F428532

General Info

Members Datasets Scaffolds Average Seq Length
380 255 760 406

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10042093|JGI25406J46586_100420931
Length 441
Sequence MASPSSSRNREPVIVAGGGIGGLAAALALARKGFRSVVLEQAPQFGEIGAGIQIAPNAWHALDALGVGALVKKEAVFIEHLLMMDGVSGEKVIDIPLDARFAKRFANPYAVTHRADIHGSLVDGCKALPQMIDLRTNXRVTGFDIADRGVRVRLASGEVINGAALVGADGAKSVVRDALVGDQLPASTIHKCYRAVLNAGDVPKDLRWAAATLWAAHDTHIVHYPLRGWKLFNLVATAIGQPISEGHAAVATPEEVLPQFAHFCEKPLKLMGTPKQFTRWMLRFRDPVDNWIKGPVALLGDAAHLMLQYMAQGAAMAMEDAVALGFACDATDGDFEKAFKRYQEMRLVRASRMHISANSLVGQIFHVPDGLLRLVRNDIFIGRSPERYYDALEWVFAAPDYVRQFKAASPARRPAATVAHRAKPLKRAAARKRRPPSRQRS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
247 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
248 2643221609 Acidovorax sp. Root217 Isolate Unclassified
249 2643221611 Acidovorax sp. Root219 Isolate Unclassified
250 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
251 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
252 2738543012 Acidovorax sp. CF301 Isolate Unclassified
253 2816332133 Acidovorax radicis 2721A Isolate Unclassified
254 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
255 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 0
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 0
Rhizoplane 0.79
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10042093 3300003203 Bacteria 1602
2 JGI25151J46595_10012322 3300003187 Bacteria 3896
3 Ga0055538_1000053 3300003751 Bacteria 127408
4 Ga0055539_1000078 3300003752 Bacteria 127408
5 Ga0055533_1000084 3300003756 Bacteria 127408
6 Ga0055525_1000112 3300003759 Bacteria 127408
7 Ga0055541_1000055 3300003841 Bacteria 127408
8 Ga0065707_10003532 3300005295 Bacteria 4112
9 Ga0070690_100000398 3300005330 Bacteria 21982
10 Ga0070670_100181067 3300005331 Bacteria 1830
11 Ga0068869_100000982 3300005334 Bacteria 16552
12 Ga0070680_100001158 3300005336 Bacteria 18956
13 Ga0070680_100002637 3300005336 Bacteria 13291
14 Ga0070680_100154412 3300005336 Bacteria 1928
15 Ga0070682_100001096 3300005337 Bacteria 15544
16 Ga0068868_100000097 3300005338 Bacteria 54209
17 Ga0068868_100001858 3300005338 Bacteria 14495
18 Ga0070689_100000188 3300005340 Bacteria 37400
19 Ga0070689_100185035 3300005340 Bacteria 1694
20 Ga0070691_10000867 3300005341 Bacteria 12254
21 Ga0070687_100000069 3300005343 Bacteria 33055
22 Ga0070692_10006007 3300005345 Bacteria 5232
23 Ga0070692_10023260 3300005345 Bacteria 3035
24 Ga0070675_100045415 3300005354 Bacteria 3595
25 Ga0070675_100263582 3300005354 Bacteria 1511
26 Ga0070671_100060748 3300005355 Bacteria 3147
27 Ga0070674_100023097 3300005356 Bacteria 4019
28 Ga0070674_100055859 3300005356 Bacteria 2736
29 Ga0070674_100156966 3300005356 Bacteria 1723
30 Ga0070673_100021371 3300005364 Bacteria 4690
31 Ga0070659_100150123 3300005366 Bacteria 1901
32 Ga0070667_100042093 3300005367 Bacteria 3832
33 Ga0070667_100082626 3300005367 Bacteria 2751
34 Ga0070667_100142689 3300005367 Bacteria 2099
35 Ga0070714_100047357 3300005435 Bacteria 3652
36 Ga0070701_10001237 3300005438 Bacteria 9373
37 Ga0070705_100021866 3300005440 Bacteria 3408
38 Ga0070705_100028403 3300005440 Bacteria 3064
39 Ga0070705_100099211 3300005440 Bacteria 1835
40 Ga0070694_100000562 3300005444 Bacteria 20530
41 Ga0070708_100275993 3300005445 Bacteria 1581
42 Ga0070678_100063113 3300005456 Bacteria 2739
43 Ga0070681_10130580 3300005458 Bacteria 2444
44 Ga0068867_100000296 3300005459 Bacteria 32704
45 Ga0068867_100007181 3300005459 Bacteria 7873
46 Ga0068867_100021885 3300005459 Bacteria 4566
47 Ga0070707_100288563 3300005468 Bacteria 1594
48 Ga0070698_100065246 3300005471 Bacteria 3666
49 Ga0070699_100007220 3300005518 Bacteria 9666
50 Ga0070679_100003737 3300005530 Bacteria 13955
51 Ga0070679_100028971 3300005530 Bacteria 5462
52 Ga0070684_100044478 3300005535 Bacteria 3841
53 Ga0070697_100004195 3300005536 Bacteria 11049
54 Ga0070686_100000090 3300005544 Bacteria 63246
55 Ga0070686_100009181 3300005544 Bacteria 5549
56 Ga0070695_100000188 3300005545 Bacteria 29840
