F428755

General Info

Members Datasets Scaffolds Average Seq Length
380 313 760 249

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0024025|Ga0466959_0024025_2813_3556
Length 241
Sequence MNAVVTGGSSGLGLGLVEALVSRGAKVTVVARNRDALDTVRARLGVATVSADVTDAGAAHRVLSETRPDLLVLNAGVKPPMGRLDKIGWDDFSAAWQTDVKAGFHWLQAALRLPLKRGSRVLVGSSGAALNGSPLSGGYAGAKRTLWIMAKYANNVSQQADLGIRFQVIVPQQMVAGTGVGEAGAMGVSKDEFLARFGAPMPPRDFGEKVVSVLVDPKFAGGVAFGLKGDTGITILEEAAA

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
221 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
222 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
223 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
224 2512875024
225 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
226 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
227 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
228 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
229 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
230 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
231 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
232 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
233 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
234 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
235 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
236 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
237 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
238 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
239 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
240 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
241 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
242 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
243 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
244 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
245 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
246 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
247 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
248 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
249 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
250 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
251 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
252 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
253 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
254 2904456579 Variovorax sp. 2002 Isolate Unclassified
255 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
256 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
257 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
258 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
259 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
260 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
261 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
262 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
263 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
264 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
265 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
266 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
267 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
268 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
269 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
270 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
271 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
272 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
273 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
274 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
275 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
276 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
277 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
278 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
279 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
280 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
281 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
282 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
283 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
284 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
285 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
286 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
287 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
288 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
289 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
290 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
