F428498

General Info

Members Datasets Scaffolds Average Seq Length
379 258 374 187

Family's Representative Sequence

Representative Sequence 3300053102|Ga0500554_104019|Ga0500554_104019_98_724
Length 208
Sequence MFDSQCDLAALIYEPSQDPDRILRGFADDLNASGHRAVGLVQTGRYCLDAPKLSAMLVHTGEELQLFQDLGTCSTGCRLDVGQLLDAGIQIARAIDEGADLVIVNRFGRQEREGKGLSFLIERALSHDIPVVIAVPGHRFADWIRFANGMSVKLRCDRASLDAWWQALSARNVGLIGAWPSDRVRSLQIDHPLHPVFVANHAVRACDA

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
3 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
4 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
5 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
235 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
241 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0.26
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.47
Nodule 0
Rhizoplane 5.54
Rhizosphere 65.96
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10124022 3300003320 Bacteria 1279
2 Ga0070683_100041663 3300005329 Bacteria 4226
3 Ga0070690_100795982 3300005330 Bacteria 733
4 Ga0070660_100307058 3300005339 Bacteria 1301
5 Ga0070692_10833979 3300005345 Bacteria 632
6 Ga0070668_100566110 3300005347 Bacteria 990
7 Ga0070669_100397034 3300005353 Bacteria 1127
8 Ga0070671_100144782 3300005355 Bacteria 2006
9 Ga0070674_100089230 3300005356 Bacteria 2221
10 Ga0070659_100231055 3300005366 Bacteria 1529
11 Ga0070667_100328719 3300005367 Bacteria 1381
12 Ga0070711_100008006 3300005439 Bacteria 6451
13 Ga0070700_100116731 3300005441 Bacteria 1782
14 Ga0070663_100015926 3300005455 Bacteria 4868
15 Ga0070663_100319201 3300005455 Bacteria 1249
16 Ga0070663_100693854 3300005455 Bacteria 865
17 Ga0070662_100076141 3300005457 Bacteria 2486
18 Ga0068867_100082575 3300005459 Bacteria 2424
19 Ga0070684_100002172 3300005535 Bacteria 14475
20 Ga0068853_100127940 3300005539 Bacteria 2270
21 Ga0070672_100566081 3300005543 Bacteria 988
22 Ga0070665_100012170 3300005548 Bacteria 8674
23 Ga0068855_100472711 3300005563 Bacteria 1365
24 Ga0068854_101229175 3300005578 Bacteria 672
25 Ga0068866_10100615 3300005718 Bacteria 1594
26 Ga0068861_100542164 3300005719 Bacteria 1059
27 Ga0068858_100308147 3300005842 Bacteria 1512
28 Ga0068858_100311688 3300005842 Bacteria 1503
29 Ga0068862_100263543 3300005844 Bacteria 1574
30 Ga0081455_10035428 3300005937 Bacteria 4460
31 Ga0081540_1042496 3300005983 Bacteria 2344
32 Ga0070717_10043898 3300006028 Bacteria 3650
33 Ga0075365_10027550 3300006038 Bacteria 3617
34 Ga0075365_10055700 3300006038 Bacteria 2626
35 Ga0075365_10294928 3300006038 Bacteria 1141
36 Ga0075368_10046136 3300006042 Bacteria 1723
37 Ga0075368_10055674 3300006042 Bacteria 1577
38 Ga0075368_10267390 3300006042 Bacteria 733
39 Ga0075363_100002095 3300006048 Bacteria 7993
40 Ga0075363_100016777 3300006048 Bacteria 3621
41 Ga0075363_100048182 3300006048 Bacteria 2265
42 Ga0075363_100550817 3300006048 Bacteria 688
43 Ga0075364_10031364 3300006051 Bacteria 3415