57 Ga0070695_100014991 3300005545 Bacteria 4676
58 Ga0070695_100061041 3300005545 Bacteria 2445
59 Ga0070696_100000719 3300005546 Bacteria 21155
60 Ga0070696_100012269 3300005546 Bacteria 5743
61 Ga0070696_100023207 3300005546 Bacteria 4216
62 Ga0070696_100113081 3300005546 Bacteria 1957
63 Ga0070693_100001033 3300005547 Bacteria 12422
64 Ga0070665_100197899 3300005548 Bacteria 2010
65 Ga0070704_100000064 3300005549 Bacteria 34900
66 Ga0070704_100028481 3300005549 Bacteria 3717
67 Ga0068855_100000833 3300005563 Bacteria 38155
68 Ga0068854_100118356 3300005578 Bacteria 2007
69 Ga0068856_100017695 3300005614 Bacteria 6911
70 Ga0068856_100097720 3300005614 Bacteria 2926
71 Ga0070702_100000002 3300005615 Bacteria 83999
72 Ga0068852_100013608 3300005616 Bacteria 6229
73 Ga0068852_100040325 3300005616 Bacteria 3938
74 Ga0068852_100261332 3300005616 Bacteria 1662
75 Ga0068859_100000195 3300005617 Bacteria 59015
76 Ga0068859_100110587 3300005617 Bacteria 2809
77 Ga0068866_10000037 3300005718 Bacteria 50738
78 Ga0068861_100000043 3300005719 Bacteria 57807
79 Ga0068861_100008107 3300005719 Bacteria 7226
80 Ga0068870_10089116 3300005840 Bacteria 1721
81 Ga0068863_100064274 3300005841 Bacteria 3471
82 Ga0068858_100001438 3300005842 Bacteria 24478
83 Ga0068858_100003921 3300005842 Bacteria 14698
84 Ga0068858_100010244 3300005842 Bacteria 8895
85 Ga0068858_100098980 3300005842 Bacteria 2719
86 Ga0068860_100037967 3300005843 Bacteria 4609
87 Ga0068860_100199310 3300005843 Bacteria 1939
88 Ga0068862_100002188 3300005844 Bacteria 17538
89 Ga0068862_100124357 3300005844 Bacteria 2276
90 Ga0081539_10000233 3300005985 Bacteria 130647
91 Ga0070716_100133675 3300006173 Bacteria 1572
92 Ga0075362_10025222 3300006177 Bacteria 2528
93 Ga0075366_10033949 3300006195 Bacteria 3006
94 Ga0075366_10073618 3300006195 Bacteria 2036
95 Ga0097621_100000045 3300006237 Bacteria 65278
96 Ga0097621_100038135 3300006237 Bacteria 3855
97 Ga0075370_10017440 3300006353 Bacteria 3880
98 Ga0068871_100000040 3300006358 Bacteria 69044
99 Ga0068871_100011962 3300006358 Bacteria 6388
100 Ga0075428_100000047 3300006844 Bacteria 96882
101 Ga0075430_100026031 3300006846 Bacteria 4977
102 Ga0075430_100027080 3300006846 Bacteria 4873
103 Ga0075431_100110914 3300006847 Bacteria 2831
104 Ga0075431_100171945 3300006847 Bacteria 2226
105 Ga0075433_10000605 3300006852 Bacteria 23895
106 Ga0075433_10160131 3300006852 Bacteria 2003
107 Ga0075434_100000414 3300006871 Bacteria 31577
108 Ga0075434_100000554 3300006871 Bacteria 28632
109 Ga0075429_100000067 3300006880 Bacteria 51949
110 Ga0068865_100000343 3300006881 Bacteria 25779
111 Ga0075436_100001082 3300006914 Bacteria 18349
112 Ga0075436_100006380 3300006914 Bacteria 8081
113 Ga0075436_100020290 3300006914 Bacteria 4561
114 Ga0075436_100025180 3300006914 Bacteria 4092
115 Ga0097620_100000195 3300006931 Bacteria 59015
116 Ga0097620_100110586 3300006931 Bacteria 2809
117 Ga0075435_100005507 3300007076 Bacteria 8849
118 Ga0075435_100164420 3300007076 Bacteria 1871
119 Ga0099794_10016726 3300007265 Bacteria 3257
120 Ga0111539_10060108 3300009094 Bacteria 4505
121 Ga0111539_10109701 3300009094 Bacteria 3238
122 Ga0111539_10170777 3300009094 Bacteria 2541
123 Ga0111539_10394330 3300009094 Bacteria 1612
124 Ga0105245_10000306 3300009098 Bacteria 47026
125 Ga0105245_10039479 3300009098 Bacteria 4201
126 Ga0114129_10000040 3300009147 Bacteria 107971
127 Ga0105243_10000035 3300009148 Bacteria 177598
128 Ga0105243_10061389 3300009148 Bacteria 3006
129 Ga0105241_10007746 3300009174 Bacteria 7895
130 Ga0105242_10000097 3300009176 Bacteria 61646
131 Ga0105248_10325757 3300009177 Bacteria 1730
132 Ga0105249_10001837 3300009553 Bacteria 18455
133 Ga0105239_10045568 3300010375 Bacteria 4807
134 Ga0105246_10130091 3300011119 Bacteria 1879
135 Ga0157378_10001996 3300013297 Bacteria 18243
136 Ga0157372_10123993 3300013307 Bacteria 2970
137 Ga0157375_10026773 3300013308 Bacteria 5380
138 Ga0157380_10011181 3300014326 Bacteria 6477
139 Ga0157380_10012013 3300014326 Bacteria 6267
140 Ga0157380_10095688 3300014326 Bacteria 2461
