F428595

General Info

Members Datasets Scaffolds Average Seq Length
380 272 760 334

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100070912|Ga0068853_1000709122
Length 368
Sequence LFHVLKHYSEHDPKHPKHDLSTDEEGTTMTATPDLPAAAREWHLLSRPVGWPKPEDFALVEADVRQPAEGQVLVRNKFLSVDPYMRGRMSAAKSYVAPFELGKAMQGGAVGEVVVSDVEGIEPGDHVLHFQGWREYAVVDAKQAVKVDPEAAPLSTYLGVLGMTGLTAYAGLLRTASFKEGDSVFVSGAAGAVGSQVGQIAKLKGASRVIGSAGSDDKVKLLVEEYGFDAAFNYKNGPVSEQLREAAPDGVDVYFDNVGGDHLEAAIGSLNRGGRIAVCGMISVYNNTEPAPGPRNLARLIQTRGRIEGFLVGDHYDLQPQFVQEVGAWVRSGELKYRETVAEGIENNLEAFLGVLRGDNTGKMIVKL

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
50 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
65 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
66 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
67 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
68 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
69 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
70 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
71 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
72 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
73 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
197 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
198 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
213 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
214 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
215 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
216 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
217 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
218 2643221572 Leifsonia sp. Root60 Isolate Unclassified
219 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
220 2643221613 Oerskovia sp. Root22 Isolate Unclassified
221 2643221647 Streptomyces sp. Root369 Isolate Unclassified
222 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
223 2643221714 Streptomyces sp. Root264 Isolate Unclassified
224 2643221721 Oerskovia sp. Root918 Isolate Unclassified
225 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
226 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
227 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
228 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
229 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
230 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
231 2808606448 Streptomyces sp. 193411 Isolate Unclassified
232 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
233 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
234 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
235 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
236 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
237 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
238 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
239 2862574272 Streptomyces sp. AcE210 Isolate Nodule
240 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
241 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
242 2867428634 Streptomyces sp. RP5T Isolate Unclassified
243 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
244 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
245 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
246 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
247 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
248 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
249 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
250 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
251 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
252 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
253 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
254 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
255 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
256 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
257 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
258 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
