F428748

General Info

Members Datasets Scaffolds Average Seq Length
380 231 760 265

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0004296|Ga0466969_0004296_5413_6273
Length 286
Sequence MLAARIVARDAPTPASPGPWPRPMNSLTDVLNIPDTQSEHDDRHLAIQLVGVKRVRYPLQLRVAGAAQQAAADWSLAVALPADQKGTHMSRFVAWLDQLEGPMDAAMLQAAFADMLQRLHADEGRVEAAFTFFLRKSAPVSGISSLLDYQGRWIAERKDGRTSVWAEVTVPVKTLCPCSKEISDYGAHNQRSAVTIRAELKSPVEWHELVRFAEDSASCELWPLLKRADEKWVTEHAYENPKFVEDLVRDVAIAVQRDPRIGRYAIDVENFESIHNHSAYARIERA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
138 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
139 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
143 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
144 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
216 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
225 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
231 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.26
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.05
Nodule 0
Rhizoplane 1.32
Rhizosphere 67.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0004296 3300044656 Bacteria 7581
2 rootH1_10032612 3300003316 Bacteria 1638
3 Ga0065715_10212478 3300005293 Bacteria 1308
4 Ga0070676_10009276 3300005328 Bacteria 5319
5 Ga0070690_100009859 3300005330 Bacteria 5544
6 Ga0070670_100079267 3300005331 Bacteria 2822
7 Ga0068869_100013093 3300005334 Bacteria 5506
8 Ga0070666_10023731 3300005335 Bacteria 3994
9 Ga0068868_100193664 3300005338 Bacteria 1691
10 Ga0070687_100008524 3300005343 Bacteria 4350
11 Ga0070668_100004465 3300005347 Bacteria 10381
12 Ga0070668_100500748 3300005347 Bacteria 1051
13 Ga0070669_100001532 3300005353 Bacteria 16719
14 Ga0070675_100029330 3300005354 Bacteria 4436
15 Ga0070671_100009696 3300005355 Bacteria 7737
16 Ga0070674_100021293 3300005356 Bacteria 4158
17 Ga0070673_100279500 3300005364 Bacteria 1464
18 Ga0070667_100055154 3300005367 Bacteria 3356
19 Ga0070667_100071080 3300005367 Bacteria 2963
20 Ga0070701_10035374 3300005438 Bacteria 2509
21 Ga0070708_100104522 3300005445 Bacteria 2597
22 Ga0070663_100001510 3300005455 Bacteria 12793
23 Ga0070662_100014058 3300005457 Bacteria 5337
24 Ga0070662_100033331 3300005457 Bacteria 3626
25 Ga0070662_100599328 3300005457 Bacteria 927
26 Ga0068867_100000249 3300005459 Bacteria 35572
27 Ga0068867_100005345 3300005459 Bacteria 9073
28 Ga0068867_100027184 3300005459 Bacteria 4111
29 Ga0070706_100009139 3300005467 Bacteria 9228
30 Ga0070707_100147167 3300005468 Bacteria 2292
31 Ga0070672_100020069 3300005543 Bacteria 4868
32 Ga0070672_100070301 3300005543 Bacteria 2781
33 Ga0070686_100164976 3300005544 Bacteria 1562
34 Ga0070693_100044946 3300005547 Bacteria 2501
35 Ga0068857_100017919 3300005577 Bacteria 6211
36 Ga0068857_100030341 3300005577 Bacteria 4774
37 Ga0068856_100155795 3300005614 Bacteria 2294
38 Ga0068852_100340608 3300005616 Bacteria 1461
39 Ga0068859_100471107 3300005617 Bacteria 1351
40 Ga0068864_100048789 3300005618 Bacteria 3641
41 Ga0068864_100087120 3300005618 Bacteria 2748
42 Ga0068864_100132925 3300005618 Bacteria 2237
43 Ga0068866_10001739 3300005718 Bacteria 9153
44 Ga0068866_10002956 3300005718 Bacteria 7012
45 Ga0068866_10035420 3300005718 Bacteria 2438
46 Ga0068861_100007169 3300005719 Bacteria 7633
47 Ga0068861_100008498 3300005719 Bacteria 7069
48 Ga0068863_100163644 3300005841 Bacteria 2133
49 Ga0068860_100004363 3300005843 Bacteria 14447
50 Ga0068860_100017973 3300005843 Bacteria 6887
51 Ga0068860_100215826 3300005843 Bacteria 1862
52 Ga0068862_100017121 3300005844 Bacteria 6031
53 Ga0068862_100020991 3300005844 Bacteria 5457
54 Ga0081455_10299781 3300005937 Bacteria 1154
55 Ga0075365_10091385 3300006038 Bacteria 2074