141 Ga0157377_10009512 3300014745 Bacteria 4772
142 Ga0157377_10112989 3300014745 Bacteria 1635
143 Ga0157379_10011288 3300014968 Bacteria 7786
144 Ga0157379_10027084 3300014968 Bacteria 5102
145 Ga0157379_10030223 3300014968 Bacteria 4820
146 Ga0157379_10055699 3300014968 Bacteria 3533
147 Ga0157379_10057874 3300014968 Bacteria 3464
148 Ga0157376_10000403 3300014969 Bacteria 28093
149 Ga0213872_10003582 3300021361 Bacteria 8544
150 Ga0213872_10024053 3300021361 Bacteria 2801
151 Ga0209784_100035 3300025224 Bacteria 299760
152 Ga0209566_100040 3300025225 Bacteria 299760
153 Ga0209674_100057 3300025226 Bacteria 299760
154 Ga0209563_100059 3300025230 Bacteria 299760
155 Ga0209677_100036 3300025253 Bacteria 299760
156 Ga0209025_1000115 3300025294 Bacteria 218871
157 Ga0207642_10004703 3300025899 Bacteria 4411
158 Ga0207642_10072520 3300025899 Bacteria 1643
159 Ga0207645_10008084 3300025907 Bacteria 7379
160 Ga0207643_10028125 3300025908 Bacteria 3120
161 Ga0207654_10018546 3300025911 Bacteria 3654
162 Ga0207707_10002138 3300025912 Bacteria 17899
163 Ga0207660_10041212 3300025917 Bacteria 3235
164 Ga0207660_10042158 3300025917 Bacteria 3202
165 Ga0207662_10000006 3300025918 Bacteria 105457
166 Ga0207652_10002034 3300025921 Bacteria 17425
167 Ga0207652_10017870 3300025921 Bacteria 5810
168 Ga0207646_10013083 3300025922 Bacteria 7947
169 Ga0207646_10105624 3300025922 Bacteria 2526
170 Ga0207659_10032236 3300025926 Bacteria 3594
171 Ga0207659_10032882 3300025926 Bacteria 3564
172 Ga0207687_10002839 3300025927 Bacteria 11755
173 Ga0207664_10273393 3300025929 Bacteria 1480
174 Ga0207644_10031597 3300025931 Bacteria 3690
175 Ga0207644_10036732 3300025931 Bacteria 3441
176 Ga0207690_10127157 3300025932 Bacteria 1860
177 Ga0207706_10054169 3300025933 Bacteria 3540
178 Ga0207686_10000690 3300025934 Bacteria 20922
179 Ga0207709_10003054 3300025935 Bacteria 10125
180 Ga0207670_10009171 3300025936 Bacteria 5628
181 Ga0207670_10084516 3300025936 Bacteria 2228
182 Ga0207670_10109004 3300025936 Bacteria 1992
183 Ga0207669_10215360 3300025937 Bacteria 1405
184 Ga0207704_10002301 3300025938 Bacteria 8579
185 Ga0207704_10126358 3300025938 Bacteria 1761
186 Ga0207665_10193958 3300025939 Bacteria 1477
187 Ga0207691_10036555 3300025940 Bacteria 4551
188 Ga0207691_10045783 3300025940 Bacteria 4021
189 Ga0207691_10059002 3300025940 Bacteria 3490
190 Ga0207691_10229808 3300025940 Bacteria 1607
191 Ga0207711_10232973 3300025941 Bacteria 1687
192 Ga0207689_10000082 3300025942 Bacteria 76708
193 Ga0207689_10008405 3300025942 Bacteria 8987
194 Ga0207689_10044722 3300025942 Bacteria 3661
195 Ga0207667_10054691 3300025949 Bacteria 4198
196 Ga0207712_10022320 3300025961 Bacteria 4166
197 Ga0207658_10055869 3300025986 Bacteria 2928
198 Ga0207677_10006101 3300026023 Bacteria 6579
199 Ga0207677_10009599 3300026023 Bacteria 5446
200 Ga0207677_10034627 3300026023 Bacteria 3272
201 Ga0207703_10009391 3300026035 Bacteria 7688
202 Ga0207678_10189150 3300026067 Bacteria 1759
203 Ga0207708_10004812 3300026075 Bacteria 9943
204 Ga0207702_10013289 3300026078 Bacteria 6847
205 Ga0207648_10000300 3300026089 Bacteria 53912
206 Ga0207648_10007584 3300026089 Bacteria 10641
207 Ga0207648_10010566 3300026089 Bacteria 8736
208 Ga0207648_10109129 3300026089 Bacteria 2429
209 Ga0207676_10069132 3300026095 Bacteria 2827
210 Ga0207674_10153898 3300026116 Bacteria 2255
211 Ga0207674_10320120 3300026116 Bacteria 1500
212 Ga0207675_100000064 3300026118 Bacteria 79279
213 Ga0207683_10024014 3300026121 Bacteria 5247
214 Ga0207698_10006461 3300026142 Bacteria 7316
215 Ga0210000_1000809 3300027462 Bacteria 4332
216 Ga0209983_1006467 3300027665 Bacteria 2406
217 Ga0209971_1009358 3300027682 Bacteria 2322
218 Ga0207428_10001387 3300027907 Bacteria 25585
219 Ga0268266_10032241 3300028379 Bacteria 4452
220 Ga0268265_10002988 3300028380 Bacteria 12355
221 Ga0268265_10005451 3300028380 Bacteria 8692
222 Ga0268264_10001394 3300028381 Bacteria 22601
223 Ga0268264_10030457 3300028381 Bacteria 4423
224 Ga0268264_10249497 3300028381 Bacteria 1648