259 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
260 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
261 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
262 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
263 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
264 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
265 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
266 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
267 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
268 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
269 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
270 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
271 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
272 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.32
Metatranscriptomes 7.63
Isolates 16.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0.53
Rhizoplane 3.16
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100070912 3300005539 Bacteria 3034
2 JGI24735J21928_10035475 3300002067 Bacteria 1466
3 rootH1_10015258 3300003316 Bacteria 10891
4 rootL2_10002560 3300003322 Bacteria 7226
5 rootH1_10033010 3300003323 Bacteria 7649
6 Ga0055536_1004711 3300003781 Bacteria 6867
7 Ga0068855_100094329 3300005563 Bacteria 3451
8 Ga0068862_100154688 3300005844 Unclassified 2043
9 Ga0075363_100025433 3300006048 Bacteria 3019
10 Ga0075367_10000724 3300006178 Bacteria 12790
11 Ga0075428_100338005 3300006844 Unclassified 1617
12 Ga0111539_10087078 3300009094 Bacteria 3670
13 Ga0105246_10150924 3300011119 Bacteria 1759
14 Ga0157369_10201414 3300013105 Bacteria 2089
15 Ga0157374_10231218 3300013296 Bacteria 1816
16 Ga0182008_10022142 3300014497 Bacteria 3255
17 Ga0182007_10000596 3300015262 Bacteria 21115
18 Ga0183367_1009 3300015688 Bacteria 484598
19 Ga0197907_11152192 3300020069 Bacteria 2143
20 Ga0206354_10817537 3300020081 Bacteria 2124
21 Ga0209676_1001099 3300025292 Bacteria 30043
22 Ga0209758_1009735 3300025297 Bacteria 5904
23 Ga0209050_1022267 3300025298 Bacteria 2275
24 Ga0207713_1025026 3300025735 Bacteria 2765
25 Ga0207647_10093914 3300025904 Bacteria 1787
26 Ga0207639_10096175 3300026041 Bacteria 2382
27 Ga0209371_1011240 3300027312 Bacteria 2672
28 Ga0209968_1016274 3300027526 Unclassified 1181
29 Ga0268265_10133830 3300028380 Unclassified 2065
30 Ga0307517_10027239 3300028786 Bacteria 6873
31 Ga0307515_10000262 3300028794 Bacteria 130525
32 Ga0307515_10103448 3300028794 Bacteria 3413
33 Ga0268256_1017375 3300030500 Bacteria 2027
34 Ga0307511_10000928 3300030521 Bacteria 30993
35 Ga0307511_10083341 3300030521 Bacteria 2228
36 Ga0307513_10008634 3300031456 Bacteria 12986
37 Ga0307513_10043841 3300031456 Bacteria 4908
38 Ga0307513_10047114 3300031456 Bacteria 4692
39 Ga0307509_10039292 3300031507 Bacteria 5156
40 Ga0307508_10002597 3300031616 Bacteria 19002
41 Ga0316575_10003550 3300031665 Bacteria 5394
42 Ga0316579_10018401 3300031691 Bacteria 3075
43 Ga0316576_10008213 3300031727 Bacteria 6636
44 Ga0316576_10045496 3300031727 Bacteria 3173
45 Ga0316578_10001743 3300031728 Bacteria 9109
46 Ga0316578_10044220 3300031728 Bacteria 2590
47 Ga0307516_10003019 3300031730 Bacteria 21949
48 Ga0307516_10056659 3300031730 Bacteria 3821
49 Ga0307518_10116223 3300031838 Bacteria 1900
50 Ga0307410_10066387 3300031852 Bacteria 2485
51 Ga0307410_10261254 3300031852 Bacteria 1350
52 Ga0307407_10023023 3300031903 Bacteria 3244
53 Ga0307409_100008005 3300031995 Bacteria 6371
54 Ga0307409_100219172 3300031995 Bacteria 1716
55 Ga0307416_100052458 3300032002 Bacteria 3265
56 Ga0307414_10000242 3300032004 Bacteria 34787
57 Ga0307415_100003473 3300032126 Bacteria 8033
58 Ga0316585_10000480 3300032137 Bacteria 9420
59 Ga0316580_10001983 3300032139 Bacteria 5527
60 Ga0307507_10006930 3300033179 Bacteria 16871
61 Ga0307510_10049110 3300033180 Bacteria 4492
62 Ga0307510_10069480 3300033180 Bacteria 3527
63 Ga0316574_0004734 3300035398 Bacteria 7181
64 Ga0316574_0055120 3300035398 Bacteria 2484
65 Ga0316582_0013753 3300036647 Bacteria 4565