291 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
292 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
293 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
294 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
295 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
296 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
297 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
298 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
299 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
300 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
301 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
302 3004167301 Mesorhizobium loti 582 Isolate Unclassified
303 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
304 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
305 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
306 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
307 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
308 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
309 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
310 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
311 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
312 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
313 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0.26
Isolates 24.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 20.79
Rhizoplane 6.32
Rhizosphere 59.21
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0024025 3300045049 Bacteria 4513
2 JGI25157J39369_1000447 3300002741 Bacteria 26448
3 rootH2_10283342 3300003320 Bacteria 1967
4 Ga0006562J51391_1100254 3300003578 Bacteria 6274
5 JGI25404J52841_10000708 3300003659 Bacteria 5159
6 Ga0055540_1000625 3300003792 Bacteria 25161
7 Ga0065704_10116509 3300005289 Bacteria 1852
8 Ga0070658_10078247 3300005327 Bacteria 2714
9 Ga0070683_100007317 3300005329 Bacteria 9320
10 Ga0070690_100329698 3300005330 Bacteria 1102
11 Ga0068869_100011919 3300005334 Bacteria 5720
12 Ga0070680_100012257 3300005336 Bacteria 6658
13 Ga0070680_100088736 3300005336 Bacteria 2558
14 Ga0070660_100225391 3300005339 Bacteria 1524
15 Ga0070660_100629693 3300005339 Unclassified 898
16 Ga0070691_10020480 3300005341 Bacteria 3056
17 Ga0070692_10061967 3300005345 Bacteria 1973
18 Ga0070675_100217182 3300005354 Bacteria 1664
19 Ga0070703_10043583 3300005406 Bacteria 1407
20 Ga0070714_100102112 3300005435 Bacteria 2528
21 Ga0070714_100692741 3300005435 Bacteria 983
22 Ga0070713_100130459 3300005436 Bacteria 2216
23 Ga0070710_10271842 3300005437 Bacteria 1096
24 Ga0070701_10023760 3300005438 Unclassified 2957
25 Ga0070711_100301727 3300005439 Bacteria 1274
26 Ga0070708_100488254 3300005445 Bacteria 1162
27 Ga0070663_100089297 3300005455 Bacteria 2280
28 Ga0070681_10037601 3300005458 Bacteria 4856
29 Ga0070681_10379758 3300005458 Bacteria 1324
30 Ga0070685_10446110 3300005466 Bacteria 905
31 Ga0070706_100801625 3300005467 Bacteria 872
32 Ga0070707_100022553 3300005468 Bacteria 5953
33 Ga0070698_100007369 3300005471 Bacteria 11909
34 Ga0070698_100057384 3300005471 Bacteria 3940
35 Ga0070699_100107346 3300005518 Bacteria 2449
36 Ga0070679_100013683 3300005530 Bacteria 7770
37 Ga0070697_100003278 3300005536 Bacteria 12430
38 Ga0068853_100054219 3300005539 Bacteria 3455
39 Ga0070686_100471951 3300005544 Bacteria 968
40 Ga0070695_100005273 3300005545 Bacteria 7611
41 Ga0070696_100002384 3300005546 Bacteria 12429
42 Ga0070696_100139979 3300005546 Bacteria 1768
43 Ga0070693_100020247 3300005547 Bacteria 3505
44 Ga0070665_100174031 3300005548 Bacteria 2153
45 Ga0068855_100010142 3300005563 Bacteria 11353
46 Ga0068857_100018531 3300005577 Bacteria 6106
47 Ga0068856_100301479 3300005614 Bacteria 1620
48 Ga0068856_100616206 3300005614 Bacteria 1106
49 Ga0068864_100239284 3300005618 Bacteria 1681
50 Ga0068864_100321115 3300005618 Bacteria 1454
51 Ga0068861_100352516 3300005719 Bacteria 1291
52 Ga0068851_10160656 3300005834 Bacteria 1234
53 Ga0068870_10063280 3300005840 Bacteria 1995
54 Ga0068858_100146902 3300005842 Bacteria 2215
55 Ga0068860_100105064 3300005843 Bacteria 2697
56 Ga0068862_100004543 3300005844 Bacteria 11698
57 Ga0081540_1000015 3300005983 Bacteria 178704
58 Ga0075363_100027917 3300006048 Bacteria 2898
59 Ga0075363_100239865 3300006048 Bacteria 1042
60 Ga0075364_10048569 3300006051 Bacteria 2765
61 Ga0070716_100247941 3300006173 Bacteria 1211
62 Ga0070712_100178383 3300006175 Bacteria 1653
63 Ga0070712_100509324 3300006175 Bacteria 1010
64 Ga0075362_10015002 3300006177 Bacteria 3142
