F428644

General Info

Members Datasets Scaffolds Average Seq Length
380 266 760 418

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10161544|Ga0105238_101615441
Length 476
Sequence MRVLVIGSGGREHALCWAIAGSPLLAKLWCAPGNPGIAAVAECVPIGALDFAALVAFAQDNEIDLVVPGPEAPLVAGIADAMEAASIPCIGPSRAAARLEGSKAYTKELCDAAGIPTAQWERFDDAEAARGFVRRRGAPIVVKADGLAAGKGVVVAATEAEALAAIDAMMQARAFGEAGAAVVIEECLVGEEVSLFALCDGETALPLGAAQDHKRVGEGETGPNTGGMGAYSPTPSFSPALQQAAMDRIIRPALAEMARRGTPFRGILYAGLMLTDDGMKLIEFNVRFGDPECQALVLRMKSDLLFALHAACHGGLANFEFQWHDTASIAVVMAARGYPEAPERGSEIRGLDRAAAVPGVQIFHAGTTLSRGRLLATGGRVLTVCAGGDDQRAAYAAIDRIDWPEGFCRRDIGWRAKFRRARSSADSISSGRSRTSHASVVITPPSTAPAPRAHASSQPATPHTPQGSHREVGEWS

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
245 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
246 2643221651 Afipia sp. Root123D2 Isolate Unclassified
247 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
248 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
249 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
250 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
251 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
252 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
253 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
254 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
255 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
256 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
257 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
258 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
259 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
260 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
261 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
262 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
263 2920879853 Kocuria salina CV6 Isolate Unclassified
264 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
265 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
266 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0.26
Isolates 6.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.32
Nodule 0
Rhizoplane 10
Rhizosphere 68.42
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10161544 3300009551 Bacteria 2216
2 JGI25406J46586_10000845 3300003203 Bacteria 14403
3 JGI25406J46586_10023553 3300003203 Bacteria 2431
4 JGI25153J46596_10015526 3300003215 Bacteria 3095
5 Ga0065165_1015706 3300005262 Bacteria 2875
6 Ga0070658_10001441 3300005327 Bacteria 20287
7 Ga0070683_100061931 3300005329 Bacteria 3478
8 Ga0068868_100151575 3300005338 Bacteria 1909
9 Ga0070689_100003731 3300005340 Bacteria 10197
10 Ga0070689_100260770 3300005340 Bacteria 1432
11 Ga0070669_100012555 3300005353 Bacteria 6008
12 Ga0070674_100126320 3300005356 Bacteria 1900
13 Ga0070688_100007055 3300005365 Bacteria 6044
14 Ga0070709_10036891 3300005434 Bacteria 2981
15 Ga0070714_100024016 3300005435 Bacteria 5014
16 Ga0070713_100298537 3300005436 Bacteria 1482
17 Ga0070701_10100885 3300005438 Bacteria 1598
18 Ga0070700_100118537 3300005441 Bacteria 1770
19 Ga0070678_100037529 3300005456 Bacteria 3403
20 Ga0070681_10177476 3300005458 Bacteria 2052
21 Ga0068867_100069223 3300005459 Bacteria 2635
22 Ga0070685_10023692 3300005466 Bacteria 3364
23 Ga0070684_100047264 3300005535 Bacteria 3729
24 Ga0070672_100013142 3300005543 Bacteria 5836
25 Ga0070686_100015611 3300005544 Bacteria 4404
26 Ga0070695_100003485 3300005545 Bacteria 9185
27 Ga0070665_100053587 3300005548 Bacteria 4045
28 Ga0068855_100003543 3300005563 Bacteria 19086
29 Ga0070664_100088274 3300005564 Bacteria 2681
30 Ga0068854_100067303 3300005578 Bacteria 2609
31 Ga0068852_100288908 3300005616 Bacteria 1583
32 Ga0068852_100292720 3300005616 Bacteria 1573
33 Ga0068859_100355749 3300005617 Bacteria 1559
34 Ga0068864_100092674 3300005618 Bacteria 2667