56 Ga0075368_10043572 3300006042 Bacteria 1769
57 Ga0075363_100056912 3300006048 Bacteria 2097
58 Ga0075364_10019981 3300006051 Bacteria 4210
59 Ga0075364_10168821 3300006051 Bacteria 1478
60 Ga0075362_10001681 3300006177 Bacteria 7173
61 Ga0075367_10039987 3300006178 Bacteria 2737
62 Ga0075367_10041468 3300006178 Bacteria 2691
63 Ga0075367_10042467 3300006178 Bacteria 2660
64 Ga0075367_10052292 3300006178 Bacteria 2417
65 Ga0075366_10000618 3300006195 Bacteria 16716
66 Ga0075366_10001285 3300006195 Bacteria 12524
67 Ga0075366_10001950 3300006195 Bacteria 10433
68 Ga0075366_10010384 3300006195 Bacteria 5227
69 Ga0075366_10039679 3300006195 Bacteria 2782
70 Ga0075366_10046459 3300006195 Bacteria 2573
71 Ga0075366_10075083 3300006195 Bacteria 2016
72 Ga0075366_10081521 3300006195 Bacteria 1932
73 Ga0075366_10092895 3300006195 Bacteria 1808
74 Ga0075366_10155307 3300006195 Bacteria 1386
75 Ga0075366_10229110 3300006195 Bacteria 1132
76 Ga0075366_10246495 3300006195 Bacteria 1089
77 Ga0075366_10249109 3300006195 Bacteria 1083
78 Ga0075370_10000087 3300006353 Bacteria 28459
79 Ga0075370_10003324 3300006353 Bacteria 7636
80 Ga0075370_10004191 3300006353 Bacteria 6961
81 Ga0075370_10008070 3300006353 Bacteria 5402
82 Ga0075370_10062551 3300006353 Bacteria 2121
83 Ga0075430_100049074 3300006846 Bacteria 3563
84 Ga0075429_100001289 3300006880 Bacteria 20430
85 Ga0068865_100006714 3300006881 Bacteria 7039
86 Ga0097620_100471146 3300006931 Bacteria 1351
87 Ga0105240_10033561 3300009093 Bacteria 6627
88 Ga0105245_10227539 3300009098 Bacteria 1802
89 Ga0105247_10265810 3300009101 Bacteria 1178
90 Ga0105243_10000765 3300009148 Bacteria 30835
91 Ga0105243_10024011 3300009148 Bacteria 4647
92 Ga0105243_10050830 3300009148 Bacteria 3276
93 Ga0105243_10485368 3300009148 Bacteria 1167
94 Ga0105237_10058104 3300009545 Bacteria 3871
95 Ga0105238_10663761 3300009551 Bacteria 1053
96 Ga0105239_10022851 3300010375 Bacteria 6894
97 Ga0105239_10570608 3300010375 Bacteria 1289
98 Ga0105246_10013889 3300011119 Bacteria 5055
99 Ga0157374_10075038 3300013296 Bacteria 3195
100 Ga0157378_10096213 3300013297 Bacteria 2698
101 Ga0163162_10009974 3300013306 Bacteria 9238
102 Ga0163162_10039880 3300013306 Bacteria 4693
103 Ga0157375_10006250 3300013308 Bacteria 10375
104 Ga0157375_10227309 3300013308 Bacteria 2025
105 Ga0157375_10256025 3300013308 Bacteria 1912
106 Ga0157375_10761757 3300013308 Bacteria 1119
107 Ga0163163_10475244 3300014325 Bacteria 1311
108 Ga0157380_10011812 3300014326 Bacteria 6315
109 Ga0157380_10012619 3300014326 Bacteria 6131
110 Ga0157380_10129018 3300014326 Bacteria 2154
111 Ga0157377_10000016 3300014745 Bacteria 190613
112 Ga0157377_10139892 3300014745 Bacteria 1486
113 Ga0157379_10051699 3300014968 Bacteria 3670
114 Ga0157376_10116184 3300014969 Bacteria 2363
115 Ga0163161_10183371 3300017792 Bacteria 1606
116 Ga0163161_10290309 3300017792 Bacteria 1285
117 Ga0206353_11238192 3300020082 Bacteria 1251
118 Ga0213872_10019667 3300021361 Bacteria 3110
119 Ga0213872_10035144 3300021361 Bacteria 2292
120 Ga0209051_1010602 3300025303 Bacteria 4631
121 Ga0207642_10004076 3300025899 Bacteria 4681
122 Ga0207642_10019436 3300025899 Bacteria 2630
123 Ga0207688_10089134 3300025901 Bacteria 1769
124 Ga0207645_10002448 3300025907 Bacteria 14610
125 Ga0207645_10165415 3300025907 Bacteria 1448
126 Ga0207695_10101651 3300025913 Bacteria 2869
127 Ga0207660_10026867 3300025917 Bacteria 3923
128 Ga0207662_10001761 3300025918 Bacteria 10629
129 Ga0207652_10042739 3300025921 Bacteria 3859
130 Ga0207652_10568760 3300025921 Bacteria 1018
131 Ga0207646_10364880 3300025922 Bacteria 1305
132 Ga0207681_10002612 3300025923 Bacteria 11407
133 Ga0207681_10080308 3300025923 Bacteria 2300