44 Ga0070716_100352942 3300006173 Bacteria 1042
45 Ga0070712_100175554 3300006175 Bacteria 1666
46 Ga0075367_10024320 3300006178 Bacteria 3415
47 Ga0075367_10417742 3300006178 Unclassified 849
48 Ga0075369_10062733 3300006186 Bacteria 1624
49 Ga0075370_10026528 3300006353 Bacteria 3210
50 Ga0075370_10398418 3300006353 Bacteria 826
51 Ga0068871_100508065 3300006358 Bacteria 1087
52 Ga0068865_100674620 3300006881 Bacteria 881
53 Ga0075436_100256074 3300006914 Bacteria 1247
54 Ga0099794_10025719 3300007265 Bacteria 2714
55 Ga0099795_10002407 3300007788 Bacteria 4396
56 Ga0099795_10020030 3300007788 Bacteria 2173
57 Ga0105245_10334863 3300009098 Bacteria 1495
58 Ga0105247_10318454 3300009101 Bacteria 1084
59 Ga0105243_10068365 3300009148 Bacteria 2863
60 Ga0105242_10332099 3300009176 Bacteria 1398
61 Ga0105248_10352510 3300009177 Bacteria 1657
62 Ga0105248_10532416 3300009177 Bacteria 1325
63 Ga0105249_10220033 3300009553 Bacteria 1868
64 Ga0099796_10063637 3300010159 Bacteria 1314
65 Ga0105239_11261223 3300010375 Bacteria 852
66 Ga0105239_11304047 3300010375 Bacteria 838
67 Ga0163162_10585837 3300013306 Bacteria 1242
68 Ga0163162_11143856 3300013306 Bacteria 882
69 Ga0157375_10112823 3300013308 Bacteria 2819
70 Ga0157380_10406036 3300014326 Bacteria 1294
71 Ga0157380_10408652 3300014326 Bacteria 1290
72 Ga0157379_10310788 3300014968 Bacteria 1438
73 Ga0157376_10316550 3300014969 Bacteria 1482
74 Ga0163161_10060661 3300017792 Bacteria 2753
75 Ga0163161_10221619 3300017792 Bacteria 1465
76 Ga0209564_1000503 3300025295 Bacteria 64437
77 Ga0209564_1037404 3300025295 Bacteria 1368
78 Ga0207692_10119036 3300025898 Bacteria 1476
79 Ga0207710_10085020 3300025900 Bacteria 1473
80 Ga0207688_10196059 3300025901 Bacteria 1209
81 Ga0207645_10508778 3300025907 Bacteria 816
82 Ga0207707_10265199 3300025912 Bacteria 1489
83 Ga0207693_10176785 3300025915 Bacteria 1680
84 Ga0207663_10009838 3300025916 Bacteria 5061
85 Ga0207657_10135439 3300025919 Bacteria 2016
86 Ga0207652_10579855 3300025921 Bacteria 1007
87 Ga0207659_10487775 3300025926 Bacteria 1042
88 Ga0207644_10173758 3300025931 Bacteria 1684
89 Ga0207706_10088343 3300025933 Bacteria 2725
90 Ga0207709_10155958 3300025935 Bacteria 1587
91 Ga0207669_10006347 3300025937 Bacteria 5395
92 Ga0207669_10225987 3300025937 Bacteria 1377
93 Ga0207704_10178412 3300025938 Bacteria 1532
94 Ga0207691_10203965 3300025940 Bacteria 1720
95 Ga0207689_10591500 3300025942 Bacteria 933
96 Ga0207661_10000424 3300025944 Bacteria 27246
97 Ga0207712_10213059 3300025961 Bacteria 1540
98 Ga0207668_10026845 3300025972 Bacteria 3745
99 Ga0207668_10384342 3300025972 Bacteria 1182
100 Ga0207668_10536929 3300025972 Bacteria 1011
101 Ga0207640_11034023 3300025981 Bacteria 724
102 Ga0207677_11022865 3300026023 Bacteria 750
103 Ga0207703_10190739 3300026035 Bacteria 1815
104 Ga0207639_10082041 3300026041 Bacteria 2555
105 Ga0207678_10039011 3300026067 Bacteria 4123
106 Ga0207678_10127040 3300026067 Bacteria 2175