225 Ga0307515_10101926 3300028794 Bacteria 3459
226 Ga0265332_10002264 3300031238 Bacteria 9857
227 Ga0307513_10002887 3300031456 Bacteria 23517
228 Ga0307516_10001281 3300031730 Bacteria 34984
229 Ga0307516_10058155 3300031730 Bacteria 3765
230 Ga0307516_10095035 3300031730 Bacteria 2804
231 Ga0373929_0003304 3300035085 Bacteria 2915
232 Ga0373929_0018473 3300035085 Bacteria 1386
233 Ga0373940_0012769 3300035088 Bacteria 2017
234 Ga0373949_0005374 3300035090 Bacteria 2859
235 Ga0373932_0001372 3300035112 Bacteria 6829
236 Ga0373939_0000881 3300035114 Bacteria 7446
237 Ga0373939_0010231 3300035114 Bacteria 2340
238 Ga0373941_0007096 3300035115 Bacteria 2728
239 Ga0373954_0001100 3300035118 Bacteria 10800
240 Ga0373943_0058133 3300035170 Bacteria 1924
241 Ga0373946_0017723 3300035171 Bacteria 2727
242 Ga0373962_0002004 3300035242 Bacteria 4854
243 Ga0373924_0015927 3300035410 Bacteria 2865
244 Ga0373931_0003466 3300035691 Bacteria 7086
245 Ga0373931_0005626 3300035691 Bacteria 5813
246 Ga0373931_0009180 3300035691 Bacteria 4723
247 Ga0373931_0017464 3300035691 Bacteria 3550
248 Ga0373931_0030292 3300035691 Bacteria 2784
249 Ga0373935_0019649 3300035692 Bacteria 4118
250 Ga0373927_0032263 3300035695 Bacteria 3411
251 Ga0373933_0005942 3300035724 Bacteria 6640
252 Ga0373933_0007638 3300035724 Bacteria 5903
253 Ga0373937_0001045 3300036401 Bacteria 23385
254 Ga0373937_0040741 3300036401 Bacteria 4235
255 Ga0373937_0057809 3300036401 Bacteria 3563
256 Ga0395898_0226832 3300037466 Bacteria 1782
257 Ga0395905_0001148 3300037471 Bacteria 33147
258 Ga0395905_0002159 3300037471 Bacteria 22302
259 Ga0395905_0050153 3300037471 Bacteria 3912
260 Ga0395905_0269536 3300037471 Bacteria 1588
261 Ga0436365_0787708 3300039437 Bacteria 4532
262 Ga0436361_0088190 3300039447 Bacteria 26184
263 Ga0436361_1015675 3300039447 Bacteria 1878
264 Ga0439453_0002490 3300041408 Bacteria 2549
265 Ga0439441_000324 3300042001 Bacteria 4845
266 Ga0439460_0008868 3300042461 Bacteria 2542
267 Ga0439460_0026394 3300042461 Bacteria 1624
268 Ga0451577_0001465 3300042876 Bacteria 31307
269 Ga0451577_0079966 3300042876 Bacteria 2914
270 Ga0451576_0000822 3300045051 Bacteria 60600
271 Ga0495590_0033610 3300046457 Bacteria 1793
272 Ga0495629_0000206 3300046459 Bacteria 52609
273 Ga0495629_0103527 3300046459 Bacteria 1986
274 Ga0495653_0080001 3300046463 Bacteria 2419
275 Ga0495650_0000688 3300046471 Bacteria 43681
276 Ga0495580_0013828 3300046472 Bacteria 6144
277 Ga0495582_0012981 3300046473 Bacteria 4590
278 Ga0495639_0013122 3300046475 Bacteria 3575
279 Ga0495662_0003159 3300046476 Bacteria 8313
280 Ga0495664_0029928 3300046477 Bacteria 3187
281 Ga0495630_0016274 3300046517 Bacteria 5433
282 Ga0495630_0107397 3300046517 Bacteria 2114
283 Ga0495643_0006544 3300046522 Bacteria 7666
284 Ga0495640_0023373 3300046533 Bacteria 4504
285 Ga0495586_0043282 3300046535 Bacteria 2425
286 Ga0495586_0049347 3300046535 Bacteria 2275
287 Ga0495587_0108505 3300046536 Bacteria 1596
288 Ga0495597_0020197 3300046542 Bacteria 3106
289 Ga0495645_0000416 3300046543 Bacteria 29363
290 Ga0495645_0004251 3300046543 Bacteria 9782
291 Ga0495668_0033594 3300046616 Bacteria 2881
292 Ga0495659_0047693 3300046664 Bacteria 1550
293 Ga0495661_0030433 3300046665 Bacteria 3437
294 Ga0495657_0072314 3300046675 Bacteria 2249
295 Ga0495669_0010111 3300046684 Bacteria 3985
296 Ga0495613_0057013 3300046689 Bacteria 2868
297 Ga0495624_0056032 3300046690 Bacteria 2481
298 Ga0495589_0007455 3300046794 Bacteria 5733
299 Ga0495581_0010923 3300047315 Bacteria 5250
300 Ga0495604_0108953 3300047317 Bacteria 2022
301 Ga0495604_0116616 3300047317 Bacteria 1938
302 Ga0495636_0046295 3300047318 Bacteria 1814
303 Ga0495674_0116997 3300047319 Bacteria 2255
304 Ga0495680_0063053 3300047322 Bacteria 2847
305 Ga0495687_002139 3300047443 Bacteria 16502
306 Ga0496104_0014478 3300048907 Bacteria 7125
307 Ga0496105_0037385 3300048908 Bacteria 3997
308 Ga0496114_0000931 3300048917 Bacteria 21879
309 Ga0496121_0000511 3300048924 Bacteria 73863