65 Ga0075366_10046507 3300006195 Bacteria 2571
66 Ga0097621_100025734 3300006237 Bacteria 4607
67 Ga0075370_10045234 3300006353 Bacteria 2489
68 Ga0068871_100009415 3300006358 Bacteria 7076
69 Ga0075436_100124029 3300006914 Bacteria 1809
70 Ga0075435_100070375 3300007076 Bacteria 2855
71 Ga0099794_10010520 3300007265 Bacteria 3931
72 Ga0099795_10004364 3300007788 Bacteria 3640
73 Ga0099795_10017276 3300007788 Bacteria 2298
74 Ga0099795_10017346 3300007788 Bacteria 2294
75 Ga0099795_10057266 3300007788 Bacteria 1436
76 Ga0099795_10059946 3300007788 Bacteria 1409
77 Ga0099795_10069192 3300007788 Bacteria 1328
78 Ga0105240_10003911 3300009093 Bacteria 23011
79 Ga0105240_10101701 3300009093 Bacteria 3495
80 Ga0105240_10229086 3300009093 Bacteria 2161
81 Ga0105247_10042421 3300009101 Bacteria 2787
82 Ga0114129_10250295 3300009147 Bacteria 2379
83 Ga0105243_10194791 3300009148 Bacteria 1773
84 Ga0105243_10247724 3300009148 Bacteria 1589
85 Ga0105248_10010141 3300009177 Bacteria 10379
86 Ga0105237_10032105 3300009545 Bacteria 5317
87 Ga0105237_10035214 3300009545 Bacteria 5067
88 Ga0105237_10225980 3300009545 Bacteria 1872
89 Ga0105238_10000652 3300009551 Bacteria 36418
90 Ga0105238_10011692 3300009551 Bacteria 8848
91 Ga0105238_10351981 3300009551 Bacteria 1462
92 Ga0099796_10004111 3300010159 Bacteria 3478
93 Ga0099796_10009328 3300010159 Bacteria 2653
94 Ga0099796_10012057 3300010159 Unclassified 2429
95 Ga0099796_10017901 3300010159 Bacteria 2118
96 Ga0099796_10038185 3300010159 Bacteria 1610
97 Ga0099796_10090366 3300010159 Bacteria 1137
98 Ga0105239_10006979 3300010375 Bacteria 13013
99 Ga0105239_10193571 3300010375 Bacteria 2276
100 Ga0105239_10236065 3300010375 Bacteria 2052
101 Ga0105239_10382050 3300010375 Bacteria 1592
102 Ga0105239_10499571 3300010375 Bacteria 1383
103 Ga0105246_10040227 3300011119 Bacteria 3154
104 Ga0157373_10198807 3300013100 Bacteria 1413
105 Ga0157370_10031127 3300013104 Bacteria 5222
106 Ga0157369_10191135 3300013105 Bacteria 2151
107 Ga0157374_10172479 3300013296 Bacteria 2110
108 Ga0163162_10244536 3300013306 Bacteria 1926
109 Ga0157380_10163874 3300014326 Bacteria 1935
110 Ga0182008_10000711 3300014497 Bacteria 23842
111 Ga0182008_10010121 3300014497 Bacteria 5057
112 Ga0157379_10202222 3300014968 Bacteria 1796
113 Ga0157379_10232640 3300014968 Bacteria 1671
114 Ga0157376_10016887 3300014969 Bacteria 5553
115 Ga0157376_10098302 3300014969 Bacteria 2551
116 Ga0182006_1000964 3300015261 Bacteria 19073
117 Ga0182007_10027390 3300015262 Bacteria 1965
118 Ga0213872_10024857 3300021361 Bacteria 2755
119 Ga0224572_1025037 3300024225 Bacteria 1146
120 Ga0209646_1015908 3300025246 Bacteria 1120
121 Ga0209026_1000002 3300025250 Bacteria 1136158
122 Ga0209759_1000381 3300025256 Bacteria 55381
123 Ga0209758_1070556 3300025297 Bacteria 1101
124 Ga0209051_1000271 3300025303 Bacteria 86541
125 Ga0207653_10027801 3300025885 Bacteria 1816
126 Ga0207692_10052010 3300025898 Bacteria 2079
127 Ga0207684_10461453 3300025910 Bacteria 1090
128 Ga0207707_10052202 3300025912 Bacteria 3561
129 Ga0207707_10122118 3300025912 Bacteria 2277
130 Ga0207695_10007545 3300025913 Bacteria 13789
131 Ga0207695_10445073 3300025913 Bacteria 1179
132 Ga0207671_10008171 3300025914 Bacteria 8927
133 Ga0207671_10245466 3300025914 Bacteria 1407
134 Ga0207693_10023873 3300025915 Bacteria 4854
135 Ga0207693_10063659 3300025915 Bacteria 2889
136 Ga0207663_10271101 3300025916 Bacteria 1257
137 Ga0207660_10035005 3300025917 Bacteria 3484
138 Ga0207660_10043725 3300025917 Bacteria 3148
139 Ga0207662_10013851 3300025918 Bacteria 4514
140 Ga0207652_10054490 3300025921 Bacteria 3438
141 Ga0207646_10011491 3300025922 Bacteria 8570
142 Ga0207646_10103923 3300025922 Bacteria 2548
143 Ga0207694_10007507 3300025924 Bacteria 8266
144 Ga0207659_10118219 3300025926 Bacteria 2027
145 Ga0207664_10018250 3300025929 Bacteria 5159
146 Ga0207706_10080803 3300025933 Bacteria 2858
147 Ga0207665_10044662 3300025939 Bacteria 2965
148 Ga0207711_10050206 3300025941 Bacteria 3571
149 Ga0207689_10280821 3300025942 Bacteria 1379
150 Ga0207661_10068789 3300025944 Bacteria 2885
151 Ga0207667_10010882 3300025949 Bacteria 10609
152 Ga0207712_10000090 3300025961 Bacteria 104492
153 Ga0207703_10143042 3300026035 Bacteria 2078
154 Ga0207639_10089841 3300026041 Bacteria 2455
155 Ga0207639_10184101 3300026041 Bacteria 1779
156 Ga0207702_10164048 3300026078 Bacteria 2031
157 Ga0268266_10007036 3300028379 Bacteria 10213
158 Ga0268266_10016285 3300028379 Bacteria 6355
159 Ga0268265_10000937 3300028380 Bacteria 26824