107 Ga0207678_10158751 3300026067 Bacteria 1931
108 Ga0207678_10216624 3300026067 Bacteria 1638
109 Ga0207708_10040367 3300026075 Bacteria 3558
110 Ga0207648_10076696 3300026089 Bacteria 2914
111 Ga0207675_100071110 3300026118 Bacteria 3253
112 Ga0207675_101033348 3300026118 Bacteria 841
113 Ga0207683_10207189 3300026121 Bacteria 1784
114 Ga0209588_1000650 3300027671 Bacteria 8749
115 Ga0209813_10013764 3300027866 Bacteria 2165
116 Ga0209813_10175241 3300027866 Bacteria 781
117 Ga0268266_10003339 3300028379 Bacteria 16071
118 Ga0268265_10300506 3300028380 Bacteria 1445
119 Ga0268265_11054252 3300028380 Bacteria 805
120 Ga0265337_1016983 3300028556 Bacteria 2342
121 Ga0265326_10001832 3300028558 Bacteria 7298
122 Ga0265319_1003977 3300028563 Bacteria 7499
123 Ga0265334_10009857 3300028573 Bacteria 4037
124 Ga0265318_10023922 3300028577 Bacteria 2429
125 Ga0265323_10000734 3300028653 Bacteria 17734
126 Ga0265336_10000750 3300028666 Bacteria 17239
127 Ga0307515_10085986 3300028794 Bacteria 4016
128 Ga0265338_10000086 3300028800 Bacteria 175026
129 Ga0265324_10002221 3300029957 Bacteria 10139
130 Ga0265330_10003218 3300031235 Bacteria 8600
131 Ga0265330_10009433 3300031235 Bacteria 4637
132 Ga0265332_10004481 3300031238 Bacteria 6546
133 Ga0265325_10011137 3300031241 Bacteria 5178
134 Ga0265340_10003676 3300031247 Bacteria 8635
135 Ga0265340_10140735 3300031247 Bacteria 1103
136 Ga0265340_10321406 3300031247 Bacteria 685
137 Ga0265339_10000326 3300031249 Bacteria 38178
138 Ga0265339_10045045 3300031249 Bacteria 2430
139 Ga0265339_10228037 3300031249 Bacteria 909
140 Ga0265316_10053216 3300031344 Bacteria 3173
141 Ga0307509_10280731 3300031507 Bacteria 1427
142 Ga0265314_10293674 3300031711 Bacteria 914
143 Ga0265342_10017593 3300031712 Bacteria 4645
144 Ga0307510_10018868 3300033180 Bacteria 8096
145 Ga0373934_0032988 3300035086 Bacteria 2032
146 Ga0373953_0006236 3300035117 Bacteria 3917
147 Ga0373954_0005882 3300035118 Bacteria 5330
148 Ga0373956_0045347 3300035119 Bacteria 1961
149 Ga0373960_0238107 3300035121 Bacteria 657
150 Ga0373955_0018206 3300035172 Bacteria 3489
151 Ga0373933_0020530 3300035724 Bacteria 3745
152 Ga0373937_0551828 3300036401 Bacteria 1094
153 Ga0372808_023270 3300036459 Bacteria 890
154 Ga0395900_0210036 3300037418 Bacteria 1966
155 Ga0395898_0023564 3300037466 Bacteria 6219
156 Ga0395901_0041299 3300038443 Bacteria 4780
157 Ga0451793_1164240 3300041452 Bacteria 874
158 Ga0495592_0028573 3300046454 Bacteria 4223
159 Ga0495629_0021986 3300046459 Bacteria 4550
160 Ga0495638_0063608 3300046460 Bacteria 2274
161 Ga0495638_0073620 3300046460 Bacteria 2084
162 Ga0495651_0362050 3300046462 Bacteria 955
163 Ga0495650_0058224 3300046471 Bacteria 1561
164 Ga0495664_0305229 3300046477 Bacteria 961
165 Ga0495607_0084051 3300046501 Bacteria 1742
166 Ga0495583_0060908 3300046506 Bacteria 1686
167 Ga0495608_0012482 3300046511 Bacteria 5894
168 Ga0495628_0067673 3300046516 Bacteria 2788