134 Ga0207694_10198026 3300025924 Bacteria 1633
135 Ga0207694_10372143 3300025924 Bacteria 1185
136 Ga0207650_10011230 3300025925 Bacteria 6160
137 Ga0207659_10010396 3300025926 Bacteria 5849
138 Ga0207687_10273175 3300025927 Bacteria 1352
139 Ga0207687_10703671 3300025927 Bacteria 858
140 Ga0207644_10014280 3300025931 Bacteria 5313
141 Ga0207706_10008473 3300025933 Bacteria 9483
142 Ga0207706_10020055 3300025933 Bacteria 6007
143 Ga0207706_10059305 3300025933 Bacteria 3370
144 Ga0207709_10000602 3300025935 Bacteria 29841
145 Ga0207709_10004013 3300025935 Bacteria 8575
146 Ga0207709_10030324 3300025935 Bacteria 3145
147 Ga0207709_10075174 3300025935 Bacteria 2158
148 Ga0207669_10001827 3300025937 Bacteria 9013
149 Ga0207669_10005382 3300025937 Bacteria 5740
150 Ga0207691_10137255 3300025940 Bacteria 2156
151 Ga0207691_10261724 3300025940 Bacteria 1491
152 Ga0207711_10054781 3300025941 Bacteria 3423
153 Ga0207689_10023047 3300025942 Bacteria 5229
154 Ga0207689_10054403 3300025942 Bacteria 3296
155 Ga0207651_10032293 3300025960 Bacteria 3361
156 Ga0207712_10006123 3300025961 Bacteria 7586
157 Ga0207712_10091915 3300025961 Bacteria 2236
158 Ga0207668_10007941 3300025972 Bacteria 6312
159 Ga0207640_10069567 3300025981 Bacteria 2364
160 Ga0207658_10002962 3300025986 Bacteria 12152
161 Ga0207658_10021796 3300025986 Bacteria 4452
162 Ga0207677_10004558 3300026023 Bacteria 7451
163 Ga0207677_10661494 3300026023 Bacteria 923
164 Ga0207703_10005338 3300026035 Bacteria 10351
165 Ga0207703_10421062 3300026035 Bacteria 1243
166 Ga0207639_10037802 3300026041 Bacteria 3588
167 Ga0207678_10008084 3300026067 Bacteria 9275
168 Ga0207641_10005111 3300026088 Bacteria 11237
169 Ga0207641_10607963 3300026088 Bacteria 1071
170 Ga0207648_10000515 3300026089 Bacteria 43207
171 Ga0207648_10004732 3300026089 Bacteria 13902
172 Ga0207648_10032958 3300026089 Bacteria 4571
173 Ga0207676_10007217 3300026095 Bacteria 7868
174 Ga0207676_10138747 3300026095 Bacteria 2078
175 Ga0207674_10006659 3300026116 Bacteria 13573
176 Ga0207674_10037753 3300026116 Bacteria 5020
177 Ga0207675_100001881 3300026118 Bacteria 20975
178 Ga0207698_10057355 3300026142 Bacteria 3012
179 Ga0209813_10035161 3300027866 Bacteria 1499
180 Ga0268265_10019914 3300028380 Bacteria 4673
181 Ga0268264_10001473 3300028381 Bacteria 21971
182 Ga0268264_10002497 3300028381 Bacteria 16172
183 Ga0268264_10219037 3300028381 Bacteria 1751
184 Ga0307517_10002354 3300028786 Bacteria 30505
185 Ga0307515_10000090 3300028794 Bacteria 215043
186 Ga0307515_10000165 3300028794 Bacteria 162589
187 Ga0307515_10000188 3300028794 Bacteria 151439
188 Ga0307515_10000889 3300028794 Bacteria 68865
189 Ga0307515_10014346 3300028794 Bacteria 14704
190 Ga0307515_10020693 3300028794 Bacteria 11719
191 Ga0307515_10038563 3300028794 Bacteria 7637
192 Ga0307515_10072537 3300028794 Bacteria 4643
193 Ga0307515_10100888 3300028794 Bacteria 3490
194 Ga0307515_10163219 3300028794 Bacteria 2260
195 Ga0307515_10250628 3300028794 Bacteria 1524
196 Ga0307515_10257257 3300028794 Bacteria 1488
197 Ga0307512_10016010 3300030522 Bacteria 6930
198 Ga0307513_10007838 3300031456 Bacteria 13772
199 Ga0307513_10017216 3300031456 Bacteria 8672
200 Ga0307513_10037232 3300031456 Bacteria 5417
201 Ga0307513_10237776 3300031456 Bacteria 1629
202 Ga0307513_10316046 3300031456 Bacteria 1322
203 Ga0307509_10000234 3300031507 Bacteria 89398
204 Ga0307509_10140874 3300031507 Bacteria 2347
205 Ga0307509_10409564 3300031507 Bacteria 1060
206 Ga0307509_10427267 3300031507 Bacteria 1024
207 Ga0307408_100101022 3300031548 Bacteria 2198
208 Ga0307408_100288265 3300031548 Bacteria 1370
209 Ga0307508_10000007 3300031616 Bacteria 268359
210 Ga0307508_10004454 3300031616 Bacteria 13689