35 Ga0068861_100285283 3300005719 Bacteria 1423
36 Ga0068870_10043765 3300005840 Bacteria 2336
37 Ga0068860_100095048 3300005843 Bacteria 2840
38 Ga0068860_100305880 3300005843 Bacteria 1558
39 Ga0081455_10000022 3300005937 Bacteria 159620
40 Ga0081540_1006786 3300005983 Bacteria 8274
41 Ga0081539_10001464 3300005985 Bacteria 40027
42 Ga0081539_10002935 3300005985 Bacteria 22459
43 Ga0081539_10004437 3300005985 Bacteria 15491
44 Ga0081539_10034061 3300005985 Bacteria 3089
45 Ga0070717_10008076 3300006028 Bacteria 7847
46 Ga0075365_10062789 3300006038 Bacteria 2485
47 Ga0075365_10100505 3300006038 Bacteria 1980
48 Ga0075368_10003082 3300006042 Bacteria 5524
49 Ga0075363_100020450 3300006048 Bacteria 3319
50 Ga0075364_10050464 3300006051 Bacteria 2715
51 Ga0070712_100042040 3300006175 Bacteria 3142
52 Ga0070712_100056012 3300006175 Bacteria 2764
53 Ga0075367_10119310 3300006178 Bacteria 1624
54 Ga0075369_10022948 3300006186 Bacteria 2576
55 Ga0075370_10032537 3300006353 Bacteria 2917
56 Ga0075370_10034564 3300006353 Bacteria 2833
57 Ga0075428_100000213 3300006844 Bacteria 55855
58 Ga0075431_100057199 3300006847 Bacteria 4022
59 Ga0075433_10002590 3300006852 Bacteria 13784
60 Ga0075434_100000682 3300006871 Bacteria 26436
61 Ga0075434_100050998 3300006871 Bacteria 4110
62 Ga0075434_100142268 3300006871 Bacteria 2419
63 Ga0097620_100355753 3300006931 Bacteria 1559
64 Ga0105240_10008147 3300009093 Bacteria 15030
65 Ga0111539_10002652 3300009094 Bacteria 23721
66 Ga0111539_10023642 3300009094 Bacteria 7551
67 Ga0111539_10224674 3300009094 Bacteria 2187
68 Ga0111539_10400653 3300009094 Bacteria 1598
69 Ga0105245_10006796 3300009098 Bacteria 10033
70 Ga0105245_10188496 3300009098 Bacteria 1974
71 Ga0105247_10045449 3300009101 Bacteria 2694
72 Ga0105247_10066413 3300009101 Bacteria 2246
73 Ga0105243_10013134 3300009148 Bacteria 6259
74 Ga0105241_10002853 3300009174 Bacteria 12904
75 Ga0105241_10133745 3300009174 Bacteria 2011
76 Ga0105242_10207520 3300009176 Bacteria 1744
77 Ga0105248_10245446 3300009177 Bacteria 2016
78 Ga0105249_10053834 3300009553 Bacteria 3679
79 Ga0105249_10254798 3300009553 Bacteria 1741
80 Ga0105239_10022345 3300010375 Bacteria 6975
81 Ga0105239_10244006 3300010375 Bacteria 2016
82 Ga0157378_10246424 3300013297 Bacteria 1709
83 Ga0163162_10059055 3300013306 Bacteria 3866
84 Ga0157372_10039237 3300013307 Bacteria 5227
85 Ga0163163_10001576 3300014325 Bacteria 19224
86 Ga0163163_10126386 3300014325 Bacteria 2595
87 Ga0157380_10138383 3300014326 Bacteria 2088
88 Ga0157380_10232086 3300014326 Bacteria 1658
89 Ga0157379_10116669 3300014968 Bacteria 2401
90 Ga0213876_10050141 3300021384 Unclassified 2206
91 Ga0213875_10000040 3300021388 Bacteria 156362
92 Ga0213875_10017887 3300021388 Bacteria 3420
93 Ga0209564_1002521 3300025295 Bacteria 14159
94 Ga0209758_1000438 3300025297 Bacteria 70094
95 Ga0207710_10017054 3300025900 Bacteria 3077
96 Ga0207710_10036169 3300025900 Bacteria 2176
97 Ga0207688_10039754 3300025901 Bacteria 2613
98 Ga0207654_10008885 3300025911 Bacteria 5096
99 Ga0207695_10006539 3300025913 Bacteria 15089
100 Ga0207693_10020760 3300025915 Bacteria 5224
101 Ga0207693_10026649 3300025915 Bacteria 4573
102 Ga0207663_10050797 3300025916 Bacteria 2579
103 Ga0207662_10031842 3300025918 Bacteria 3065
104 Ga0207657_10052488 3300025919 Bacteria 3538
105 Ga0207687_10003879 3300025927 Bacteria 10036
106 Ga0207687_10016098 3300025927 Bacteria 4908
107 Ga0207687_10203568 3300025927 Bacteria 1549
108 Ga0207700_10054129 3300025928 Bacteria 3010
109 Ga0207664_10011436 3300025929 Bacteria 6309
110 Ga0207690_10178877 3300025932 Bacteria 1595
111 Ga0207709_10017644 3300025935 Bacteria 3986
112 Ga0207709_10031084 3300025935 Bacteria 3114
113 Ga0207670_10062786 3300025936 Bacteria 2540