160 Ga0268264_10054199 3300028381 Bacteria 3348
161 Ga0265334_10003965 3300028573 Bacteria 6660
162 Ga0265318_10053639 3300028577 Bacteria 1511
163 Ga0265323_10000311 3300028653 Bacteria 28078
164 Ga0265322_10007713 3300028654 Bacteria 3138
165 Ga0265336_10000074 3300028666 Bacteria 82727
166 Ga0265338_10000137 3300028800 Bacteria 135705
167 Ga0265324_10003671 3300029957 Bacteria 7199
168 Ga0265339_10096334 3300031249 Bacteria 1545
169 Ga0307508_10051236 3300031616 Bacteria 3670
170 Ga0307514_10054745 3300031649 Bacteria 3071
171 Ga0265314_10019587 3300031711 Bacteria 5240
172 Ga0265342_10014254 3300031712 Bacteria 5284
173 Ga0307413_10409922 3300031824 Bacteria 1064
174 Ga0307414_10071289 3300032004 Bacteria 2506
175 Ga0307510_10000666 3300033180 Bacteria 35011
176 Ga0373923_0079060 3300035111 Bacteria 1424
177 Ga0373936_0090974 3300035113 Bacteria 1279
178 Ga0373945_0132845 3300035116 Bacteria 998
179 Ga0373954_0003072 3300035118 Bacteria 7049
180 Ga0373956_0006662 3300035119 Bacteria 4632
181 Ga0373943_0089742 3300035170 Bacteria 1590
182 Ga0373931_0307395 3300035691 Bacteria 981
183 Ga0373935_0039751 3300035692 Bacteria 2950
184 Ga0373935_0066759 3300035692 Bacteria 2312
185 Ga0373933_0076965 3300035724 Bacteria 2039
186 Ga0373937_0413074 3300036401 Bacteria 1280
187 Ga0373925_0094237 3300037068 Bacteria 2292
188 Ga0395900_0110788 3300037418 Bacteria 2820
189 Ga0395901_0266610 3300038443 Bacteria 1782
190 Ga0436361_0052273 3300039447 Bacteria 5189
191 Ga0466965_0015829 3300044683 Bacteria 3583
192 Ga0466959_0008084 3300045049 Bacteria 7418
193 Ga0495592_0099873 3300046454 Bacteria 2069
194 Ga0495592_0174568 3300046454 Bacteria 1469
195 Ga0495638_0000087 3300046460 Bacteria 152531
196 Ga0495651_0077803 3300046462 Bacteria 2510
197 Ga0495651_0157816 3300046462 Bacteria 1628
198 Ga0495650_0000502 3300046471 Bacteria 59150
199 Ga0495650_0000705 3300046471 Bacteria 42734
200 Ga0495580_0162908 3300046472 Bacteria 1543
201 Ga0495664_0012727 3300046477 Bacteria 4765
202 Ga0495608_0275375 3300046511 Bacteria 1045
203 Ga0495630_0531802 3300046517 Bacteria 901
204 Ga0495648_0008727 3300046524 Bacteria 7937
205 Ga0495652_0131637 3300046529 Bacteria 1979
206 Ga0495652_0332848 3300046529 Bacteria 1093
207 Ga0495640_0019133 3300046533 Bacteria 5060
208 Ga0495640_0062527 3300046533 Bacteria 2525
209 Ga0495645_0189522 3300046543 Bacteria 1403
210 Ga0495667_0269272 3300046559 Bacteria 1082
211 Ga0495668_0005238 3300046616 Bacteria 8884
212 Ga0495611_0174064 3300046648 Bacteria 1006
213 Ga0495635_0130866 3300046663 Bacteria 1710
214 Ga0495657_0040960 3300046675 Bacteria 3173
215 Ga0495599_0098837 3300046678 Bacteria 1819
216 Ga0495623_0006249 3300046679 Bacteria 7746
217 Ga0495646_0111940 3300046680 Bacteria 1553
218 Ga0495613_0299285 3300046689 Bacteria 1114
219 Ga0495624_0120702 3300046690 Bacteria 1610
220 Ga0495604_0016408 3300047317 Bacteria 5920
221 Ga0495672_0043070 3300047320 Bacteria 2717
222 Ga0495680_0157949 3300047322 Bacteria 1648
223 Ga0495680_0330507 3300047322 Bacteria 1065
224 Ga0495675_0083727 3300047444 Bacteria 2007
225 Ga0495684_0394223 3300047471 Bacteria 973
226 Ga0495602_0056765 3300048088 Bacteria 3440
227 Ga0496101_0070786 3300048904 Bacteria 2555
228 Ga0496101_0658011 3300048904 Bacteria 828
229 Ga0496102_0003522 3300048905 Bacteria 13266
230 Ga0496102_0142088 3300048905 Bacteria 2251
231 Ga0496102_0603984 3300048905 Unclassified 1020
232 Ga0496103_0058433 3300048906 Bacteria 2396
233 Ga0496103_0279577 3300048906 Bacteria 1074
234 Ga0496104_0072102 3300048907 Bacteria 3284
235 Ga0496104_0092270 3300048907 Bacteria 2896
236 Ga0496105_0099996 3300048908 Bacteria 2395
237 Ga0496106_0000212 3300048909 Bacteria 40609
238 Ga0496107_0063729 3300048910 Bacteria 2671
239 Ga0496108_0185221 3300048911 Bacteria 1803
240 Ga0496109_0027213 3300048912 Bacteria 5104
241 Ga0496109_0234179 3300048912 Bacteria 1728
242 Ga0496112_0037747 3300048915 Bacteria 4716
243 Ga0496112_0043866 3300048915 Bacteria 4379
244 Ga0496112_0122552 3300048915 Bacteria 2570
245 Ga0496112_0568619 3300048915 Bacteria 1067
246 Ga0496113_0288188 3300048916 Bacteria 1313
247 Ga0496114_0058419 3300048917 Bacteria 3221
248 Ga0496115_0104874 3300048918 Bacteria 2320
249 Ga0496115_0195102 3300048918 Bacteria 1673
250 Ga0496118_0192910 3300048921 Bacteria 1216
251 Ga0496121_0147415 3300048924 Bacteria 1737
252 Ga0496124_0055855 3300048927 Bacteria 3334
253 Ga0496125_0111273 3300048928 Bacteria 1982
254 Ga0496125_0123814 3300048928 Bacteria 1837
255 Ga0496126_0000338 3300048929 Bacteria 98321