211 Ga0307508_10013271 3300031616 Bacteria 7536
212 Ga0307514_10118500 3300031649 Bacteria 1854
213 Ga0307516_10000128 3300031730 Bacteria 90057
214 Ga0307516_10000398 3300031730 Bacteria 56825
215 Ga0307516_10012557 3300031730 Bacteria 9118
216 Ga0307516_10018688 3300031730 Bacteria 7200
217 Ga0307405_10000483 3300031731 Bacteria 14957
218 Ga0307413_10039157 3300031824 Bacteria 2754
219 Ga0307410_10004639 3300031852 Bacteria 7138
220 Ga0307406_10018198 3300031901 Bacteria 4100
221 Ga0307412_10011226 3300031911 Bacteria 5181
222 Ga0307416_100420916 3300032002 Bacteria 1380
223 Ga0307411_10008943 3300032005 Bacteria 5227
224 Ga0307510_10022775 3300033180 Bacteria 7267
225 Ga0307510_10054087 3300033180 Bacteria 4211
226 Ga0373932_0008482 3300035112 Bacteria 2458
227 Ga0373962_0025807 3300035242 Bacteria 1580
228 Ga0373931_0047129 3300035691 Bacteria 2281
229 Ga0373931_0205075 3300035691 Bacteria 1180
230 Ga0373935_0075140 3300035692 Bacteria 2186
231 Ga0373925_0137181 3300037068 Bacteria 1912
232 Ga0373925_0447365 3300037068 Bacteria 1058
233 Ga0395900_0000131 3300037418 Bacteria 125554
234 Ga0395898_0001654 3300037466 Bacteria 30082
235 Ga0395898_0473440 3300037466 Bacteria 1192
236 Ga0395905_0060252 3300037471 Bacteria 3549
237 Ga0395905_0089148 3300037471 Bacteria 2891
238 Ga0395905_0240811 3300037471 Bacteria 1690
239 Ga0395905_0391357 3300037471 Bacteria 1284
240 Ga0395905_0813084 3300037471 Bacteria 838
241 Ga0436361_0263782 3300039447 Bacteria 4960
242 Ga0436361_0899240 3300039447 Bacteria 5448
243 Ga0451800_1184735 3300041459 Bacteria 1139
244 Ga0451835_0657262 3300041492 Bacteria 898
245 Ga0451839_0266520 3300041496 Bacteria 993
246 Ga0451851_0771470 3300041507 Bacteria 1588
247 Ga0439431_0003498 3300041997 Bacteria 3462
248 Ga0439462_0043591 3300042015 Bacteria 1199
249 Ga0450896_030265 3300042133 Bacteria 818
250 Ga0450898_026702 3300042134 Bacteria 1041
251 Ga0450899_010771 3300042135 Bacteria 1016
252 Ga0439434_0028835 3300042435 Bacteria 1682
253 Ga0451577_0001120 3300042876 Bacteria 38005
254 Ga0451577_0006947 3300042876 Bacteria 11183
255 Ga0451577_0315955 3300042876 Bacteria 1416
256 Ga0466972_0000390 3300044658 Bacteria 23451
257 Ga0466972_0026258 3300044658 Bacteria 2886
258 Ga0466965_0232750 3300044683 Bacteria 984
259 Ga0466966_0000208 3300044684 Bacteria 39070
260 Ga0466961_0033009 3300044693 Bacteria 3326
261 Ga0466964_0029566 3300044706 Bacteria 2164
262 Ga0466964_0041455 3300044706 Bacteria 1862
263 Ga0453684_0304179 3300044712 Bacteria 1812
264 Ga0466971_0012981 3300044719 Bacteria 3655
265 Ga0466968_0051453 3300044735 Bacteria 1760
266 Ga0466968_0185096 3300044735 Bacteria 970
267 Ga0466970_0013695 3300044765 Bacteria 4160
268 Ga0466957_0001097 3300044842 Bacteria 13996
269 Ga0466959_0000664 3300045049 Bacteria 20079
270 Ga0466959_0078300 3300045049 Bacteria 2384
271 Ga0451576_0003772 3300045051 Bacteria 20437
272 Ga0451576_0679744 3300045051 Bacteria 1081
273 Ga0466958_0247831 3300045836 Bacteria 1139
274 Ga0466967_0024475 3300045976 Bacteria 4965
275 Ga0466967_0665241 3300045976 Bacteria 1030
276 Ga0495592_0000291 3300046454 Bacteria 42990
277 Ga0495592_0117023 3300046454 Bacteria 1880
278 Ga0495590_0004662 3300046457 Bacteria 5508
279 Ga0495629_0089788 3300046459 Bacteria 2144
280 Ga0495629_0311400 3300046459 Bacteria 1077
281 Ga0495638_0067734 3300046460 Bacteria 2191
282 Ga0495650_0002299 3300046471 Bacteria 15858
283 Ga0495585_0008002 3300046492 Bacteria 6426
284 Ga0495610_0006772 3300046512 Bacteria 7777
285 Ga0495610_0157487 3300046512 Bacteria 963
286 Ga0495620_0061521 3300046515 Bacteria 1562
287 Ga0495630_0254599 3300046517 Bacteria 1341
288 Ga0495632_0002939 3300046519 Bacteria 12506