114 Ga0207691_10014425 3300025940 Bacteria 7536
115 Ga0207711_10021844 3300025941 Bacteria 5345
116 Ga0207689_10024231 3300025942 Bacteria 5092
117 Ga0207712_10100692 3300025961 Bacteria 2147
118 Ga0207668_10160527 3300025972 Bacteria 1751
119 Ga0207668_10195592 3300025972 Bacteria 1606
120 Ga0207658_10256289 3300025986 Bacteria 1489
121 Ga0207703_10046066 3300026035 Bacteria 3511
122 Ga0207703_10068265 3300026035 Bacteria 2929
123 Ga0207708_10049604 3300026075 Bacteria 3197
124 Ga0207708_10103474 3300026075 Bacteria 2206
125 Ga0207641_10286562 3300026088 Bacteria 1551
126 Ga0207648_10181617 3300026089 Bacteria 1862
127 Ga0207676_10181838 3300026095 Bacteria 1842
128 Ga0207675_100023595 3300026118 Bacteria 5723
129 Ga0207683_10046213 3300026121 Bacteria 3809
130 Ga0207683_10063056 3300026121 Bacteria 3265
131 Ga0207428_10020280 3300027907 Bacteria 5648
132 Ga0207428_10023041 3300027907 Bacteria 5243
133 Ga0207428_10097423 3300027907 Bacteria 2276
134 Ga0207428_10113550 3300027907 Bacteria 2082
135 Ga0268266_10022268 3300028379 Bacteria 5401
136 Ga0268266_10024317 3300028379 Bacteria 5154
137 Ga0268264_10163460 3300028381 Bacteria 2008
138 Ga0265322_10010095 3300028654 Bacteria 2739
139 Ga0265338_10001843 3300028800 Bacteria 33286
140 Ga0265330_10019164 3300031235 Bacteria 3138
141 Ga0265325_10011961 3300031241 Bacteria 4973
142 Ga0265339_10008991 3300031249 Bacteria 6317
143 Ga0265339_10068991 3300031249 Bacteria 1888
144 Ga0265316_10052763 3300031344 Bacteria 3189
145 Ga0265316_10113959 3300031344 Bacteria 2045
146 Ga0265313_10000928 3300031595 Bacteria 29181
147 Ga0307508_10113262 3300031616 Bacteria 2313
148 Ga0316576_10005401 3300031727 Bacteria 7803
149 Ga0316576_10060595 3300031727 Bacteria 2772
150 Ga0307412_10016933 3300031911 Bacteria 4355
151 Ga0316587_1003666 3300033529 Bacteria 2170
152 Ga0373949_0009668 3300035090 Bacteria 2112
153 Ga0373954_0068879 3300035118 Bacteria 1679
154 Ga0373943_0072869 3300035170 Bacteria 1743
155 Ga0373955_0092068 3300035172 Bacteria 1729
156 Ga0373942_0004768 3300035207 Bacteria 3149
157 Ga0316574_0039494 3300035398 Bacteria 2902
158 Ga0373931_0000355 3300035691 Bacteria 18854
159 Ga0373931_0037459 3300035691 Bacteria 2532
160 Ga0373931_0070807 3300035691 Bacteria 1904
161 Ga0373933_0013745 3300035724 Bacteria 4492
162 Ga0373933_0035902 3300035724 Bacteria 2898
163 Ga0373947_0044222 3300035725 Bacteria 2661
164 Ga0373937_0001718 3300036401 Bacteria 18412
165 Ga0373937_0013990 3300036401 Bacteria 7075
166 Ga0373937_0051878 3300036401 Bacteria 3760
167 Ga0373937_0052245 3300036401 Bacteria 3746
168 Ga0316584_0001409 3300036712 Bacteria 14381
169 Ga0316584_0059086 3300036712 Bacteria 2871
170 Ga0395899_0017235 3300037312 Bacteria 5505
171 Ga0395900_0005722 3300037418 Bacteria 12991
172 Ga0395900_0080758 3300037418 Bacteria 3341
173 Ga0395898_0004095 3300037466 Bacteria 15992
174 Ga0436364_0725334 3300037853 Bacteria 3560
175 Ga0436364_0854630 3300037853 Bacteria 11397
176 Ga0436364_1101563 3300037853 Bacteria 8996
177 Ga0436364_1472994 3300037853 Bacteria 2105
178 Ga0436364_1537514 3300037853 Bacteria 10558
179 Ga0395901_0013936 3300038443 Bacteria 8182
180 Ga0436365_1870977 3300039437 Bacteria 5549
181 Ga0436360_0659124 3300039438 Bacteria 7476
182 Ga0436361_0843974 3300039447 Bacteria 5436
183 Ga0436361_0978767 3300039447 Bacteria 9292
184 Ga0439465_0011626 3300041413 Bacteria 2763
185 Ga0466967_0063092 3300045976 Bacteria 3291
186 Ga0495638_0009112 3300046460 Bacteria 6986
187 Ga0495638_0014093 3300046460 Bacteria 5414
188 Ga0495638_0022920 3300046460 Bacteria 4092
189 Ga0495638_0124879 3300046460 Bacteria 1517
190 Ga0495594_0023411 3300046499 Bacteria 3309
191 Ga0495606_0002474 3300046507 Bacteria 21381
192 Ga0495608_0069208 3300046511 Bacteria 2306
193 Ga0495616_0059107 3300046513 Bacteria 1886