66 Ga0316582_0067189 3300036647 Bacteria 2312
67 Ga0316584_0020279 3300036712 Bacteria 4816
68 Ga0316584_0096456 3300036712 Bacteria 2213
69 Ga0316584_0104839 3300036712 Bacteria 2116
70 Ga0395899_0007522 3300037312 Bacteria 8419
71 Ga0395900_0116256 3300037418 Bacteria 2745
72 Ga0395898_0013495 3300037466 Bacteria 8412
73 Ga0395898_0020277 3300037466 Bacteria 6753
74 Ga0395898_0133203 3300037466 Bacteria 2380
75 Ga0395901_0477965 3300038443 Bacteria 1271
76 Ga0439439_0020381 3300041406 Bacteria 1648
77 Ga0439433_0005633 3300041999 Bacteria 2688
78 Ga0439448_0001042 3300042005 Bacteria 6935
79 Ga0439449_0019468 3300042007 Bacteria 2544
80 Ga0439450_038356 3300042008 Bacteria 1104
81 Ga0439457_000686 3300042014 Bacteria 10018
82 Ga0439457_000747 3300042014 Bacteria 9683
83 Ga0439457_003347 3300042014 Bacteria 4380
84 Ga0439462_0017682 3300042015 Bacteria 1847
85 Ga0450894_005189 3300042131 Bacteria 1684
86 Ga0450896_005400 3300042133 Bacteria 1743
87 Ga0450898_001702 3300042134 Bacteria 2954
88 Ga0450899_000986 3300042135 Bacteria 3220
89 Ga0450906_003221 3300042145 Bacteria 3524
90 Ga0439458_0000129 3300042157 Bacteria 15799
91 Ga0450908_004810 3300042184 Bacteria 2597
92 Ga0451577_0191890 3300042876 Bacteria 1843
93 Ga0466969_0102586 3300044656 Bacteria 1345
94 Ga0466972_0021667 3300044658 Bacteria 3202
95 Ga0466972_0021856 3300044658 Bacteria 3187
96 Ga0466972_0051860 3300044658 Bacteria 1978
97 Ga0466965_0000323 3300044683 Bacteria 16008
98 Ga0466965_0019207 3300044683 Bacteria 3282
99 Ga0466965_0041364 3300044683 Bacteria 2271
100 Ga0466965_0121871 3300044683 Bacteria 1347
101 Ga0466966_0000906 3300044684 Bacteria 18841
102 Ga0466966_0002905 3300044684 Bacteria 11294
103 Ga0466966_0005859 3300044684 Bacteria 8104
104 Ga0466961_0004990 3300044693 Bacteria 8341
105 Ga0466961_0006324 3300044693 Bacteria 7520
106 Ga0466961_0024973 3300044693 Bacteria 3845
107 Ga0466963_0000356 3300044694 Bacteria 20688
108 Ga0466963_0000390 3300044694 Bacteria 20004
109 Ga0466964_0010533 3300044706 Bacteria 3489
110 Ga0453684_0523504 3300044712 Bacteria 1310
111 Ga0466971_0001789 3300044719 Bacteria 9115
112 Ga0466971_0015726 3300044719 Bacteria 3332
113 Ga0466970_0001058 3300044765 Bacteria 13331
114 Ga0466970_0056258 3300044765 Bacteria 2102
115 Ga0466957_0000583 3300044842 Bacteria 18472
116 Ga0466957_0023625 3300044842 Bacteria 3635
117 Ga0466959_0001064 3300045049 Bacteria 16430
118 Ga0466959_0144402 3300045049 Bacteria 1680
119 Ga0466959_0145127 3300045049 Bacteria 1675
120 Ga0466958_0004057 3300045836 Bacteria 7681
121 Ga0466967_0022213 3300045976 Bacteria 5171
122 Ga0466967_0045895 3300045976 Bacteria 3800
123 Ga0466967_0102429 3300045976 Bacteria 2619
124 Ga0466967_0145573 3300045976 Bacteria 2210
125 Ga0466967_0490411 3300045976 Bacteria 1205
126 Ga0495592_0021216 3300046454 Bacteria 4939
127 Ga0495592_0086791 3300046454 Bacteria 2252
128 Ga0495603_0018613 3300046455 Bacteria 4202
129 Ga0495603_0018964 3300046455 Bacteria 4164
130 Ga0495629_0001804 3300046459 Bacteria 16777
131 Ga0495629_0002094 3300046459 Bacteria 15472
132 Ga0495629_0006416 3300046459 Bacteria 8718
133 Ga0495629_0129682 3300046459 Bacteria 1756
134 Ga0495638_0077263 3300046460 Bacteria 2027
135 Ga0495638_0154988 3300046460 Bacteria 1326
136 Ga0495582_0166473 3300046473 Bacteria 1254
137 Ga0495605_0005570 3300046474 Bacteria 7327
138 Ga0495662_0007500 3300046476 Bacteria 5389
139 Ga0495662_0008632 3300046476 Bacteria 5007
140 Ga0495664_0050740 3300046477 Bacteria 2463
141 Ga0495664_0113404 3300046477 Bacteria 1637
142 Ga0495584_0019110 3300046491 Bacteria 3479
143 Ga0495585_0029395 3300046492 Bacteria 3128
144 Ga0495585_0115060 3300046492 Bacteria 1427
145 Ga0495594_0000244 3300046499 Bacteria 26387
146 Ga0495596_0032205 3300046500 Bacteria 2091
147 Ga0495606_0021343 3300046507 Bacteria 4744
148 Ga0495608_0252491 3300046511 Bacteria 1099
149 Ga0495618_0006372 3300046514 Bacteria 7166
150 Ga0495628_0023816 3300046516 Bacteria 5020
151 Ga0495630_0085165 3300046517 Bacteria 2386