289 Ga0495632_0023442 3300046519 Bacteria 3296
290 Ga0495648_0076603 3300046524 Bacteria 1920
291 Ga0495666_0027503 3300046526 Bacteria 2799
292 Ga0495642_0109019 3300046528 Bacteria 1183
293 Ga0495652_0445794 3300046529 Bacteria 907
294 Ga0495621_0127702 3300046539 Bacteria 987
295 Ga0495597_0010847 3300046542 Bacteria 4437
296 Ga0495645_0242976 3300046543 Bacteria 1200
297 Ga0495622_0136121 3300046557 Bacteria 1117
298 Ga0495625_0003235 3300046660 Bacteria 16485
299 Ga0495646_0165250 3300046680 Bacteria 1223
300 Ga0495613_0033496 3300046689 Bacteria 3818
301 Ga0495649_0001158 3300046694 Bacteria 20470
302 Ga0495687_000500 3300047443 Bacteria 47248
303 Ga0495687_004213 3300047443 Bacteria 9863
304 Ga0495673_0103186 3300047469 Bacteria 1150
305 Ga0495686_0004579 3300047472 Bacteria 11287
306 Ga0495593_0050555 3300047673 Bacteria 2202
307 Ga0495626_0082429 3300048091 Bacteria 1427
308 Ga0495626_0102098 3300048091 Bacteria 1249
309 Ga0496104_0015982 3300048907 Bacteria 6812
310 Ga0496108_0135867 3300048911 Bacteria 2116
311 Ga0496113_0367080 3300048916 Bacteria 1155
312 Ga0496114_0402082 3300048917 Bacteria 1213
313 Ga0501043_0000149 3300049579 Bacteria 65122
314 Ga0501046_0000092 3300049580 Bacteria 97456
315 Ga0501047_0000028 3300049581 Bacteria 220279
316 Ga0501048_0000097 3300049582 Bacteria 47728
317 Ga0501067_0206992 3300049583 Bacteria 1093
318 Ga0501257_053469 3300049686 Bacteria 1010
319 Ga0501265_002297 3300049762 Bacteria 2170
320 Ga0501045_0000170 3300049824 Bacteria 35617
321 nmdc:mga03683_27525_c1 3300050489 Bacteria 2252
322 nmdc:mga03683_70149_c1 3300050489 Bacteria 1497
323 nmdc:mga03n38_278106_c1 3300050490 Bacteria 893
324 nmdc:mga00v17_67222_c1 3300050491 Bacteria 2214
325 nmdc:mga0yw44_80196_c1 3300050492 Bacteria 2044
326 nmdc:mga0k408_114050_c1 3300050493 Bacteria 1598
327 nmdc:mga0k408_128991_c1 3300050493 Bacteria 1501
328 nmdc:mga0k408_24421_c1 3300050493 Bacteria 3415
329 nmdc:mga0k408_246060_c1 3300050493 Bacteria 1068
330 nmdc:mga0k408_273726_c1 3300050493 Bacteria 1008
331 nmdc:mga0k408_279988_c1 3300050493 Bacteria 996
332 nmdc:mga0k408_28763_c1 3300050493 Bacteria 3161
333 nmdc:mga0k408_31643_c1 3300050493 Bacteria 3022
334 nmdc:mga0k408_3626_c1 3300050493 Bacteria 8169
335 nmdc:mga0k408_390_c2 3300050493 Bacteria 17975
336 nmdc:mga0k408_5904_c1 3300050493 Bacteria 6530
337 nmdc:mga0k408_81253_c1 3300050493 Bacteria 1898
338 nmdc:mga0k408_887_c1 3300050493 Bacteria 16392
339 nmdc:mga0k408_95185_c1 3300050493 Bacteria 1752
340 nmdc:mga06z11_134731_c1 3300050494 Bacteria 1391
341 nmdc:mga06z11_49896_c1 3300050494 Bacteria 2137
342 nmdc:mga04h51_41877_c1 3300050495 Bacteria 1499
343 nmdc:mga04h51_52738_c1 3300050495 Bacteria 1370
344 nmdc:mga07m45_12176_c1 3300050496 Bacteria 4539
345 nmdc:mga07m45_129878_c1 3300050496 Bacteria 1458
346 nmdc:mga07m45_21548_c1 3300050496 Bacteria 3510
347 nmdc:mga07m45_38081_c1 3300050496 Bacteria 2683
348 nmdc:mga07m45_4980_c1 3300050496 Bacteria 6559
349 nmdc:mga07m45_51050_c1 3300050496 Bacteria 1871
350 nmdc:mga07m45_67_c1 3300050496 Bacteria 40608
351 nmdc:mga07m45_6964_c1 3300050496 Bacteria 5749
352 nmdc:mga07m45_90513_c1 3300050496 Bacteria 1753
353 nmdc:mga05p37_245189_c1 3300050507 Bacteria 2151
354 nmdc:mga09592_19777_c1 3300050508 Bacteria 5531
355 nmdc:mga0qj67_121042_c1 3300050509 Bacteria 2117
356 nmdc:mga08y16_290322_c1 3300050511 Bacteria 1686
357 nmdc:mga0n895_434347_c1 3300050512 Bacteria 1326
358 nmdc:mga0sz30_17060_c1 3300050516 Bacteria 2892
359 nmdc:mga0sz30_56965_c1 3300050516 Bacteria 1665
360 Ga0495612_0024442 3300053078 Bacteria 2425
361 Ga0500647_0136221 3300053091 Bacteria 1155
362 Ga0500557_093687 3300053105 Bacteria 996
363 Ga0500593_000462 3300053117 Bacteria 16125