310 Ga0496126_0094680 3300048929 Bacteria 2621
311 Ga0501033_0003135 3300049570 Bacteria 13738
312 Ga0501036_0000778 3300049572 Bacteria 23605
313 Ga0501038_0023557 3300049574 Bacteria 5501
314 Ga0501038_0215323 3300049574 Bacteria 1535
315 Ga0501039_0009480 3300049575 Bacteria 7422
316 Ga0501040_0000808 3300049576 Bacteria 19495
317 Ga0501040_0010031 3300049576 Bacteria 6186
318 Ga0501040_0031728 3300049576 Bacteria 3572
319 Ga0501040_0032649 3300049576 Bacteria 3524
320 Ga0501041_0004667 3300049577 Bacteria 7949
321 Ga0501041_0005636 3300049577 Bacteria 7314
322 Ga0501042_0032257 3300049578 Bacteria 3708
323 Ga0501043_0035904 3300049579 Bacteria 3900
324 Ga0501043_0088611 3300049579 Bacteria 2432
325 Ga0501046_0020754 3300049580 Bacteria 5427
326 Ga0501046_0025673 3300049580 Bacteria 4819
327 Ga0501047_0063450 3300049581 Bacteria 3564
328 Ga0501048_0016370 3300049582 Bacteria 5464
329 Ga0501048_0021903 3300049582 Bacteria 4677
330 Ga0501068_0004020 3300049584 Bacteria 7998
331 Ga0501070_0067027 3300049586 Bacteria 2973
332 Ga0501071_0005010 3300049587 Bacteria 8466
333 Ga0501071_0080750 3300049587 Bacteria 2379
334 Ga0501072_0005483 3300049588 Bacteria 9659
335 Ga0501072_0017479 3300049588 Bacteria 5511
336 Ga0501074_0041642 3300049590 Bacteria 3325
337 Ga0501075_0004928 3300049591 Bacteria 9101
338 Ga0501075_0007259 3300049591 Bacteria 7684
339 Ga0501076_0012570 3300049592 Bacteria 6333
340 Ga0501076_0014667 3300049592 Bacteria 5907
341 Ga0501077_0005485 3300049593 Bacteria 7721
342 Ga0501077_0043433 3300049593 Bacteria 2857
343 Ga0501079_0007800 3300049741 Bacteria 8105
344 Ga0501079_0017859 3300049741 Bacteria 5417
345 Ga0501080_0056773 3300049742 Bacteria 3645
346 Ga0501081_0000810 3300049743 Bacteria 18453
347 Ga0501081_0004980 3300049743 Bacteria 8551
348 Ga0501035_0030604 3300049822 Bacteria 4906
349 Ga0501045_0022182 3300049824 Bacteria 4543
350 nmdc:mga0k408_44979_c1 3300050493 Bacteria 2547
351 nmdc:mga05p37_886_c1 3300050507 Bacteria 33754
352 nmdc:mga09592_335_c1 3300050508 Bacteria 34453
353 nmdc:mga0qj67_6200_c1 3300050509 Bacteria 8774
354 nmdc:mga06r32_276523_c1 3300050510 Bacteria 1666
355 nmdc:mga08y16_127322_c1 3300050511 Bacteria 2649
356 nmdc:mga08y16_1601_c1 3300050511 Bacteria 22883
357 nmdc:mga08y16_187131_c1 3300050511 Bacteria 2148
358 nmdc:mga0n895_16155_c1 3300050512 Bacteria 6842
359 nmdc:mga0n895_2327_c1 3300050512 Bacteria 14807
360 nmdc:mga0n895_75424_c1 3300050512 Bacteria 3352
361 nmdc:mga0rr50_2318_c1 3300050513 Bacteria 10677
362 nmdc:mga08x19_118462_c1 3300050514 Bacteria 1772
363 nmdc:mga08x19_24618_c1 3300050514 Bacteria 3744
364 nmdc:mga08x19_2723_c1 3300050514 Bacteria 10682
365 nmdc:mga0a205_144693_c1 3300050515 Bacteria 2277
366 nmdc:mga0a205_505_c1 3300050515 Bacteria 30610
367 Ga0501084_0001603 3300054114 Bacteria 17927
368 Ga0501084_0171758 3300054114 Bacteria 1830
369 Ga0501082_0015756 3300060353 Bacteria 6502
370 Ga0530510_0010946 3300061734 Bacteria 6364
371 2553005827 2551306416 Bacteria 6152985
372 2574432969 2574179768 Bacteria 4907129
373 2644061292 2643221609 Bacteria 6756331
374 2644076667 2643221611 Bacteria 6820941
375 2644246760 2643221644 Bacteria 6865017
376 2644302587 2643221654 Bacteria 5273570
377 2739243618 2738543012 Bacteria 7115078
378 2816474167 2816332133 Bacteria 7249298
379 2923514607 2923510766 Bacteria 5926163
380 639787577 639633007 Bacteria 4376040
381 JGI25406J46586_10042093
382 JGI25151J46595_10012322
383 Ga0055538_1000053
384 Ga0055539_1000078
385 Ga0055533_1000084
386 Ga0055525_1000112
387 Ga0055541_1000055
388 Ga0065707_10003532
389 Ga0070690_100000398
390 Ga0070670_100181067
391 Ga0068869_100000982
392 Ga0070680_100001158
393 Ga0070680_100002637
394 Ga0070680_100154412
395 Ga0070682_100001096
396 Ga0068868_100000097
397 Ga0068868_100001858
398 Ga0070689_100000188
399 Ga0070689_100185035
400 Ga0070691_10000867
401 Ga0070687_100000069
402 Ga0070692_10006007
403 Ga0070692_10023260
404 Ga0070675_100045415
405 Ga0070675_100263582
406 Ga0070671_100060748
407 Ga0070674_100023097
408 Ga0070674_100055859
