244
686 Ga0496105_0000139
687 Ga0496105_0039966
688 Ga0496105_0067778
689 Ga0496106_0354122
690 Ga0496107_0002549
691 Ga0496107_0202858
692 Ga0496108_0005824
693 Ga0496108_0018618
694 Ga0496108_0290096
695 Ga0496109_0003037
696 Ga0496109_0104143
697 Ga0496109_0296132
698 Ga0496110_0014960
699 Ga0496110_0027025
700 Ga0496110_0231700
701 Ga0496111_0011145
702 Ga0496111_0086355
703 Ga0496111_0087668
704 Ga0496112_0035679
705 Ga0496112_0388235
706 Ga0496113_0008269
707 Ga0496113_0015825
708 Ga0496114_0006386
709 Ga0496114_0083061
710 Ga0496115_0000902
711 Ga0496115_0094992
712 Ga0496115_0345668
713 Ga0496121_0027929
714 Ga0496122_0038251
715 Ga0496124_0021763
716 Ga0496125_0000040
717 Ga0496126_0813693
718 Ga0501310_000063
719 Ga0501034_0021481
720 Ga0501034_0815974
721 Ga0501036_0876001
722 Ga0501038_0379408
723 Ga0501040_0174959
724 Ga0501043_0667285
725 Ga0501046_0043550
726 Ga0501067_0036411
727 Ga0501068_0415585
728 Ga0501075_0083150
729 Ga0501075_0642863
730 Ga0501075_0876543
731 Ga0501076_0064280
732 Ga0501079_0076402
733 Ga0501081_0225113
734 nmdc:mga0yw44_2155_c1
735 nmdc:mga0yw44_669542_c1
736 nmdc:mga0k408_34777_c1
737 nmdc:mga06z11_28968_c1
738 nmdc:mga06z11_45236_c1
739 nmdc:mga04h51_124702_c1
740 nmdc:mga05p37_67997_c1
741 nmdc:mga06r32_24791_c1
742 nmdc:mga0rr50_8159_c1
743 nmdc:mga08x19_22872_c1
744 nmdc:mga0a205_204580_c1
745 Ga0495601_0008352
746 Ga0495612_0001350
747 Ga0495655_0258649
748 Ga0495595_0050530
749 Ga0495619_0077756
750 Ga0495619_0090373
751 Ga0495619_0134819
752 Ga0500591_076694
753 Ga0530510_0109833
754 2671833703
755 2686540160
756 2774851859
757 2776259571
758 2895885428
759 2919714188
760 2996340901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02570

CbiC

Precorrin-8X methylmutase

49

238

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f2v-assembly1.cif.gz_A crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis 0.9885 3 210
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9882 4 207
5n0g-assembly1.cif.gz_A-2 crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba 0.9865 4 207
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9855 6 207
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9807 6 207
ID Description Score Start End Superfamily
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9863 6 209 3.40.50.10230
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9815 6 209 3.40.50.10230
2afvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9299 7 206 3.40.50.10230
1ou0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9127 15 206 3.40.50.10230
af_Q58340_4_210_3.40.50.10230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9087 6 205 3.40.50.10230
ID Description Score Start End GO Terms
AF-A0A259BLJ3-F1-model_v4 Precorrin-8X methylmutase 1.001 55 210 GO:0009236
GO:0016993
AF-A0A6G3TPJ4-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 1.001 121 208 GO:0009236
GO:0016993
AF-A0A258JX74-F1-model_v4 Precorrin-8X methylmutase 0.9989 42 210 GO:0009236
GO:0016993
AF-A0A1M6YI70-F1-model_v4 Precorrin-8X methylmutase 0.9976 4 207 GO:0009236
GO:0016993
AF-A0A6G3X8A9-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 0.9972 62 182 GO:0009236
GO:0016993

Map