364 Ga0500594_0000292 3300053118 Bacteria 11401
365 Ga0500607_159949 3300053121 Bacteria 1031
366 Ga0500658_0002883 3300053134 Bacteria 6601
367 Ga0500658_0018122 3300053134 Bacteria 2636
368 Ga0500559_0000214 3300053136 Bacteria 46366
369 Ga0500564_075193 3300053138 Bacteria 1520
370 Ga0500568_0018752 3300053139 Bacteria 3019
371 Ga0500590_020187 3300053148 Bacteria 3456
372 Ga0500619_000325 3300053154 Bacteria 9276
373 Ga0500619_013196 3300053154 Bacteria 2183
374 Ga0500622_0005113 3300053156 Bacteria 7962
375 Ga0500636_0018875 3300053177 Bacteria 4078
376 Ga0500587_003501 3300053739 Bacteria 2189
377 Ga0466962_0002201 3300061719 Bacteria 9220
378 Ga0466962_0120322 3300061719 Bacteria 1267
379 2587755616 2585428062 Bacteria 6842168
380 2644303988 2643221654 Bacteria 5273570
381 Ga0466969_0004296
382 rootH1_10032612
383 Ga0065715_10212478
384 Ga0070676_10009276
385 Ga0070690_100009859
386 Ga0070670_100079267
387 Ga0068869_100013093
388 Ga0070666_10023731
389 Ga0068868_100193664
390 Ga0070687_100008524
391 Ga0070668_100004465
392 Ga0070668_100500748
393 Ga0070669_100001532
394 Ga0070675_100029330
395 Ga0070671_100009696
396 Ga0070674_100021293
397 Ga0070673_100279500
398 Ga0070667_100055154
399 Ga0070667_100071080
400 Ga0070701_10035374
401 Ga0070708_100104522
402 Ga0070663_100001510
403 Ga0070662_100014058
404 Ga0070662_100033331
405 Ga0070662_100599328
406 Ga0068867_100000249
407 Ga0068867_100005345
408 Ga0068867_100027184
409 Ga0070706_100009139
410 Ga0070707_100147167
411 Ga0070672_100020069
412 Ga0070672_100070301
413 Ga0070686_100164976
414 Ga0070693_100044946
415 Ga0068857_100017919
416 Ga0068857_100030341
417 Ga0068856_100155795
418 Ga0068852_100340608
419 Ga0068859_100471107
420 Ga0068864_100048789
421 Ga0068864_100087120
422 Ga0068864_100132925
423 Ga0068866_10001739
424 Ga0068866_10002956
425 Ga0068866_10035420
426 Ga0068861_100007169
427 Ga0068861_100008498
428 Ga0068863_100163644
429 Ga0068860_100004363
430 Ga0068860_100017973
431 Ga0068860_100215826
432 Ga0068862_100017121
433 Ga0068862_100020991
434 Ga0081455_10299781
435 Ga0075365_10091385
436 Ga0075368_10043572
437 Ga0075363_100056912
438 Ga0075364_10019981
439 Ga0075364_10168821
440 Ga0075362_10001681
441 Ga0075367_10039987
442 Ga0075367_10041468
443 Ga0075367_10042467
444 Ga0075367_10052292
445 Ga0075366_10000618
446 Ga0075366_10001285
447 Ga0075366_10001950
448 Ga0075366_10010384
449 Ga0075366_10039679
450 Ga0075366_10046459
451 Ga0075366_10075083
452 Ga0075366_10081521
453 Ga0075366_10092895
454 Ga0075366_10155307
455 Ga0075366_10229110
456 Ga0075366_10246495
457 Ga0075366_10249109
458 Ga0075370_10000087
459 Ga0075370_10003324
460 Ga0075370_10004191
461 Ga0075370_10008070
462 Ga0075370_10062551
463 Ga0075430_100049074
464 Ga0075429_100001289
465 Ga0068865_100006714
466 Ga0097620_100471146
467 Ga0105240_10033561
468 Ga0105245_10227539
469 Ga0105247_10265810
470 Ga0105243_10000765
471 Ga0105243_10024011
472 Ga0105243_10050830
473 Ga0105243_10485368
474 Ga0105237_10058104
475 Ga0105238_10663761
476 Ga0105239_10022851
477 Ga0105239_10570608
478 Ga0105246_10013889
479 Ga0157374_10075038
480 Ga0157378_10096213
481 Ga0163162_10009974
482 Ga0163162_10039880
483 Ga0157375_10006250
484 Ga0157375_10227309
485 Ga0157375_10256025
486 Ga0157375_10761757
487 Ga0163163_10475244
488 Ga0157380_10011812
489 Ga0157380_10012619
490 Ga0157380_10129018
491 Ga0157377_10000016
492 Ga0157377_10139892
493 Ga0157379_10051699
494 Ga0157376_10116184
495 Ga0163161_10183371
496 Ga0163161_10290309
497 Ga0206353_11238192
498 Ga0213872_10019667
499 Ga0213872_10035144
500 Ga0209051_1010602
501 Ga0207642_10004076
502 Ga0207642_10019436
503 Ga0207688_10089134
504 Ga0207645_10002448
505 Ga0207645_10165415