409 Ga0070674_100156966
410 Ga0070673_100021371
411 Ga0070659_100150123
412 Ga0070667_100042093
413 Ga0070667_100082626
414 Ga0070667_100142689
415 Ga0070714_100047357
416 Ga0070701_10001237
417 Ga0070705_100021866
418 Ga0070705_100028403
419 Ga0070705_100099211
420 Ga0070694_100000562
421 Ga0070708_100275993
422 Ga0070678_100063113
423 Ga0070681_10130580
424 Ga0068867_100000296
425 Ga0068867_100007181
426 Ga0068867_100021885
427 Ga0070707_100288563
428 Ga0070698_100065246
429 Ga0070699_100007220
430 Ga0070679_100003737
431 Ga0070679_100028971
432 Ga0070684_100044478
433 Ga0070697_100004195
434 Ga0070686_100000090
435 Ga0070686_100009181
436 Ga0070695_100000188
437 Ga0070695_100014991
438 Ga0070695_100061041
439 Ga0070696_100000719
440 Ga0070696_100012269
441 Ga0070696_100023207
442 Ga0070696_100113081
443 Ga0070693_100001033
444 Ga0070665_100197899
445 Ga0070704_100000064
446 Ga0070704_100028481
447 Ga0068855_100000833
448 Ga0068854_100118356
449 Ga0068856_100017695
450 Ga0068856_100097720
451 Ga0070702_100000002
452 Ga0068852_100013608
453 Ga0068852_100040325
454 Ga0068852_100261332
455 Ga0068859_100000195
456 Ga0068859_100110587
457 Ga0068866_10000037
458 Ga0068861_100000043
459 Ga0068861_100008107
460 Ga0068870_10089116
461 Ga0068863_100064274
462 Ga0068858_100001438
463 Ga0068858_100003921
464 Ga0068858_100010244
465 Ga0068858_100098980
466 Ga0068860_100037967
467 Ga0068860_100199310
468 Ga0068862_100002188
469 Ga0068862_100124357
470 Ga0081539_10000233
471 Ga0070716_100133675
472 Ga0075362_10025222
473 Ga0075366_10033949
474 Ga0075366_10073618
475 Ga0097621_100000045
476 Ga0097621_100038135
477 Ga0075370_10017440
478 Ga0068871_100000040
479 Ga0068871_100011962
480 Ga0075428_100000047
481 Ga0075430_100026031
482 Ga0075430_100027080
483 Ga0075431_100110914
484 Ga0075431_100171945
485 Ga0075433_10000605
486 Ga0075433_10160131
487 Ga0075434_100000414
488 Ga0075434_100000554
489 Ga0075429_100000067
490 Ga0068865_100000343
491 Ga0075436_100001082
492 Ga0075436_100006380
493 Ga0075436_100020290
494 Ga0075436_100025180
495 Ga0097620_100000195
496 Ga0097620_100110586
497 Ga0075435_100005507
498 Ga0075435_100164420
499 Ga0099794_10016726
500 Ga0111539_10060108
501 Ga0111539_10109701
502 Ga0111539_10170777
503 Ga0111539_10394330
504 Ga0105245_10000306
505 Ga0105245_10039479
506 Ga0114129_10000040
507 Ga0105243_10000035
508 Ga0105243_10061389
509 Ga0105241_10007746
510 Ga0105242_10000097
511 Ga0105248_10325757
512 Ga0105249_10001837
513 Ga0105239_10045568
514 Ga0105246_10130091
515 Ga0157378_10001996
516 Ga0157372_10123993
517 Ga0157375_10026773
518 Ga0157380_10011181
519 Ga0157380_10012013
520 Ga0157380_10095688
521 Ga0157377_10009512
522 Ga0157377_10112989
523 Ga0157379_10011288
524 Ga0157379_10027084
525 Ga0157379_10030223
526 Ga0157379_10055699
527 Ga0157379_10057874
528 Ga0157376_10000403
529 Ga0213872_10003582
530 Ga0213872_10024053
531 Ga0209784_100035
532 Ga0209566_100040
533 Ga0209674_100057
534 Ga0209563_100059
535 Ga0209677_100036
536 Ga0209025_1000115
537 Ga0207642_10004703
538 Ga0207642_10072520
539 Ga0207645_10008084
540 Ga0207643_10028125
541 Ga0207654_10018546
542 Ga0207707_10002138
543 Ga0207660_10041212
544 Ga0207660_10042158
545 Ga0207662_10000006
546 Ga0207652_10002034
547 Ga0207652_10017870
548 Ga0207646_10013083
549 Ga0207646_10105624
550 Ga0207659_10032236
551 Ga0207659_10032882
552 Ga0207687_10002839
553 Ga0207664_10273393
554 Ga0207644_10031597
555 Ga0207644_10036732
556 Ga0207690_10127157
557 Ga0207706_10054169
558 Ga0207686_10000690
559 Ga0207709_10003054
560 Ga0207670_10009171
561 Ga0207670_10084516
562 Ga0207670_10109004
563 Ga0207669_10215360
564 Ga0207704_10002301
565 Ga0207704_10126358
566 Ga0207665_10193958
567 Ga0207691_10036555
568 Ga0207691_10045783
569 Ga0207691_10059002
570 Ga0207691_10229808
571 Ga0207711_10232973
572 Ga0207689_10000082
573 Ga0207689_10008405
574 Ga0207689_10044722
575 Ga0207667_10054691
576 Ga0207712_10022320
577 Ga0207658_10055869
578 Ga0207677_10006101
579 Ga0207677_10009599
580 Ga0207677_10034627