194 Ga0495631_0011146 3300046518 Bacteria 4431
195 Ga0495643_0043387 3300046522 Bacteria 2448
196 Ga0495648_0052168 3300046524 Bacteria 2486
197 Ga0495652_0037543 3300046529 Bacteria 4202
198 Ga0495645_0012687 3300046543 Bacteria 5943
199 Ga0495622_0009024 3300046557 Bacteria 4617
200 Ga0495667_0005200 3300046559 Bacteria 8796
201 Ga0495667_0016388 3300046559 Bacteria 5008
202 Ga0495661_0017183 3300046665 Bacteria 4779
203 Ga0495588_0026082 3300046674 Bacteria 2916
204 Ga0495599_0076095 3300046678 Bacteria 2096
205 Ga0495647_0022174 3300046681 Bacteria 2293
206 Ga0495669_0018931 3300046684 Bacteria 2967
207 Ga0495670_0001059 3300046691 Bacteria 13333
208 Ga0495604_0026701 3300047317 Bacteria 4596
209 Ga0495672_0072650 3300047320 Bacteria 1942
210 Ga0495676_0115742 3300047321 Bacteria 1960
211 Ga0495676_0202854 3300047321 Bacteria 1377
212 Ga0495680_0115876 3300047322 Bacteria 1982
213 Ga0495675_0005408 3300047444 Bacteria 7784
214 Ga0495675_0095356 3300047444 Bacteria 1865
215 Ga0495686_0074929 3300047472 Bacteria 2076
216 Ga0495602_0043958 3300048088 Bacteria 4055
217 Ga0495602_0056541 3300048088 Bacteria 3449
218 Ga0495602_0280788 3300048088 Bacteria 1227
219 Ga0496100_0111600 3300048903 Bacteria 1900
220 Ga0496101_0058412 3300048904 Bacteria 2793
221 Ga0496101_0068077 3300048904 Bacteria 2602
222 Ga0496102_0005689 3300048905 Bacteria 10584
223 Ga0496103_0003256 3300048906 Bacteria 9952
224 Ga0496104_0000335 3300048907 Bacteria 42046
225 Ga0496104_0010396 3300048907 Bacteria 8311
226 Ga0496104_0090709 3300048907 Bacteria 2920
227 Ga0496104_0102332 3300048907 Bacteria 2743
228 Ga0496104_0154871 3300048907 Bacteria 2200
229 Ga0496104_0254206 3300048907 Bacteria 1670
230 Ga0496104_0287869 3300048907 Bacteria 1555
231 Ga0496105_0000063 3300048908 Bacteria 84836
232 Ga0496105_0002153 3300048908 Bacteria 14259
233 Ga0496105_0147673 3300048908 Bacteria 1933
234 Ga0496105_0237635 3300048908 Bacteria 1479
235 Ga0496106_0034418 3300048909 Bacteria 3783
236 Ga0496106_0071587 3300048909 Bacteria 2650
237 Ga0496107_0079278 3300048910 Bacteria 2394
238 Ga0496108_0005400 3300048911 Bacteria 10330
239 Ga0496108_0010108 3300048911 Bacteria 7655
240 Ga0496108_0186652 3300048911 Bacteria 1796
241 Ga0496109_0024315 3300048912 Bacteria 5384
242 Ga0496110_0066142 3300048913 Bacteria 3196
243 Ga0496110_0109658 3300048913 Bacteria 2479
244 Ga0496111_0001723 3300048914 Bacteria 12796
245 Ga0496111_0035437 3300048914 Bacteria 3566
246 Ga0496112_0006789 3300048915 Bacteria 10089
247 Ga0496112_0050274 3300048915 Bacteria 4088
248 Ga0496112_0290288 3300048915 Bacteria 1581
249 Ga0496113_0001988 3300048916 Bacteria 11713
250 Ga0496113_0138833 3300048916 Bacteria 1911
251 Ga0496114_0117224 3300048917 Bacteria 2287
252 Ga0496115_0021649 3300048918 Bacteria 4968
253 Ga0496115_0169525 3300048918 Bacteria 1805
254 Ga0496117_0016070 3300048920 Bacteria 6336
255 Ga0496117_0033985 3300048920 Bacteria 3849
256 Ga0496117_0088216 3300048920 Bacteria 2007
257 Ga0496118_0030240 3300048921 Bacteria 4523
258 Ga0496118_0037172 3300048921 Bacteria 3923
259 Ga0496118_0075460 3300048921 Bacteria 2404
260 Ga0496119_0000213 3300048922 Bacteria 82822
261 Ga0496120_0094316 3300048923 Bacteria 1593
262 Ga0496121_0002550 3300048924 Bacteria 27617
263 Ga0496121_0006125 3300048924 Bacteria 15113
264 Ga0496121_0012085 3300048924 Bacteria 9487
265 Ga0496122_0099990 3300048925 Bacteria 1942
266 Ga0496123_0058385 3300048926 Bacteria 2503
267 Ga0496125_0003512 3300048928 Bacteria 18920
268 Ga0496126_0125524 3300048929 Bacteria 2221
269 Ga0501031_0000719 3300049568 Bacteria 19835
270 Ga0501031_0008250 3300049568 Bacteria 6774
271 Ga0501032_0000850 3300049569 Bacteria 24762
272 Ga0501032_0006893 3300049569 Bacteria 8326
273 Ga0501033_0008859 3300049570 Bacteria 7773