506 Ga0207695_10101651
507 Ga0207660_10026867
508 Ga0207662_10001761
509 Ga0207652_10042739
510 Ga0207652_10568760
511 Ga0207646_10364880
512 Ga0207681_10002612
513 Ga0207681_10080308
514 Ga0207694_10198026
515 Ga0207694_10372143
516 Ga0207650_10011230
517 Ga0207659_10010396
518 Ga0207687_10273175
519 Ga0207687_10703671
520 Ga0207644_10014280
521 Ga0207706_10008473
522 Ga0207706_10020055
523 Ga0207706_10059305
524 Ga0207709_10000602
525 Ga0207709_10004013
526 Ga0207709_10030324
527 Ga0207709_10075174
528 Ga0207669_10001827
529 Ga0207669_10005382
530 Ga0207691_10137255
531 Ga0207691_10261724
532 Ga0207711_10054781
533 Ga0207689_10023047
534 Ga0207689_10054403
535 Ga0207651_10032293
536 Ga0207712_10006123
537 Ga0207712_10091915
538 Ga0207668_10007941
539 Ga0207640_10069567
540 Ga0207658_10002962
541 Ga0207658_10021796
542 Ga0207677_10004558
543 Ga0207677_10661494
544 Ga0207703_10005338
545 Ga0207703_10421062
546 Ga0207639_10037802
547 Ga0207678_10008084
548 Ga0207641_10005111
549 Ga0207641_10607963
550 Ga0207648_10000515
551 Ga0207648_10004732
552 Ga0207648_10032958
553 Ga0207676_10007217
554 Ga0207676_10138747
555 Ga0207674_10006659
556 Ga0207674_10037753
557 Ga0207675_100001881
558 Ga0207698_10057355
559 Ga0209813_10035161
560 Ga0268265_10019914
561 Ga0268264_10001473
562 Ga0268264_10002497
563 Ga0268264_10219037
564 Ga0307517_10002354
565 Ga0307515_10000090
566 Ga0307515_10000165
567 Ga0307515_10000188
568 Ga0307515_10000889
569 Ga0307515_10014346
570 Ga0307515_10020693
571 Ga0307515_10038563
572 Ga0307515_10072537
573 Ga0307515_10100888
574 Ga0307515_10163219
575 Ga0307515_10250628
576 Ga0307515_10257257
577 Ga0307512_10016010
578 Ga0307513_10007838
579 Ga0307513_10017216
580 Ga0307513_10037232
581 Ga0307513_10237776
582 Ga0307513_10316046
583 Ga0307509_10000234
584 Ga0307509_10140874
585 Ga0307509_10409564
586 Ga0307509_10427267
587 Ga0307408_100101022
588 Ga0307408_100288265
589 Ga0307508_10000007
590 Ga0307508_10004454
591 Ga0307508_10013271
592 Ga0307514_10118500
593 Ga0307516_10000128
594 Ga0307516_10000398
595 Ga0307516_10012557
596 Ga0307516_10018688
597 Ga0307405_10000483
598 Ga0307413_10039157
599 Ga0307410_10004639
600 Ga0307406_10018198
601 Ga0307412_10011226
602 Ga0307416_100420916
603 Ga0307411_10008943
604 Ga0307510_10022775
605 Ga0307510_10054087
606 Ga0373932_0008482
607 Ga0373962_0025807
608 Ga0373931_0047129
609 Ga0373931_0205075
610 Ga0373935_0075140
611 Ga0373925_0137181
612 Ga0373925_0447365
613 Ga0395900_0000131
614 Ga0395898_0001654
615 Ga0395898_0473440
616 Ga0395905_0060252
617 Ga0395905_0089148
618 Ga0395905_0240811
619 Ga0395905_0391357
620 Ga0395905_0813084
621 Ga0436361_0263782
622 Ga0436361_0899240
623 Ga0451800_1184735
624 Ga0451835_0657262
625 Ga0451839_0266520
626 Ga0451851_0771470
627 Ga0439431_0003498
628 Ga0439462_0043591
629 Ga0450896_030265
630 Ga0450898_026702
631 Ga0450899_010771
632 Ga0439434_0028835
633 Ga0451577_0001120
634 Ga0451577_0006947
635 Ga0451577_0315955
636 Ga0466972_0000390
637 Ga0466972_0026258
638 Ga0466965_0232750
639 Ga0466966_0000208
640 Ga0466961_0033009
641 Ga0466964_0029566
642 Ga0466964_0041455
643 Ga0453684_0304179
644 Ga0466971_0012981
645 Ga0466968_0051453
646 Ga0466968_0185096
647 Ga0466970_0013695
648 Ga0466957_0001097
649 Ga0466959_0000664
650 Ga0466959_0078300
651 Ga0451576_0003772
652 Ga0451576_0679744
653 Ga0466958_0247831
654 Ga0466967_0024475
655 Ga0466967_0665241
656 Ga0495592_0000291
657 Ga0495592_0117023
658 Ga0495590_0004662
659 Ga0495629_0089788
660 Ga0495629_0311400
661 Ga0495638_0067734
662 Ga0495650_0002299
663 Ga0495585_0008002
664 Ga0495610_0006772
665 Ga0495610_0157487
666 Ga0495620_0061521
667 Ga0495630_0254599
668 Ga0495632_0002939