152 Ga0495631_0001322 3300046518 Bacteria 15182
153 Ga0495631_0036813 3300046518 Bacteria 2183
154 Ga0495632_0073447 3300046519 Bacteria 1640
155 Ga0495644_0054638 3300046523 Bacteria 1500
156 Ga0495648_0032917 3300046524 Bacteria 3393
157 Ga0495666_0027977 3300046526 Bacteria 2774
158 Ga0495652_0027089 3300046529 Bacteria 5053
159 Ga0495652_0332329 3300046529 Bacteria 1094
160 Ga0495640_0017052 3300046533 Bacteria 5420
161 Ga0495640_0043406 3300046533 Bacteria 3132
162 Ga0495587_0001052 3300046536 Bacteria 18175
163 Ga0495609_0045769 3300046538 Bacteria 1960
164 Ga0495645_0026051 3300046543 Bacteria 4244
165 Ga0495622_0084035 3300046557 Bacteria 1464
166 Ga0495633_0054250 3300046558 Bacteria 1885
167 Ga0495667_0071703 3300046559 Bacteria 2259
168 Ga0495634_0001072 3300046642 Bacteria 25558
169 Ga0495634_0113054 3300046642 Bacteria 1744
170 Ga0495611_0070756 3300046648 Bacteria 1594
171 Ga0495625_0076895 3300046660 Bacteria 2333
172 Ga0495625_0109916 3300046660 Bacteria 1885
173 Ga0495635_0239887 3300046663 Bacteria 1223
174 Ga0495661_0029447 3300046665 Bacteria 3504
175 Ga0495588_0001576 3300046674 Bacteria 9749
176 Ga0495588_0005714 3300046674 Bacteria 5548
177 Ga0495657_0006771 3300046675 Bacteria 8934
178 Ga0495657_0047918 3300046675 Bacteria 2886
179 Ga0495599_0093350 3300046678 Bacteria 1878
180 Ga0495623_0107932 3300046679 Bacteria 1690
181 Ga0495646_0000925 3300046680 Bacteria 16689
182 Ga0495646_0191661 3300046680 Bacteria 1117
183 Ga0495613_0008641 3300046689 Bacteria 7556
184 Ga0495613_0066824 3300046689 Bacteria 2624
185 Ga0495613_0075745 3300046689 Bacteria 2449
186 Ga0495624_0056308 3300046690 Bacteria 2474
187 Ga0495624_0206092 3300046690 Bacteria 1193
188 Ga0495670_0036028 3300046691 Bacteria 2465
189 Ga0495671_0074997 3300046692 Bacteria 1659
190 Ga0495671_0132699 3300046692 Bacteria 1214
191 Ga0495671_0149827 3300046692 Bacteria 1136
192 Ga0495589_0009280 3300046794 Bacteria 5115
193 Ga0495589_0024779 3300046794 Bacteria 3048
194 Ga0495589_0036693 3300046794 Bacteria 2456
195 Ga0495589_0051540 3300046794 Bacteria 2035
196 Ga0495589_0085199 3300046794 Bacteria 1535
197 Ga0495600_0074706 3300046809 Bacteria 2213
198 Ga0495600_0130153 3300046809 Bacteria 1636
199 Ga0495660_0025981 3300046810 Bacteria 3322
200 Ga0495581_0062443 3300047315 Bacteria 2152
201 Ga0495581_0083351 3300047315 Bacteria 1852
202 Ga0495604_0000177 3300047317 Bacteria 56559
203 Ga0495604_0034767 3300047317 Bacteria 3985
204 Ga0495636_0001704 3300047318 Bacteria 8381
205 Ga0495636_0027511 3300047318 Bacteria 2316
206 Ga0495636_0030890 3300047318 Bacteria 2193
207 Ga0495674_0079214 3300047319 Bacteria 2822
208 Ga0495676_0012929 3300047321 Bacteria 7509
209 Ga0495676_0043504 3300047321 Bacteria 3673
210 Ga0495676_0045023 3300047321 Bacteria 3595
211 Ga0495676_0220999 3300047321 Bacteria 1305
212 Ga0495680_0021131 3300047322 Bacteria 5455
213 Ga0495683_0026377 3300047323 Bacteria 2974
214 Ga0495687_014209 3300047443 Bacteria 4111
215 Ga0495687_038858 3300047443 Bacteria 2109
216 Ga0495675_0016289 3300047444 Bacteria 4702
217 Ga0495675_0110457 3300047444 Bacteria 1716
218 Ga0495675_0124329 3300047444 Bacteria 1605
219 Ga0495685_001606 3300047447 Bacteria 6971
220 Ga0495685_002065 3300047447 Bacteria 6244
221 Ga0495685_023311 3300047447 Bacteria 2131
222 Ga0495685_036069 3300047447 Bacteria 1698
223 Ga0495685_045792 3300047447 Bacteria 1489
224 Ga0495681_0000764 3300047470 Bacteria 24797
225 Ga0495681_0064395 3300047470 Bacteria 1679
226 Ga0495681_0126705 3300047470 Bacteria 1090
227 Ga0495686_0024014 3300047472 Bacteria 4010
228 Ga0495593_0001475 3300047673 Bacteria 13813
229 Ga0495593_0088551 3300047673 Bacteria 1595
230 Ga0495602_0094888 3300048088 Bacteria 2464
231 Ga0495614_0002145 3300048089 Bacteria 8736
232 Ga0495614_0006761 3300048089 Bacteria 5130
233 Ga0495614_0089464 3300048089 Bacteria 1338
234 Ga0496101_0417946 3300048904 Bacteria 1057
235 Ga0496102_0172130 3300048905 Bacteria 2038
236 Ga0496103_0071535 3300048906 Bacteria 2171