581 Ga0207703_10009391
582 Ga0207678_10189150
583 Ga0207708_10004812
584 Ga0207702_10013289
585 Ga0207648_10000300
586 Ga0207648_10007584
587 Ga0207648_10010566
588 Ga0207648_10109129
589 Ga0207676_10069132
590 Ga0207674_10153898
591 Ga0207674_10320120
592 Ga0207675_100000064
593 Ga0207683_10024014
594 Ga0207698_10006461
595 Ga0210000_1000809
596 Ga0209983_1006467
597 Ga0209971_1009358
598 Ga0207428_10001387
599 Ga0268266_10032241
600 Ga0268265_10002988
601 Ga0268265_10005451
602 Ga0268264_10001394
603 Ga0268264_10030457
604 Ga0268264_10249497
605 Ga0307515_10101926
606 Ga0265332_10002264
607 Ga0307513_10002887
608 Ga0307516_10001281
609 Ga0307516_10058155
610 Ga0307516_10095035
611 Ga0373929_0003304
612 Ga0373929_0018473
613 Ga0373940_0012769
614 Ga0373949_0005374
615 Ga0373932_0001372
616 Ga0373939_0000881
617 Ga0373939_0010231
618 Ga0373941_0007096
619 Ga0373954_0001100
620 Ga0373943_0058133
621 Ga0373946_0017723
622 Ga0373962_0002004
623 Ga0373924_0015927
624 Ga0373931_0003466
625 Ga0373931_0005626
626 Ga0373931_0009180
627 Ga0373931_0017464
628 Ga0373931_0030292
629 Ga0373935_0019649
630 Ga0373927_0032263
631 Ga0373933_0005942
632 Ga0373933_0007638
633 Ga0373937_0001045
634 Ga0373937_0040741
635 Ga0373937_0057809
636 Ga0395898_0226832
637 Ga0395905_0001148
638 Ga0395905_0002159
639 Ga0395905_0050153
640 Ga0395905_0269536
641 Ga0436365_0787708
642 Ga0436361_0088190
643 Ga0436361_1015675
644 Ga0439453_0002490
645 Ga0439441_000324
646 Ga0439460_0008868
647 Ga0439460_0026394
648 Ga0451577_0001465
649 Ga0451577_0079966
650 Ga0451576_0000822
651 Ga0495590_0033610
652 Ga0495629_0000206
653 Ga0495629_0103527
654 Ga0495653_0080001
655 Ga0495650_0000688
656 Ga0495580_0013828
657 Ga0495582_0012981
658 Ga0495639_0013122
659 Ga0495662_0003159
660 Ga0495664_0029928
661 Ga0495630_0016274
662 Ga0495630_0107397
663 Ga0495643_0006544
664 Ga0495640_0023373
665 Ga0495586_0043282
666 Ga0495586_0049347
667 Ga0495587_0108505
668 Ga0495597_0020197
669 Ga0495645_0000416
670 Ga0495645_0004251
671 Ga0495668_0033594
672 Ga0495659_0047693
673 Ga0495661_0030433
674 Ga0495657_0072314
675 Ga0495669_0010111
676 Ga0495613_0057013
677 Ga0495624_0056032
678 Ga0495589_0007455
679 Ga0495581_0010923
680 Ga0495604_0108953
681 Ga0495604_0116616
682 Ga0495636_0046295
683 Ga0495674_0116997
684 Ga0495680_0063053
685 Ga0495687_002139
686 Ga0496104_0014478
687 Ga0496105_0037385
688 Ga0496114_0000931
689 Ga0496121_0000511
690 Ga0496126_0094680
691 Ga0501033_0003135
692 Ga0501036_0000778
693 Ga0501038_0023557
694 Ga0501038_0215323
695 Ga0501039_0009480
696 Ga0501040_0000808
697 Ga0501040_0010031
698 Ga0501040_0031728
699 Ga0501040_0032649
700 Ga0501041_0004667
701 Ga0501041_0005636
702 Ga0501042_0032257
703 Ga0501043_0035904
704 Ga0501043_0088611
705 Ga0501046_0020754
706 Ga0501046_0025673
707 Ga0501047_0063450
708 Ga0501048_0016370
709 Ga0501048_0021903
710 Ga0501068_0004020
711 Ga0501070_0067027
712 Ga0501071_0005010
713 Ga0501071_0080750
714 Ga0501072_0005483
715 Ga0501072_0017479
716 Ga0501074_0041642
717 Ga0501075_0004928
718 Ga0501075_0007259
719 Ga0501076_0012570
720 Ga0501076_0014667
721 Ga0501077_0005485
722 Ga0501077_0043433
723 Ga0501079_0007800
724 Ga0501079_0017859
725 Ga0501080_0056773
726 Ga0501081_0000810
727 Ga0501081_0004980
728 Ga0501035_0030604
729 Ga0501045_0022182
730 nmdc:mga0k408_44979_c1
731 nmdc:mga05p37_886_c1
732 nmdc:mga09592_335_c1
733 nmdc:mga0qj67_6200_c1
734 nmdc:mga06r32_276523_c1
735 nmdc:mga08y16_127322_c1
736 nmdc:mga08y16_1601_c1
737 nmdc:mga08y16_187131_c1
738 nmdc:mga0n895_16155_c1
739 nmdc:mga0n895_2327_c1
740 nmdc:mga0n895_75424_c1
741 nmdc:mga0rr50_2318_c1
742 nmdc:mga08x19_118462_c1
743 nmdc:mga08x19_24618_c1
744 nmdc:mga08x19_2723_c1
745 nmdc:mga0a205_144693_c1
746 nmdc:mga0a205_505_c1
747 Ga0501084_0001603
748 Ga0501084_0171758
749 Ga0501082_0015756
750 Ga0530510_0010946
751 2553005827
752 2574432969
753 2644061292
754 2644076667
755 2644246760
756 2644302587
757 2739243618
758 2816474167
759 2923514607
760 639787577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