256 Ga0496126_0033299 3300048929 Bacteria 4849
257 Ga0496126_0248950 3300048929 Bacteria 1481
258 Ga0496126_0328625 3300048929 Bacteria 1255
259 Ga0501032_0003411 3300049569 Bacteria 12164
260 Ga0501042_0326584 3300049578 Bacteria 1109
261 Ga0501043_0063381 3300049579 Bacteria 2903
262 Ga0501046_0003481 3300049580 Bacteria 14438
263 Ga0501047_0019615 3300049581 Bacteria 6488
264 Ga0501076_0667533 3300049592 Bacteria 858
265 Ga0501079_0262881 3300049741 Bacteria 1349
266 Ga0501035_0009204 3300049822 Bacteria 9183
267 Ga0501044_0001569 3300049823 Bacteria 26741
268 nmdc:mga03n38_186131_c1 3300050490 Bacteria 1067
269 nmdc:mga00v17_496533_c1 3300050491 Bacteria 791
270 nmdc:mga0yw44_119924_c1 3300050492 Bacteria 1693
271 nmdc:mga0yw44_213324_c1 3300050492 Bacteria 1277
272 nmdc:mga0k408_348266_c1 3300050493 Bacteria 883
273 nmdc:mga05p37_156705_c1 3300050507 Bacteria 2782
274 nmdc:mga05p37_299274_c1 3300050507 Bacteria 1912
275 nmdc:mga0n895_291086_c1 3300050512 Bacteria 1656
276 nmdc:mga08x19_163807_c1 3300050514 Bacteria 1511
277 Ga0495601_0030066 3300053077 Bacteria 3373
278 Ga0495612_0032615 3300053078 Bacteria 2105
279 Ga0500583_0036130 3300053092 Bacteria 2210
280 Ga0500594_0011969 3300053118 Bacteria 2035
281 Ga0500568_0027648 3300053139 Bacteria 2370
282 Ga0500568_0059386 3300053139 Bacteria 1484
283 Ga0500577_0179901 3300053142 Bacteria 907
284 Ga0500588_0010527 3300053146 Bacteria 2237
285 Ga0500604_0005828 3300053151 Bacteria 3257
286 Ga0500645_001480 3300053730 Bacteria 11799
287 2509371314 2509276018 Bacteria 6910194
288 2509395857 2509276022 Bacteria 6200534
289 2510315920 2510065059 Bacteria 6847884
290 2512932004 2512875016 Bacteria 6529530
291 2512959978 2512875024 Bacteria 7195110
292 2688598025 2687453392 Bacteria 6880454
293 2756672090 2756170246 Bacteria 7451806
294 2770199671 2767802442 Bacteria 5747986
295 2844007961 2844002411 Bacteria 7168230
296 2844535589 2844533157 Bacteria 7517899
297 2856326881 2856320880 Bacteria 7263508
298 2856333734 2856328259 Bacteria 6528202
299 2856338124 2856334872 Bacteria 7037011
300 2857371736 2857367948 Bacteria 6965560
301 2869256416 2869249662 Bacteria 6868783
302 2869268346 2869264136 Bacteria 6880765
303 2869275104 2869271264 Bacteria 6908218
304 2869283569 2869278585 Bacteria 7077053
305 2871461238 2871459585 Bacteria 6866887
306 2874124441 2874123672 Bacteria 7238285
307 2874132667 2874131515 Bacteria 6820270
308 2874143738 2874139085 Bacteria 7021506
309 2874165116 2874162495 Bacteria 6174670
310 2876368994 2876363079 Bacteria 6544991
311 2876404943 2876399893 Bacteria 6927900
312 2876410365 2876406927 Bacteria 6191900
313 2878739002 2878738818 Bacteria 7136951
314 2878779083 2878774303 Bacteria 6108671
315 2878788195 2878781027 Bacteria 6834456
316 2888338952 2888337043 Bacteria 6629336
317 2903450783 2903448605 Bacteria 7357801
318 2903527992 2903521522 Bacteria 6525694
319 2903529696 2903528002 Bacteria 6586099
320 2904453408 2904449895 Bacteria 6927402
321 2904459379 2904456579 Bacteria 6819253
322 2906364099 2906363423 Bacteria 6856682
323 2906376977 2906370794 Bacteria 6881062
324 2906392969 2906386501 Bacteria 5977019
325 2906395031 2906393657 Bacteria 6790866
326 2906413619 2906408224 Bacteria 6162342
327 2922157872 2922151315 Bacteria 6902399
328 2922175141 2922172374 Bacteria 6167644
329 2922185597 2922178524 Bacteria 6025201
330 2924724870 2924718760 Bacteria 6331356
331 2924734934 2924733363 Bacteria 7574837
332 2924753593 2924748358 Bacteria 6154725
333 2924776364 2924776078 Bacteria 7492003
334 2937854107 2937848649 Bacteria 6983481
335 2937869888 2937868953 Bacteria 6639878
336 2937884182 2937877337 Bacteria 7246526
337 2937979716 2937972304 Bacteria 7532020
338 2945972177 2945972063 Bacteria 6086495
339 2958040081 2958034702 Bacteria 6989922
340 2958054425 2958041894 Bacteria 13082850
341 2958065323 2958064165 Bacteria 7158582
342 2958091493 2958084443 Bacteria 7312792
343 2958099477 2958092219 Bacteria 6861151
344 2958151112 2958144490 Bacteria 6677056
345 2958164121 2958158011 Bacteria 6058449
346 2961137673 2961136820 Bacteria 6775228
347 2963647203 2963644680 Bacteria 6530403
348 2965026027 2965025482 Bacteria 6532201
349 2965036085 2965032056 Bacteria 6887443
350 2965044470 2965040258 Bacteria 6855979
351 2965054983 2965047637 Bacteria 6623551
352 2965109724 2965102966 Bacteria 6800987
353 2965116571 2965110997 Bacteria 6693150
354 2968018924 2968016561 Bacteria 7022047
355 2968087962 2968083720 Bacteria 7351627
356 2970470903 2970469710 Bacteria 6969209