237 Ga0496104_0172416 3300048907 Bacteria 2074
238 Ga0496105_0029676 3300048908 Bacteria 4477
239 Ga0496108_0100973 3300048911 Bacteria 2461
240 Ga0496109_0037466 3300048912 Bacteria 4380
241 Ga0496110_0007135 3300048913 Bacteria 8896
242 Ga0496111_0268676 3300048914 Bacteria 1265
243 Ga0496112_0068497 3300048915 Bacteria 3504
244 Ga0496114_0034581 3300048917 Bacteria 4170
245 Ga0496114_0509846 3300048917 Bacteria 1064
246 Ga0501309_003709 3300049129 Bacteria 1744
247 Ga0501310_007915 3300049130 Bacteria 1145
248 Ga0501307_008192 3300049162 Bacteria 1169
249 Ga0495678_037376 3300049459 Bacteria 1973
250 Ga0501311_007502 3300049527 Bacteria 1257
251 Ga0501312_011148 3300049528 Bacteria 1216
252 Ga0501313_007020 3300049529 Bacteria 1234
253 Ga0501316_003146 3300049532 Bacteria 1584
254 Ga0501318_002573 3300049534 Bacteria 1586
255 Ga0501319_001948 3300049535 Bacteria 1262
256 Ga0501320_005635 3300049536 Bacteria 1148
257 Ga0501323_004268 3300049539 Bacteria 1505
258 Ga0501323_006850 3300049539 Bacteria 1284
259 Ga0501324_003527 3300049540 Bacteria 1203
260 Ga0501031_0003645 3300049568 Bacteria 9912
261 Ga0501032_0004518 3300049569 Bacteria 10466
262 Ga0501032_0010218 3300049569 Bacteria 6775
263 Ga0501032_0053760 3300049569 Bacteria 2711
264 Ga0501033_0006266 3300049570 Bacteria 9324
265 Ga0501033_0044082 3300049570 Bacteria 3320
266 Ga0501033_0046615 3300049570 Bacteria 3222
267 Ga0501034_0035145 3300049571 Bacteria 5082
268 Ga0501034_0073801 3300049571 Bacteria 3420
269 Ga0501036_0000116 3300049572 Bacteria 49710
270 Ga0501036_0017427 3300049572 Bacteria 6004
271 Ga0501036_0028775 3300049572 Bacteria 4696
272 Ga0501037_0017754 3300049573 Bacteria 5236
273 Ga0501038_0024578 3300049574 Bacteria 5373
274 Ga0501038_0032149 3300049574 Bacteria 4631
275 Ga0501038_0104937 3300049574 Bacteria 2348
276 Ga0501038_0151723 3300049574 Bacteria 1889
277 Ga0501039_0004035 3300049575 Bacteria 11033
278 Ga0501039_0159212 3300049575 Bacteria 1774
279 Ga0501042_0055754 3300049578 Bacteria 2820
280 Ga0501043_0052887 3300049579 Bacteria 3189
281 Ga0501043_0123369 3300049579 Bacteria 2031
282 Ga0501046_0042167 3300049580 Bacteria 3638
283 Ga0501046_0323929 3300049580 Bacteria 1123
284 Ga0501047_0038128 3300049581 Bacteria 4648
285 Ga0501047_0071902 3300049581 Bacteria 3329
286 Ga0501047_0148818 3300049581 Bacteria 2217
287 Ga0501048_0025698 3300049582 Bacteria 4290
288 Ga0501070_0000283 3300049586 Bacteria 47512
289 Ga0501070_0004008 3300049586 Bacteria 12659
290 Ga0501070_0377585 3300049586 Bacteria 1148
291 Ga0501074_0007556 3300049590 Bacteria 7864
292 Ga0501035_0025154 3300049822 Bacteria 5457
293 Ga0501035_0086309 3300049822 Bacteria 2765
294 Ga0501044_0017451 3300049823 Bacteria 7701
295 Ga0501044_0056830 3300049823 Bacteria 4017
296 Ga0501044_0075131 3300049823 Bacteria 3431
297 Ga0501044_0079787 3300049823 Bacteria 3315
298 nmdc:mga03n38_54638_c1 3300050490 Bacteria 1796
299 nmdc:mga03n38_84312_c1 3300050490 Bacteria 1500
300 nmdc:mga0yw44_61900_c1 3300050492 Bacteria 2297
301 nmdc:mga06z11_2317_c1 3300050494 Bacteria 7247
302 Ga0495619_0177820 3300053085 Bacteria 1472
303 Ga0500640_047175 3300053095 Bacteria 1888
304 Ga0500572_008093 3300053111 Bacteria 2449
305 Ga0587084_001220 3300059477 Bacteria 2384
306 Ga0587084_001963 3300059477 Bacteria 2056
307 Ga0587080_003400 3300059503 Bacteria 1976
308 Ga0587083_0003245 3300059505 Bacteria 2135
309 Ga0587088_000951 3300059508 Bacteria 2778
310 Ga0587090_001854 3300059510 Bacteria 2215
311 Ga0587094_000812 3300059513 Bacteria 2689
312 Ga0587062_001621 3300059639 Bacteria 1990
313 Ga0587067_001590 3300059640 Bacteria 2506
314 Ga0587072_002353 3300059643 Bacteria 2512
315 Ga0587075_001116 3300059644 Bacteria 2497
316 Ga0587078_000839 3300059646 Bacteria 2520
317 Ga0587071_001334 3300060344 Bacteria 3039
318 Ga0587111_0001573 3300060346 Bacteria 2798
319 Ga0466962_0001300 3300061719 Bacteria 11530
320 2547407814 2547132111 Bacteria 8013147
321 2585308375 2582581313 Bacteria 10042643