274 Ga0501034_0000393 3300049571 Bacteria 74137
275 Ga0501034_0025879 3300049571 Bacteria 5976
276 Ga0501036_0000958 3300049572 Bacteria 21739
277 Ga0501036_0018991 3300049572 Bacteria 5767
278 Ga0501037_0000054 3300049573 Bacteria 109898
279 Ga0501037_0000294 3300049573 Bacteria 42178
280 Ga0501038_0000039 3300049574 Bacteria 122904
281 Ga0501038_0000651 3300049574 Bacteria 30855
282 Ga0501039_0000056 3300049575 Bacteria 90421
283 Ga0501039_0003218 3300049575 Bacteria 12216
284 Ga0501042_0144489 3300049578 Bacteria 1715
285 Ga0501043_0000637 3300049579 Bacteria 31032
286 Ga0501043_0011324 3300049579 Bacteria 6981
287 Ga0501046_0000725 3300049580 Bacteria 31884
288 Ga0501046_0000834 3300049580 Bacteria 30018
289 Ga0501046_0011415 3300049580 Bacteria 7596
290 Ga0501047_0000203 3300049581 Bacteria 72023
291 Ga0501047_0225920 3300049581 Bacteria 1727
292 Ga0501048_0000078 3300049582 Bacteria 50963
293 Ga0501067_0000346 3300049583 Bacteria 25225
294 Ga0501067_0030039 3300049583 Bacteria 3013
295 Ga0501067_0036253 3300049583 Bacteria 2739
296 Ga0501068_0000291 3300049584 Bacteria 24952
297 Ga0501068_0022060 3300049584 Bacteria 3721
298 Ga0501069_0001778 3300049585 Bacteria 10781
299 Ga0501069_0002968 3300049585 Bacteria 8726
300 Ga0501070_0004799 3300049586 Bacteria 11561
301 Ga0501070_0012552 3300049586 Bacteria 7145
302 Ga0501072_0011365 3300049588 Bacteria 6804
303 Ga0501073_0000750 3300049589 Bacteria 22975
304 Ga0501079_0001315 3300049741 Bacteria 17467
305 Ga0501079_0001985 3300049741 Bacteria 14652
306 Ga0501080_0000866 3300049742 Bacteria 24782
307 Ga0501080_0012114 3300049742 Bacteria 7900
308 Ga0501080_0036925 3300049742 Bacteria 4561
309 Ga0501083_0003621 3300049744 Bacteria 10840
310 Ga0501035_0001592 3300049822 Bacteria 22985
311 Ga0501035_0050018 3300049822 Bacteria 3746
312 Ga0501044_0001625 3300049823 Bacteria 26338
313 Ga0501045_0001038 3300049824 Bacteria 18267
314 nmdc:mga03683_15377_c1 3300050489 Bacteria 2855
315 nmdc:mga00v17_37477_c1 3300050491 Bacteria 2896
316 nmdc:mga0yw44_15632_c1 3300050492 Bacteria 4072
317 nmdc:mga0yw44_36534_c1 3300050492 Bacteria 2895
318 nmdc:mga06r32_41047_c1 3300050510 Bacteria 4394
319 nmdc:mga08y16_100472_c1 3300050511 Bacteria 3012
320 nmdc:mga08y16_223730_c1 3300050511 Bacteria 1947
321 nmdc:mga0n895_199986_c1 3300050512 Bacteria 2029
322 nmdc:mga0n895_3101_c1 3300050512 Bacteria 13235
323 nmdc:mga0rr50_9258_c1 3300050513 Bacteria 6182
324 nmdc:mga0a205_3468_c1 3300050515 Bacteria 14083
325 nmdc:mga0sz30_14812_c1 3300050516 Bacteria 3076
326 nmdc:mga0sz30_63566_c1 3300050516 Bacteria 1580
327 Ga0495601_0012871 3300053077 Bacteria 5022
328 Ga0495595_0030333 3300053084 Bacteria 2425
329 Ga0495595_0049658 3300053084 Bacteria 1941
330 Ga0495619_0190241 3300053085 Bacteria 1420
331 Ga0500643_013807 3300053087 Bacteria 2833
332 Ga0500644_0000201 3300053088 Bacteria 36319
333 Ga0500644_0008001 3300053088 Bacteria 2774
334 Ga0500581_053381 3300053089 Bacteria 2057
335 Ga0500651_0138598 3300053093 Bacteria 1468
336 Ga0500566_0000214 3300053094 Bacteria 30715
337 Ga0500650_0038879 3300053098 Bacteria 2190
338 Ga0500556_0000216 3300053104 Bacteria 46888
339 Ga0500569_005548 3300053109 Bacteria 2715
340 Ga0500595_009201 3300053119 Bacteria 3997
341 Ga0500642_0000012 3300053130 Bacteria 206424
342 Ga0500652_001002 3300053131 Bacteria 9227
343 Ga0500559_0000167 3300053136 Bacteria 51877
344 Ga0500568_0000595 3300053139 Bacteria 26291
345 Ga0500577_0000241 3300053142 Bacteria 14218
346 Ga0500586_000572 3300053145 Bacteria 7473
347 Ga0500616_0000515 3300053153 Bacteria 48965
348 Ga0500616_0093113 3300053153 Bacteria 1488
349 Ga0500619_011810 3300053154 Bacteria 2260
350 Ga0500622_0002115 3300053156 Bacteria 14789
351 Ga0500622_0104879 3300053156 Bacteria 1387