669 Ga0495632_0023442
670 Ga0495648_0076603
671 Ga0495666_0027503
672 Ga0495642_0109019
673 Ga0495652_0445794
674 Ga0495621_0127702
675 Ga0495597_0010847
676 Ga0495645_0242976
677 Ga0495622_0136121
678 Ga0495625_0003235
679 Ga0495646_0165250
680 Ga0495613_0033496
681 Ga0495649_0001158
682 Ga0495687_000500
683 Ga0495687_004213
684 Ga0495673_0103186
685 Ga0495686_0004579
686 Ga0495593_0050555
687 Ga0495626_0082429
688 Ga0495626_0102098
689 Ga0496104_0015982
690 Ga0496108_0135867
691 Ga0496113_0367080
692 Ga0496114_0402082
693 Ga0501043_0000149
694 Ga0501046_0000092
695 Ga0501047_0000028
696 Ga0501048_0000097
697 Ga0501067_0206992
698 Ga0501257_053469
699 Ga0501265_002297
700 Ga0501045_0000170
701 nmdc:mga03683_27525_c1
702 nmdc:mga03683_70149_c1
703 nmdc:mga03n38_278106_c1
704 nmdc:mga00v17_67222_c1
705 nmdc:mga0yw44_80196_c1
706 nmdc:mga0k408_114050_c1
707 nmdc:mga0k408_128991_c1
708 nmdc:mga0k408_24421_c1
709 nmdc:mga0k408_246060_c1
710 nmdc:mga0k408_273726_c1
711 nmdc:mga0k408_279988_c1
712 nmdc:mga0k408_28763_c1
713 nmdc:mga0k408_31643_c1
714 nmdc:mga0k408_3626_c1
715 nmdc:mga0k408_390_c2
716 nmdc:mga0k408_5904_c1
717 nmdc:mga0k408_81253_c1
718 nmdc:mga0k408_887_c1
719 nmdc:mga0k408_95185_c1
720 nmdc:mga06z11_134731_c1
721 nmdc:mga06z11_49896_c1
722 nmdc:mga04h51_41877_c1
723 nmdc:mga04h51_52738_c1
724 nmdc:mga07m45_12176_c1
725 nmdc:mga07m45_129878_c1
726 nmdc:mga07m45_21548_c1
727 nmdc:mga07m45_38081_c1
728 nmdc:mga07m45_4980_c1
729 nmdc:mga07m45_51050_c1
730 nmdc:mga07m45_67_c1
731 nmdc:mga07m45_6964_c1
732 nmdc:mga07m45_90513_c1
733 nmdc:mga05p37_245189_c1
734 nmdc:mga09592_19777_c1
735 nmdc:mga0qj67_121042_c1
736 nmdc:mga08y16_290322_c1
737 nmdc:mga0n895_434347_c1
738 nmdc:mga0sz30_17060_c1
739 nmdc:mga0sz30_56965_c1
740 Ga0495612_0024442
741 Ga0500647_0136221
742 Ga0500557_093687
743 Ga0500593_000462
744 Ga0500594_0000292
745 Ga0500607_159949
746 Ga0500658_0002883
747 Ga0500658_0018122
748 Ga0500559_0000214
749 Ga0500564_075193
750 Ga0500568_0018752
751 Ga0500590_020187
752 Ga0500619_000325
753 Ga0500619_013196
754 Ga0500622_0005113
755 Ga0500636_0018875
756 Ga0500587_003501
757 Ga0466962_0002201
758 Ga0466962_0120322
759 2587755616
760 2644303988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02649

GCHY-1

Type I GTP cyclohydrolase folE2

33

281

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d2o-assembly1.cif.gz_A crystal structure of manganese-metallated gtp cyclohydrolase type ib 0.8293 24 261
2r5r-assembly1.cif.gz_A the crystal structure of duf198 from nitrosomonas europaea atcc 19718 0.8281 21 262
5k95-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase-ib with 8-oxo-gtp 0.8219 24 262
2r5r-assembly1.cif.gz_A the crystal structure of duf198 from nitrosomonas europaea atcc 19718 0.8126 21 262
3d2o-assembly1.cif.gz_A crystal structure of manganese-metallated gtp cyclohydrolase type ib 0.8073 24 261
ID Description Score Start End Superfamily
3d2oB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8325 26 261 3.10.270.10
3d2oB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8071 26 261 3.10.270.10
af_Q2G0L1_30_291_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.7532 24 262 3.10.270.10
af_Q58185_15_301_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.742 26 262 3.10.270.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.717 25 107 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A351BIW8-F1-model_v4 GTP cyclohydrolase I FolE2 0.9214 68 155 GO:0003934
AF-A0A7V5R875-F1-model_v4 GTP cyclohydrolase I FolE2 0.9002 25 127 GO:0003934
AF-A0A2B4M6U4-F1-model_v4 deleted 0.893 69 162
AF-A0A7C4AH44-F1-model_v4 GTP cyclohydrolase I FolE2 0.8757 26 143 GO:0003934
AF-A0A2B4M6U4-F1-model_v4 deleted 0.8755 69 162

Map