357 2970551721 2970547951 Bacteria 6931819
358 2970598006 2970593180 Bacteria 7073582
359 2977874887 2977872689 Bacteria 7270173
360 2977916533 2977915119 Bacteria 6829656
361 2977927478 2977922695 Bacteria 6956781
362 2977936611 2977935797 Bacteria 6252826
363 2977957112 2977950692 Bacteria 6893264
364 2977958065 2977957713 Bacteria 6877875
365 2979795757 2979793036 Bacteria 6808957
366 2987649198 2987645492 Bacteria 6117018
367 2987678711 2987673487 Bacteria 6884027
368 2996356561 2996348954 Bacteria 7239054
369 3004168301 3004167301 Bacteria 8330599
370 3004197792 3004195979 Bacteria 6776956
371 3004215774 3004211236 Bacteria 7417683
372 3004224551 3004218560 Bacteria 7421728
373 3004242161 3004239961 Bacteria 6892290
374 3004282864 3004275668 Bacteria 7114440
375 3004335098 3004334049 Bacteria 8449246
376 3005479969 3005474847 Bacteria 9259049
377 637075101 637000159 Bacteria 7596297
378 649872557 649633066 Bacteria 6690028
379 8004302986 8004300914 Bacteria 6132239
380 8004368961 8004361976 Bacteria 6858373
381 Ga0466959_0024025
382 JGI25157J39369_1000447
383 rootH2_10283342
384 Ga0006562J51391_1100254
385 JGI25404J52841_10000708
386 Ga0055540_1000625
387 Ga0065704_10116509
388 Ga0070658_10078247
389 Ga0070683_100007317
390 Ga0070690_100329698
391 Ga0068869_100011919
392 Ga0070680_100012257
393 Ga0070680_100088736
394 Ga0070660_100225391
395 Ga0070660_100629693
396 Ga0070691_10020480
397 Ga0070692_10061967
398 Ga0070675_100217182
399 Ga0070703_10043583
400 Ga0070714_100102112
401 Ga0070714_100692741
402 Ga0070713_100130459
403 Ga0070710_10271842
404 Ga0070701_10023760
405 Ga0070711_100301727
406 Ga0070708_100488254
407 Ga0070663_100089297
408 Ga0070681_10037601
409 Ga0070681_10379758
410 Ga0070685_10446110
411 Ga0070706_100801625
412 Ga0070707_100022553
413 Ga0070698_100007369
414 Ga0070698_100057384
415 Ga0070699_100107346
416 Ga0070679_100013683
417 Ga0070697_100003278
418 Ga0068853_100054219
419 Ga0070686_100471951
420 Ga0070695_100005273
421 Ga0070696_100002384
422 Ga0070696_100139979
423 Ga0070693_100020247
424 Ga0070665_100174031
425 Ga0068855_100010142
426 Ga0068857_100018531
427 Ga0068856_100301479
428 Ga0068856_100616206
429 Ga0068864_100239284
430 Ga0068864_100321115
431 Ga0068861_100352516
432 Ga0068851_10160656
433 Ga0068870_10063280
434 Ga0068858_100146902
435 Ga0068860_100105064
436 Ga0068862_100004543
437 Ga0081540_1000015
438 Ga0075363_100027917
439 Ga0075363_100239865
440 Ga0075364_10048569
441 Ga0070716_100247941
442 Ga0070712_100178383
443 Ga0070712_100509324
444 Ga0075362_10015002
445 Ga0075366_10046507
446 Ga0097621_100025734
447 Ga0075370_10045234
448 Ga0068871_100009415
449 Ga0075436_100124029
450 Ga0075435_100070375
451 Ga0099794_10010520
452 Ga0099795_10004364
453 Ga0099795_10017276
454 Ga0099795_10017346
455 Ga0099795_10057266
456 Ga0099795_10059946
457 Ga0099795_10069192
458 Ga0105240_10003911
459 Ga0105240_10101701
460 Ga0105240_10229086
461 Ga0105247_10042421
462 Ga0114129_10250295
463 Ga0105243_10194791
464 Ga0105243_10247724
465 Ga0105248_10010141
466 Ga0105237_10032105
467 Ga0105237_10035214
468 Ga0105237_10225980
469 Ga0105238_10000652
470 Ga0105238_10011692
471 Ga0105238_10351981
472 Ga0099796_10004111
473 Ga0099796_10009328
474 Ga0099796_10012057
475 Ga0099796_10017901
476 Ga0099796_10038185
477 Ga0099796_10090366
478 Ga0105239_10006979
479 Ga0105239_10193571
480 Ga0105239_10236065
481 Ga0105239_10382050
482 Ga0105239_10499571
483 Ga0105246_10040227
484 Ga0157373_10198807
485 Ga0157370_10031127
486 Ga0157369_10191135
487 Ga0157374_10172479
488 Ga0163162_10244536
489 Ga0157380_10163874
490 Ga0182008_10000711
491 Ga0182008_10010121
492 Ga0157379_10202222
493 Ga0157379_10232640
494 Ga0157376_10016887
495 Ga0157376_10098302
496 Ga0182006_1000964
497 Ga0182007_10027390
498 Ga0213872_10024857
499 Ga0224572_1025037
500 Ga0209646_1015908
501 Ga0209026_1000002
502 Ga0209759_1000381
503 Ga0209758_1070556
504 Ga0209051_1000271
505 Ga0207653_10027801
506 Ga0207692_10052010
507 Ga0207684_10461453
508 Ga0207707_10052202
509 Ga0207707_10122118
510 Ga0207695_10007545
511 Ga0207695_10445073
512 Ga0207671_10008171
513 Ga0207671_10245466
514 Ga0207693_10023873
515 Ga0207693_10063659
516 Ga0207663_10271101
517 Ga0207660_10035005
518 Ga0207660_10043725
519 Ga0207662_10013851
520 Ga0207652_10054490
521 Ga0207646_10011491
522 Ga0207646_10103923
523 Ga0207694_10007507
524 Ga0207659_10118219
525 Ga0207664_10018250
526 Ga0207706_10080803
527 Ga0207665_10044662
528 Ga0207711_10050206
529 Ga0207689_10280821
530 Ga0207661_10068789