352 Ga0500634_0019197 3300053161 Bacteria 3680
353 Ga0500636_0011591 3300053177 Bacteria 5161
354 Ga0500645_019497 3300053730 Bacteria 2109
355 Ga0501084_0002205 3300054114 Bacteria 15623
356 Ga0501082_0001966 3300060353 Bacteria 18093
357 Ga0501082_0277566 3300060353 Bacteria 1459
358 2511390673 2511231027 Bacteria 5013807
359 2603857399 2602042107 Bacteria 6226103
360 2644289859 2643221651 Bacteria 4798932
361 2765469067 2765235802 Bacteria 5618596
362 2770194873 2767802442 Bacteria 5747986
363 2776272345 2775506902 Bacteria 6208009
364 2776284284 2775506904 Bacteria 5954060
365 2809225669 2808606447 Bacteria 3572005
366 2839994425 2839993093 Bacteria 5512535
367 2840764959 2840764183 Bacteria 6358399
368 2842873626 2842871566 Bacteria 4827117
369 2852635473 2852632344 Bacteria 3463163
370 2857526779 2857524615 Bacteria 6615449
371 2893069946 2893066018 Bacteria 6158120
372 2894655212 2894652903 Bacteria 4587256
373 2894773800 2894772417 Bacteria 5305674
374 2904578922 2904578770 Bacteria 5302906
375 2919077712 2919073203 Bacteria 6531949
376 2919122251 2919119836 Bacteria 5208557
377 2920881662 2920879853 Bacteria 4216831
378 2954014840 2954011201 Bacteria 4762601
379 3002142910 3002141150 Bacteria 5254435
380 8007374941 8007371054 Bacteria 4849201
381 Ga0105238_10161544
382 JGI25406J46586_10000845
383 JGI25406J46586_10023553
384 JGI25153J46596_10015526
385 Ga0065165_1015706
386 Ga0070658_10001441
387 Ga0070683_100061931
388 Ga0068868_100151575
389 Ga0070689_100003731
390 Ga0070689_100260770
391 Ga0070669_100012555
392 Ga0070674_100126320
393 Ga0070688_100007055
394 Ga0070709_10036891
395 Ga0070714_100024016
396 Ga0070713_100298537
397 Ga0070701_10100885
398 Ga0070700_100118537
399 Ga0070678_100037529
400 Ga0070681_10177476
401 Ga0068867_100069223
402 Ga0070685_10023692
403 Ga0070684_100047264
404 Ga0070672_100013142
405 Ga0070686_100015611
406 Ga0070695_100003485
407 Ga0070665_100053587
408 Ga0068855_100003543
409 Ga0070664_100088274
410 Ga0068854_100067303
411 Ga0068852_100288908
412 Ga0068852_100292720
413 Ga0068859_100355749
414 Ga0068864_100092674
415 Ga0068861_100285283
416 Ga0068870_10043765
417 Ga0068860_100095048
418 Ga0068860_100305880
419 Ga0081455_10000022
420 Ga0081540_1006786
421 Ga0081539_10001464
422 Ga0081539_10002935
423 Ga0081539_10004437
424 Ga0081539_10034061
425 Ga0070717_10008076
426 Ga0075365_10062789
427 Ga0075365_10100505
428 Ga0075368_10003082
429 Ga0075363_100020450
430 Ga0075364_10050464
431 Ga0070712_100042040
432 Ga0070712_100056012
433 Ga0075367_10119310
434 Ga0075369_10022948
435 Ga0075370_10032537
436 Ga0075370_10034564
437 Ga0075428_100000213
438 Ga0075431_100057199
439 Ga0075433_10002590
440 Ga0075434_100000682
441 Ga0075434_100050998
442 Ga0075434_100142268
443 Ga0097620_100355753
444 Ga0105240_10008147
445 Ga0111539_10002652
446 Ga0111539_10023642
447 Ga0111539_10224674
448 Ga0111539_10400653
449 Ga0105245_10006796
450 Ga0105245_10188496
451 Ga0105247_10045449
452 Ga0105247_10066413
453 Ga0105243_10013134
454 Ga0105241_10002853
455 Ga0105241_10133745
456 Ga0105242_10207520
457 Ga0105248_10245446
458 Ga0105249_10053834
459 Ga0105249_10254798
460 Ga0105239_10022345
461 Ga0105239_10244006
462 Ga0157378_10246424
463 Ga0163162_10059055
464 Ga0157372_10039237
465 Ga0163163_10001576
466 Ga0163163_10126386
467 Ga0157380_10138383
468 Ga0157380_10232086
469 Ga0157379_10116669
470 Ga0213876_10050141
471 Ga0213875_10000040
472 Ga0213875_10017887
473 Ga0209564_1002521
474 Ga0209758_1000438
475 Ga0207710_10017054
476 Ga0207710_10036169
477 Ga0207688_10039754
478 Ga0207654_10008885
479 Ga0207695_10006539
480 Ga0207693_10020760
481 Ga0207693_10026649
482 Ga0207663_10050797
483 Ga0207662_10031842
484 Ga0207657_10052488
485 Ga0207687_10003879
486 Ga0207687_10016098
487 Ga0207687_10203568
488 Ga0207700_10054129