322 2585313189 2582581314 Bacteria 11452267
323 2616694655 2616644814 Bacteria 11555299
324 2616899762 2616644941 Bacteria 8510691
325 2643832278 2643221563 Bacteria 4726935
326 2643874941 2643221572 Bacteria 3614809
327 2644053927 2643221608 Bacteria 4724829
328 2644084558 2643221613 Bacteria 4622396
329 2644268906 2643221647 Bacteria 10741251
330 2644436120 2643221678 Bacteria 9540101
331 2644632022 2643221714 Bacteria 9015452
332 2644667180 2643221721 Bacteria 4486924
333 2784587668 2784132148 Bacteria 8627943
334 2785344595 2784746763 Bacteria 9783172
335 2785368301 2784746768 Bacteria 10036182
336 2786669300 2786546132 Bacteria 10419719
337 2808840946 2808606359 Bacteria 9866990
338 2808875718 2808606365 Bacteria 4301966
339 2809231235 2808606448 Bacteria 8656184
340 2812359246 2811994879 Bacteria 9313447
341 2812481418 2811994917 Bacteria 7761064
342 2852640805 2852635781 Bacteria 8251373
343 2857733110 2857729791 Bacteria 4040535
344 2862288372 2862281513 Bacteria 9621493
345 2862291165 2862290372 Bacteria 7471434
346 2862514000 2862507626 Bacteria 9425308
347 2862582585 2862574272 Bacteria 10567477
348 2863405863 2863404153 Bacteria 9672205
349 2866617307 2866612099 Bacteria 7543886
350 2867432285 2867428634 Bacteria 9590268
351 2875393623 2875391855 Bacteria 7600475
352 2877682277 2877676314 Bacteria 9512378
353 2912721175 2912715099 Bacteria 9460473
354 2912725204 2912723979 Bacteria 8557534
355 2919448110 2919446982 Bacteria 3994487
356 2919468432 2919468124 Bacteria 9133025
357 2928121815 2928121344 Bacteria 3972376
358 2935894485 2935890801 Bacteria 4593001
359 2946074904 2946072368 Bacteria 8999607
360 2947230555 2947224130 Bacteria 9938529
361 2954003977 2954002825 Bacteria 9173742
362 2954387409 2954380949 Bacteria 10050426
363 2954675763 2954673503 Bacteria 9685905
364 2954688501 2954682443 Bacteria 9862841
365 2954698239 2954691527 Bacteria 10720516
366 2954703988 2954701450 Bacteria 10834262
367 2954717262 2954711539 Bacteria 10867210
368 2954727230 2954721474 Bacteria 10456478
369 2954734562 2954731030 Bacteria 10243860
370 2954746136 2954740390 Bacteria 10229294
371 2954753459 2954749733 Bacteria 10366972
372 2954765103 2954759201 Bacteria 9358192
373 2990067052 2990059506 Bacteria 9321252
374 3006397315 3006393351 Bacteria 6615579
375 3006501930 3006493962 Bacteria 8825450
376 8008559261 8008558824 Bacteria 10610750
377 8008579800 8008574985 Bacteria 7815457
378 8023630403 8023623736 Bacteria 8593882
379 8048407959 8048406513 Bacteria 8936924
380 8056836734 8056829672 Bacteria 9045328
381 Ga0068853_100070912
382 JGI24735J21928_10035475
383 rootH1_10015258
384 rootL2_10002560
385 rootH1_10033010
386 Ga0055536_1004711
387 Ga0068855_100094329
388 Ga0068862_100154688
389 Ga0075363_100025433
390 Ga0075367_10000724
391 Ga0075428_100338005
392 Ga0111539_10087078
393 Ga0105246_10150924
394 Ga0157369_10201414
395 Ga0157374_10231218
396 Ga0182008_10022142
397 Ga0182007_10000596
398 Ga0183367_1009
399 Ga0197907_11152192
400 Ga0206354_10817537
401 Ga0209676_1001099
402 Ga0209758_1009735
403 Ga0209050_1022267
404 Ga0207713_1025026
405 Ga0207647_10093914
406 Ga0207639_10096175
407 Ga0209371_1011240
408 Ga0209968_1016274
409 Ga0268265_10133830
410 Ga0307517_10027239
411 Ga0307515_10000262
412 Ga0307515_10103448
413 Ga0268256_1017375
414 Ga0307511_10000928
415 Ga0307511_10083341
416 Ga0307513_10008634
417 Ga0307513_10043841
418 Ga0307513_10047114
419 Ga0307509_10039292
420 Ga0307508_10002597
421 Ga0316575_10003550
422 Ga0316579_10018401
423 Ga0316576_10008213
424 Ga0316576_10045496
425 Ga0316578_10001743
426 Ga0316578_10044220
427 Ga0307516_10003019
428 Ga0307516_10056659
429 Ga0307518_10116223
430 Ga0307410_10066387
431 Ga0307410_10261254
432 Ga0307407_10023023
433 Ga0307409_100008005
434 Ga0307409_100219172
435 Ga0307416_100052458
436 Ga0307414_10000242
437 Ga0307415_100003473
438 Ga0316585_10000480
439 Ga0316580_10001983
440 Ga0307507_10006930
441 Ga0307510_10049110
442 Ga0307510_10069480
443 Ga0316574_0004734