531 Ga0207667_10010882
532 Ga0207712_10000090
533 Ga0207703_10143042
534 Ga0207639_10089841
535 Ga0207639_10184101
536 Ga0207702_10164048
537 Ga0268266_10007036
538 Ga0268266_10016285
539 Ga0268265_10000937
540 Ga0268264_10054199
541 Ga0265334_10003965
542 Ga0265318_10053639
543 Ga0265323_10000311
544 Ga0265322_10007713
545 Ga0265336_10000074
546 Ga0265338_10000137
547 Ga0265324_10003671
548 Ga0265339_10096334
549 Ga0307508_10051236
550 Ga0307514_10054745
551 Ga0265314_10019587
552 Ga0265342_10014254
553 Ga0307413_10409922
554 Ga0307414_10071289
555 Ga0307510_10000666
556 Ga0373923_0079060
557 Ga0373936_0090974
558 Ga0373945_0132845
559 Ga0373954_0003072
560 Ga0373956_0006662
561 Ga0373943_0089742
562 Ga0373931_0307395
563 Ga0373935_0039751
564 Ga0373935_0066759
565 Ga0373933_0076965
566 Ga0373937_0413074
567 Ga0373925_0094237
568 Ga0395900_0110788
569 Ga0395901_0266610
570 Ga0436361_0052273
571 Ga0466965_0015829
572 Ga0466959_0008084
573 Ga0495592_0099873
574 Ga0495592_0174568
575 Ga0495638_0000087
576 Ga0495651_0077803
577 Ga0495651_0157816
578 Ga0495650_0000502
579 Ga0495650_0000705
580 Ga0495580_0162908
581 Ga0495664_0012727
582 Ga0495608_0275375
583 Ga0495630_0531802
584 Ga0495648_0008727
585 Ga0495652_0131637
586 Ga0495652_0332848
587 Ga0495640_0019133
588 Ga0495640_0062527
589 Ga0495645_0189522
590 Ga0495667_0269272
591 Ga0495668_0005238
592 Ga0495611_0174064
593 Ga0495635_0130866
594 Ga0495657_0040960
595 Ga0495599_0098837
596 Ga0495623_0006249
597 Ga0495646_0111940
598 Ga0495613_0299285
599 Ga0495624_0120702
600 Ga0495604_0016408
601 Ga0495672_0043070
602 Ga0495680_0157949
603 Ga0495680_0330507
604 Ga0495675_0083727
605 Ga0495684_0394223
606 Ga0495602_0056765
607 Ga0496101_0070786
608 Ga0496101_0658011
609 Ga0496102_0003522
610 Ga0496102_0142088
611 Ga0496102_0603984
612 Ga0496103_0058433
613 Ga0496103_0279577
614 Ga0496104_0072102
615 Ga0496104_0092270
616 Ga0496105_0099996
617 Ga0496106_0000212
618 Ga0496107_0063729
619 Ga0496108_0185221
620 Ga0496109_0027213
621 Ga0496109_0234179
622 Ga0496112_0037747
623 Ga0496112_0043866
624 Ga0496112_0122552
625 Ga0496112_0568619
626 Ga0496113_0288188
627 Ga0496114_0058419
628 Ga0496115_0104874
629 Ga0496115_0195102
630 Ga0496118_0192910
631 Ga0496121_0147415
632 Ga0496124_0055855
633 Ga0496125_0111273
634 Ga0496125_0123814
635 Ga0496126_0000338
636 Ga0496126_0033299
637 Ga0496126_0248950
638 Ga0496126_0328625
639 Ga0501032_0003411
640 Ga0501042_0326584
641 Ga0501043_0063381
642 Ga0501046_0003481
643 Ga0501047_0019615
644 Ga0501076_0667533
645 Ga0501079_0262881
646 Ga0501035_0009204
647 Ga0501044_0001569
648 nmdc:mga03n38_186131_c1
649 nmdc:mga00v17_496533_c1
650 nmdc:mga0yw44_119924_c1
651 nmdc:mga0yw44_213324_c1
652 nmdc:mga0k408_348266_c1
653 nmdc:mga05p37_156705_c1
654 nmdc:mga05p37_299274_c1
655 nmdc:mga0n895_291086_c1
656 nmdc:mga08x19_163807_c1
657 Ga0495601_0030066
658 Ga0495612_0032615
659 Ga0500583_0036130
660 Ga0500594_0011969
661 Ga0500568_0027648
662 Ga0500568_0059386
663 Ga0500577_0179901
664 Ga0500588_0010527
665 Ga0500604_0005828
666 Ga0500645_001480
667 2509371314
668 2509395857
669 2510315920
670 2512932004
671 2512959978
672 2688598025
673 2756672090
674 2770199671
675 2844007961
676 2844535589
677 2856326881
678 2856333734
679 2856338124
680 2857371736
681 2869256416
682 2869268346
683 2869275104
684 2869283569
685 2871461238
686 2874124441
687 2874132667
688 2874143738
689 2874165116
690 2876368994
691 2876404943
692 2876410365
693 2878739002
694 2878779083
695 2878788195
696 2888338952
697 2903450783
698 2903527992
699 2903529696
700 2904453408
701 2904459379
702 2906364099
703 2906376977
704 2906392969
705 2906395031
706 2906413619
707 2922157872
708 2922175141
709 2922185597
710 2924724870
711 2924734934
712 2924753593
713 2924776364
714 2937854107
715 2937869888
716 2937884182
717 2937979716
718 2945972177
719 2958040081
720 2958054425
721 2958065323
722 2958091493
723 2958099477
724 2958151112
725 2958164121
726 2961137673
727 2963647203
728 2965026027
729 2965036085
730 2965044470
731 2965054983
732 2965109724
733 2965116571
734 2968018924
735 2968087962
736 2970470903
737 2970551721
738 2970598006
739 2977874887
740 2977916533
741 2977927478
742 2977936611
743 2977957112
744 2977958065
745 2979795757
746 2987649198
747 2987678711
748 2996356561
749 3004168301
750 3004197792
751 3004215774
752 3004224551
753 3004242161
754 3004282864
755 3004335098
756 3005479969
757 637075101
758 649872557
759 8004302986
760 8004368961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