489 Ga0207664_10011436
490 Ga0207690_10178877
491 Ga0207709_10017644
492 Ga0207709_10031084
493 Ga0207670_10062786
494 Ga0207691_10014425
495 Ga0207711_10021844
496 Ga0207689_10024231
497 Ga0207712_10100692
498 Ga0207668_10160527
499 Ga0207668_10195592
500 Ga0207658_10256289
501 Ga0207703_10046066
502 Ga0207703_10068265
503 Ga0207708_10049604
504 Ga0207708_10103474
505 Ga0207641_10286562
506 Ga0207648_10181617
507 Ga0207676_10181838
508 Ga0207675_100023595
509 Ga0207683_10046213
510 Ga0207683_10063056
511 Ga0207428_10020280
512 Ga0207428_10023041
513 Ga0207428_10097423
514 Ga0207428_10113550
515 Ga0268266_10022268
516 Ga0268266_10024317
517 Ga0268264_10163460
518 Ga0265322_10010095
519 Ga0265338_10001843
520 Ga0265330_10019164
521 Ga0265325_10011961
522 Ga0265339_10008991
523 Ga0265339_10068991
524 Ga0265316_10052763
525 Ga0265316_10113959
526 Ga0265313_10000928
527 Ga0307508_10113262
528 Ga0316576_10005401
529 Ga0316576_10060595
530 Ga0307412_10016933
531 Ga0316587_1003666
532 Ga0373949_0009668
533 Ga0373954_0068879
534 Ga0373943_0072869
535 Ga0373955_0092068
536 Ga0373942_0004768
537 Ga0316574_0039494
538 Ga0373931_0000355
539 Ga0373931_0037459
540 Ga0373931_0070807
541 Ga0373933_0013745
542 Ga0373933_0035902
543 Ga0373947_0044222
544 Ga0373937_0001718
545 Ga0373937_0013990
546 Ga0373937_0051878
547 Ga0373937_0052245
548 Ga0316584_0001409
549 Ga0316584_0059086
550 Ga0395899_0017235
551 Ga0395900_0005722
552 Ga0395900_0080758
553 Ga0395898_0004095
554 Ga0436364_0725334
555 Ga0436364_0854630
556 Ga0436364_1101563
557 Ga0436364_1472994
558 Ga0436364_1537514
559 Ga0395901_0013936
560 Ga0436365_1870977
561 Ga0436360_0659124
562 Ga0436361_0843974
563 Ga0436361_0978767
564 Ga0439465_0011626
565 Ga0466967_0063092
566 Ga0495638_0009112
567 Ga0495638_0014093
568 Ga0495638_0022920
569 Ga0495638_0124879
570 Ga0495594_0023411
571 Ga0495606_0002474
572 Ga0495608_0069208
573 Ga0495616_0059107
574 Ga0495631_0011146
575 Ga0495643_0043387
576 Ga0495648_0052168
577 Ga0495652_0037543
578 Ga0495645_0012687
579 Ga0495622_0009024
580 Ga0495667_0005200
581 Ga0495667_0016388
582 Ga0495661_0017183
583 Ga0495588_0026082
584 Ga0495599_0076095
585 Ga0495647_0022174
586 Ga0495669_0018931
587 Ga0495670_0001059
588 Ga0495604_0026701
589 Ga0495672_0072650
590 Ga0495676_0115742
591 Ga0495676_0202854
592 Ga0495680_0115876
593 Ga0495675_0005408
594 Ga0495675_0095356
595 Ga0495686_0074929
596 Ga0495602_0043958
597 Ga0495602_0056541
598 Ga0495602_0280788
599 Ga0496100_0111600
600 Ga0496101_0058412
601 Ga0496101_0068077
602 Ga0496102_0005689
603 Ga0496103_0003256
604 Ga0496104_0000335
605 Ga0496104_0010396
606 Ga0496104_0090709
607 Ga0496104_0102332
608 Ga0496104_0154871
609 Ga0496104_0254206
610 Ga0496104_0287869
611 Ga0496105_0000063
612 Ga0496105_0002153
613 Ga0496105_0147673
614 Ga0496105_0237635
615 Ga0496106_0034418
616 Ga0496106_0071587
617 Ga0496107_0079278
618 Ga0496108_0005400
619 Ga0496108_0010108
620 Ga0496108_0186652
621 Ga0496109_0024315
622 Ga0496110_0066142
623 Ga0496110_0109658
624 Ga0496111_0001723
625 Ga0496111_0035437
626 Ga0496112_0006789
627 Ga0496112_0050274
628 Ga0496112_0290288
629 Ga0496113_0001988
630 Ga0496113_0138833
631 Ga0496114_0117224
632 Ga0496115_0021649
633 Ga0496115_0169525
634 Ga0496117_0016070
635 Ga0496117_0033985
636 Ga0496117_0088216
637 Ga0496118_0030240
638 Ga0496118_0037172
639 Ga0496118_0075460
640 Ga0496119_0000213
641 Ga0496120_0094316
642 Ga0496121_0002550
643 Ga0496121_0006125
644 Ga0496121_0012085
645 Ga0496122_0099990
646 Ga0496123_0058385
647 Ga0496125_0003512
648 Ga0496126_0125524
649 Ga0501031_0000719
650 Ga0501031_0008250
651 Ga0501032_0000850
652 Ga0501032_0006893
653 Ga0501033_0008859
654 Ga0501034_0000393
655 Ga0501034_0025879
656 Ga0501036_0000958
657 Ga0501036_0018991