444 Ga0316574_0055120
445 Ga0316582_0013753
446 Ga0316582_0067189
447 Ga0316584_0020279
448 Ga0316584_0096456
449 Ga0316584_0104839
450 Ga0395899_0007522
451 Ga0395900_0116256
452 Ga0395898_0013495
453 Ga0395898_0020277
454 Ga0395898_0133203
455 Ga0395901_0477965
456 Ga0439439_0020381
457 Ga0439433_0005633
458 Ga0439448_0001042
459 Ga0439449_0019468
460 Ga0439450_038356
461 Ga0439457_000686
462 Ga0439457_000747
463 Ga0439457_003347
464 Ga0439462_0017682
465 Ga0450894_005189
466 Ga0450896_005400
467 Ga0450898_001702
468 Ga0450899_000986
469 Ga0450906_003221
470 Ga0439458_0000129
471 Ga0450908_004810
472 Ga0451577_0191890
473 Ga0466969_0102586
474 Ga0466972_0021667
475 Ga0466972_0021856
476 Ga0466972_0051860
477 Ga0466965_0000323
478 Ga0466965_0019207
479 Ga0466965_0041364
480 Ga0466965_0121871
481 Ga0466966_0000906
482 Ga0466966_0002905
483 Ga0466966_0005859
484 Ga0466961_0004990
485 Ga0466961_0006324
486 Ga0466961_0024973
487 Ga0466963_0000356
488 Ga0466963_0000390
489 Ga0466964_0010533
490 Ga0453684_0523504
491 Ga0466971_0001789
492 Ga0466971_0015726
493 Ga0466970_0001058
494 Ga0466970_0056258
495 Ga0466957_0000583
496 Ga0466957_0023625
497 Ga0466959_0001064
498 Ga0466959_0144402
499 Ga0466959_0145127
500 Ga0466958_0004057
501 Ga0466967_0022213
502 Ga0466967_0045895
503 Ga0466967_0102429
504 Ga0466967_0145573
505 Ga0466967_0490411
506 Ga0495592_0021216
507 Ga0495592_0086791
508 Ga0495603_0018613
509 Ga0495603_0018964
510 Ga0495629_0001804
511 Ga0495629_0002094
512 Ga0495629_0006416
513 Ga0495629_0129682
514 Ga0495638_0077263
515 Ga0495638_0154988
516 Ga0495582_0166473
517 Ga0495605_0005570
518 Ga0495662_0007500
519 Ga0495662_0008632
520 Ga0495664_0050740
521 Ga0495664_0113404
522 Ga0495584_0019110
523 Ga0495585_0029395
524 Ga0495585_0115060
525 Ga0495594_0000244
526 Ga0495596_0032205
527 Ga0495606_0021343
528 Ga0495608_0252491
529 Ga0495618_0006372
530 Ga0495628_0023816
531 Ga0495630_0085165
532 Ga0495631_0001322
533 Ga0495631_0036813
534 Ga0495632_0073447
535 Ga0495644_0054638
536 Ga0495648_0032917
537 Ga0495666_0027977
538 Ga0495652_0027089
539 Ga0495652_0332329
540 Ga0495640_0017052
541 Ga0495640_0043406
542 Ga0495587_0001052
543 Ga0495609_0045769
544 Ga0495645_0026051
545 Ga0495622_0084035
546 Ga0495633_0054250
547 Ga0495667_0071703
548 Ga0495634_0001072
549 Ga0495634_0113054
550 Ga0495611_0070756
551 Ga0495625_0076895
552 Ga0495625_0109916
553 Ga0495635_0239887
554 Ga0495661_0029447
555 Ga0495588_0001576
556 Ga0495588_0005714
557 Ga0495657_0006771
558 Ga0495657_0047918
559 Ga0495599_0093350
560 Ga0495623_0107932
561 Ga0495646_0000925
562 Ga0495646_0191661
563 Ga0495613_0008641
564 Ga0495613_0066824
565 Ga0495613_0075745
566 Ga0495624_0056308
567 Ga0495624_0206092
568 Ga0495670_0036028
569 Ga0495671_0074997
570 Ga0495671_0132699
571 Ga0495671_0149827
572 Ga0495589_0009280
573 Ga0495589_0024779
574 Ga0495589_0036693
575 Ga0495589_0051540
576 Ga0495589_0085199
577 Ga0495600_0074706
578 Ga0495600_0130153
579 Ga0495660_0025981
580 Ga0495581_0062443
581 Ga0495581_0083351
582 Ga0495604_0000177
583 Ga0495604_0034767
584 Ga0495636_0001704
585 Ga0495636_0027511
586 Ga0495636_0030890
587 Ga0495674_0079214
588 Ga0495676_0012929
589 Ga0495676_0043504
590 Ga0495676_0045023
591 Ga0495676_0220999
592 Ga0495680_0021131
593 Ga0495683_0026377
594 Ga0495687_014209
595 Ga0495687_038858
596 Ga0495675_0016289
597 Ga0495675_0110457
598 Ga0495675_0124329
599 Ga0495685_001606
600 Ga0495685_002065
601 Ga0495685_023311
602 Ga0495685_036069
603 Ga0495685_045792
604 Ga0495681_0000764
605 Ga0495681_0064395
606 Ga0495681_0126705
607 Ga0495686_0024014
608 Ga0495593_0001475
609 Ga0495593_0088551
610 Ga0495602_0094888
611 Ga0495614_0002145
612 Ga0495614_0006761
613 Ga0495614_0089464
614 Ga0496101_0417946
615 Ga0496102_0172130
616 Ga0496103_0071535
617 Ga0496104_0172416
618 Ga0496105_0029676
619 Ga0496108_0100973
620 Ga0496109_0037466
621 Ga0496110_0007135
622 Ga0496111_0268676
623 Ga0496112_0068497
624 Ga0496114_0034581
625 Ga0496114_0509846
626 Ga0501309_003709