12

52

0.96

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

15

62

0.95

PF01494

FAD_binding_3

FAD binding domain

10

355

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9344 9 40
4r1n-assembly1.cif.gz_A crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum. 0.9209 8 38
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9205 4 393
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.92 4 393
4bjy-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: platinum derivative 0.9186 4 393
ID Description Score Start End Superfamily
af_P76440_125_245_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9561 9 41 3.50.50.60
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9462 9 38 3.40.50.720
af_P9WJL5_17_103_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 8 40 3.40.50.720
af_O61709_2_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9274 10 38 3.40.50.720
af_Q2FYG1_1_188_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9256 8 38 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5Z5KU83-F1-model_v4 3-hydroxybenzoate 6-monooxygenase (EC 1.14.13.24) 0.9795 3 288 GO:0018669
GO:0071949
AF-E5XS53-F1-model_v4 Salicylate hydroxylase 0.9724 8 389 GO:0004497
GO:0071949
AF-A0A5Z5KU83-F1-model_v4 3-hydroxybenzoate 6-monooxygenase (EC 1.14.13.24) 0.9694 3 288 GO:0018669
GO:0071949
AF-F3P8B8-F1-model_v4 FAD dependent oxidoreductase 0.9663 9 389 GO:0004497
GO:0071949
AF-A0A3B0S5S6-F1-model_v4 FAD-binding domain-containing protein 0.9653 9 393 GO:0004497
GO:0071949

Map