658 Ga0501037_0000054
659 Ga0501037_0000294
660 Ga0501038_0000039
661 Ga0501038_0000651
662 Ga0501039_0000056
663 Ga0501039_0003218
664 Ga0501042_0144489
665 Ga0501043_0000637
666 Ga0501043_0011324
667 Ga0501046_0000725
668 Ga0501046_0000834
669 Ga0501046_0011415
670 Ga0501047_0000203
671 Ga0501047_0225920
672 Ga0501048_0000078
673 Ga0501067_0000346
674 Ga0501067_0030039
675 Ga0501067_0036253
676 Ga0501068_0000291
677 Ga0501068_0022060
678 Ga0501069_0001778
679 Ga0501069_0002968
680 Ga0501070_0004799
681 Ga0501070_0012552
682 Ga0501072_0011365
683 Ga0501073_0000750
684 Ga0501079_0001315
685 Ga0501079_0001985
686 Ga0501080_0000866
687 Ga0501080_0012114
688 Ga0501080_0036925
689 Ga0501083_0003621
690 Ga0501035_0001592
691 Ga0501035_0050018
692 Ga0501044_0001625
693 Ga0501045_0001038
694 nmdc:mga03683_15377_c1
695 nmdc:mga00v17_37477_c1
696 nmdc:mga0yw44_15632_c1
697 nmdc:mga0yw44_36534_c1
698 nmdc:mga06r32_41047_c1
699 nmdc:mga08y16_100472_c1
700 nmdc:mga08y16_223730_c1
701 nmdc:mga0n895_199986_c1
702 nmdc:mga0n895_3101_c1
703 nmdc:mga0rr50_9258_c1
704 nmdc:mga0a205_3468_c1
705 nmdc:mga0sz30_14812_c1
706 nmdc:mga0sz30_63566_c1
707 Ga0495601_0012871
708 Ga0495595_0030333
709 Ga0495595_0049658
710 Ga0495619_0190241
711 Ga0500643_013807
712 Ga0500644_0000201
713 Ga0500644_0008001
714 Ga0500581_053381
715 Ga0500651_0138598
716 Ga0500566_0000214
717 Ga0500650_0038879
718 Ga0500556_0000216
719 Ga0500569_005548
720 Ga0500595_009201
721 Ga0500642_0000012
722 Ga0500652_001002
723 Ga0500559_0000167
724 Ga0500568_0000595
725 Ga0500577_0000241
726 Ga0500586_000572
727 Ga0500616_0000515
728 Ga0500616_0093113
729 Ga0500619_011810
730 Ga0500622_0002115
731 Ga0500622_0104879
732 Ga0500634_0019197
733 Ga0500636_0011591
734 Ga0500645_019497
735 Ga0501084_0002205
736 Ga0501082_0001966
737 Ga0501082_0277566
738 2511390673
739 2603857399
740 2644289859
741 2765469067
742 2770194873
743 2776272345
744 2776284284
745 2809225669
746 2839994425
747 2840764959
748 2842873626
749 2852635473
750 2857526779
751 2893069946
752 2894655212
753 2894773800
754 2904578922
755 2919077712
756 2919122251
757 2920881662
758 2954014840
759 3002142910
760 8007374941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

101

293

1

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

1

100

0.99

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

328

415

0.95

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

102

196

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9763 1 388
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9716 1 389
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.958 1 402
2qk4-assembly1.cif.gz_A human glycinamide ribonucleotide synthetase 0.9512 2 388
2qk4-assembly2.cif.gz_B human glycinamide ribonucleotide synthetase 0.9433 2 392
ID Description Score Start End Superfamily
af_P9WHM9_188_326_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9746 189 325 3.30.470.20
3lp8A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9723 2 93 3.40.50.20
2ip4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9651 2 93 3.40.50.20
af_P9WHM9_2_93_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.964 2 93 3.40.50.20
3lp8A03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9635 189 324 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A2V5V3Y5-F1-model_v4 Phosphoribosylglycinamide synthetase N-terminal domain-containing protein 0.9976 2 84 GO:0004637
GO:0009113
AF-A0A352Y4J7-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) 0.9975 1 87 GO:0004637
GO:0009113
AF-A0A7X8LEI6-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) 0.9962 1 108 GO:0004637
GO:0009113
AF-A0A2M7U8M5-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) 0.9959 1 71 GO:0004637
GO:0009113
AF-A0A7J4NH64-F1-model_v4 deleted 0.9941 2 93

Map