183

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

7

209

0.87

PF08659

KR

KR domain

2

166

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

161

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vp5-assembly1.cif.gz_A-2 crystal structure of a 3-oxoacyl-acyl-carrier protein reductase fabg4 from mycobacterium smegmatis bound to nad 0.8745 2 179
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.8535 6 240
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.8458 2 176
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.8454 2 235
3lls-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium tuberculosis 0.845 3 176
ID Description Score Start End Superfamily
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8898 2 72 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8784 3 55 3.40.50.720
af_A0A1D6Q3A1_14_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8765 5 107 3.40.50.720
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.862 6 72 3.40.50.720
4qedB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8564 5 176 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352S7K3-F1-model_v4 Short-chain dehydrogenase 0.982 1 85 GO:0006666
GO:0016020
GO:0030148
GO:0047560
AF-A0A352S7K3-F1-model_v4 Short-chain dehydrogenase 0.9707 1 85 GO:0006666
GO:0016020
GO:0030148
GO:0047560
AF-A0A387FXX6-F1-model_v4 SDR family oxidoreductase 0.9694 1 249 GO:0050664
AF-A0A435H1W7-F1-model_v4 deleted 0.9667 1 196
AF-A0A387FXX6-F1-model_v4 SDR family oxidoreductase 0.9655 1 249 GO:0050664

Map