627 Ga0501310_007915
628 Ga0501307_008192
629 Ga0495678_037376
630 Ga0501311_007502
631 Ga0501312_011148
632 Ga0501313_007020
633 Ga0501316_003146
634 Ga0501318_002573
635 Ga0501319_001948
636 Ga0501320_005635
637 Ga0501323_004268
638 Ga0501323_006850
639 Ga0501324_003527
640 Ga0501031_0003645
641 Ga0501032_0004518
642 Ga0501032_0010218
643 Ga0501032_0053760
644 Ga0501033_0006266
645 Ga0501033_0044082
646 Ga0501033_0046615
647 Ga0501034_0035145
648 Ga0501034_0073801
649 Ga0501036_0000116
650 Ga0501036_0017427
651 Ga0501036_0028775
652 Ga0501037_0017754
653 Ga0501038_0024578
654 Ga0501038_0032149
655 Ga0501038_0104937
656 Ga0501038_0151723
657 Ga0501039_0004035
658 Ga0501039_0159212
659 Ga0501042_0055754
660 Ga0501043_0052887
661 Ga0501043_0123369
662 Ga0501046_0042167
663 Ga0501046_0323929
664 Ga0501047_0038128
665 Ga0501047_0071902
666 Ga0501047_0148818
667 Ga0501048_0025698
668 Ga0501070_0000283
669 Ga0501070_0004008
670 Ga0501070_0377585
671 Ga0501074_0007556
672 Ga0501035_0025154
673 Ga0501035_0086309
674 Ga0501044_0017451
675 Ga0501044_0056830
676 Ga0501044_0075131
677 Ga0501044_0079787
678 nmdc:mga03n38_54638_c1
679 nmdc:mga03n38_84312_c1
680 nmdc:mga0yw44_61900_c1
681 nmdc:mga06z11_2317_c1
682 Ga0495619_0177820
683 Ga0500640_047175
684 Ga0500572_008093
685 Ga0587084_001220
686 Ga0587084_001963
687 Ga0587080_003400
688 Ga0587083_0003245
689 Ga0587088_000951
690 Ga0587090_001854
691 Ga0587094_000812
692 Ga0587062_001621
693 Ga0587067_001590
694 Ga0587072_002353
695 Ga0587075_001116
696 Ga0587078_000839
697 Ga0587071_001334
698 Ga0587111_0001573
699 Ga0466962_0001300
700 2547407814
701 2585308375
702 2585313189
703 2616694655
704 2616899762
705 2643832278
706 2643874941
707 2644053927
708 2644084558
709 2644268906
710 2644436120
711 2644632022
712 2644667180
713 2784587668
714 2785344595
715 2785368301
716 2786669300
717 2808840946
718 2808875718
719 2809231235
720 2812359246
721 2812481418
722 2852640805
723 2857733110
724 2862288372
725 2862291165
726 2862514000
727 2862582585
728 2863405863
729 2866617307
730 2867432285
731 2875393623
732 2877682277
733 2912721175
734 2912725204
735 2919448110
736 2919468432
737 2928121815
738 2935894485
739 2946074904
740 2947230555
741 2954003977
742 2954387409
743 2954675763
744 2954688501
745 2954698239
746 2954703988
747 2954717262
748 2954727230
749 2954734562
750 2954746136
751 2954753459
752 2954765103
753 2990067052
754 3006397315
755 3006501930
756 8008559261
757 8008579800
758 8023630403
759 8048407959
760 8056836734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

40

147

0.99

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

192

328

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

226

366

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9747 17 348
4b7x-assembly1.cif.gz_H crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9735 17 348
4b7x-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9735 19 348
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9728 125 344
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9716 17 348
ID Description Score Start End Superfamily
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9747 24 245 3.40.50.2300
4b7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.973 141 316 3.40.50.720
af_Q2QVJ8_160_339_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9715 165 342 3.40.50.720
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9707 19 139 3.90.180.10
af_Q9C0Y6_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9687 148 317 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2Z4V4R3-F1-model_v4 NADP-dependent oxidoreductase 0.9926 14 348 GO:0016628
AF-A0A1I4CQL0-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9923 14 348 GO:0016628
AF-A0A7W7ZYM1-F1-model_v4 NADPH-dependent curcumin reductase CurA 0.9921 18 348 GO:0016628
AF-A0A6B3GS61-F1-model_v4 NADP-dependent oxidoreductase 0.9875 101 201 GO:0016628
AF-A0A6B3CAQ7-F1-model_v4 Zinc-binding dehydrogenase 0.9874 206 341 GO:0016628

Map