169 Ga0495631_0056061 3300046518 Bacteria 1716
170 Ga0495631_0104077 3300046518 Bacteria 1221
171 Ga0495631_0123619 3300046518 Bacteria 1113
172 Ga0495632_0032033 3300046519 Bacteria 2712
173 Ga0495632_0065369 3300046519 Bacteria 1757
174 Ga0495637_0029203 3300046520 Bacteria 2456
175 Ga0495643_0128844 3300046522 Bacteria 1272
176 Ga0495643_0179210 3300046522 Bacteria 1031
177 Ga0495644_0050662 3300046523 Bacteria 1559
178 Ga0495648_0168706 3300046524 Bacteria 1124
179 Ga0495652_0251169 3300046529 Bacteria 1310
180 Ga0495598_0046786 3300046537 Bacteria 1287
181 Ga0495645_0046990 3300046543 Bacteria 3146
182 Ga0495633_0126864 3300046558 Bacteria 1181
183 Ga0495656_0058948 3300046615 Bacteria 1668
184 Ga0495656_0165149 3300046615 Bacteria 1078
185 Ga0495668_0110556 3300046616 Bacteria 1503
186 Ga0495625_0224715 3300046660 Bacteria 1228
187 Ga0495635_0017098 3300046663 Bacteria 5064
188 Ga0495661_0008801 3300046665 Bacteria 6962
189 Ga0495661_0462982 3300046665 Bacteria 609
190 Ga0495646_0013713 3300046680 Bacteria 5152
191 Ga0495613_0153296 3300046689 Bacteria 1642
192 Ga0495670_0080363 3300046691 Bacteria 1660
193 Ga0495671_0037470 3300046692 Bacteria 2452
194 Ga0495589_0249904 3300046794 Bacteria 829
195 Ga0495600_0060921 3300046809 Bacteria 2464
196 Ga0495680_0109233 3300047322 Bacteria 2051
197 Ga0495673_0031926 3300047469 Bacteria 2462
198 Ga0495681_0045948 3300047470 Bacteria 2086
199 Ga0495686_0067267 3300047472 Bacteria 2212
200 Ga0495593_0092967 3300047673 Bacteria 1552
201 Ga0495602_0684263 3300048088 Bacteria 697
202 Ga0495626_0126994 3300048091 Bacteria 1092
203 Ga0496100_0402077 3300048903 Bacteria 1043
204 Ga0496102_0139912 3300048905 Bacteria 2269
205 Ga0496104_0023937 3300048907 Bacteria 5617
206 Ga0496104_0045990 3300048907 Bacteria 4107
207 Ga0496105_0059054 3300048908 Bacteria 3165
208 Ga0496105_0565213 3300048908 Bacteria 886
209 Ga0496106_0022697 3300048909 Bacteria 4663
210 Ga0496107_0018848 3300048910 Bacteria 4865
211 Ga0496108_0000392 3300048911 Bacteria 36249
212 Ga0496109_0005498 3300048912 Bacteria 10609
213 Ga0496109_0140303 3300048912 Bacteria 2260
214 Ga0496110_0091581 3300048913 Bacteria 2720
215 Ga0496110_0479034 3300048913 Bacteria 1134
216 Ga0496112_0014618 3300048915 Bacteria 7294
217 Ga0496112_0280636 3300048915 Bacteria 1613
218 Ga0496113_0055802 3300048916 Bacteria 2963
219 Ga0496113_0564701 3300048916 Bacteria 912
220 Ga0496114_0197569 3300048917 Bacteria 1761
221 Ga0496115_0048094 3300048918 Bacteria 3412
222 Ga0496116_0001611 3300048919 Bacteria 24820
223 Ga0496117_0013012 3300048920 Bacteria 7287
224 Ga0496117_0081715 3300048920 Bacteria 2119
225 Ga0496117_0201086 3300048920 Bacteria 1126
226 Ga0496118_0025336 3300048921 Bacteria 5090
227 Ga0496118_0056431 3300048921 Bacteria 2953
228 Ga0496118_0102730 3300048921 Bacteria 1925
229 Ga0496120_0039825 3300048923 Bacteria 2769
230 Ga0496120_0126436 3300048923 Bacteria 1315
231 Ga0496121_0028031 3300048924 Bacteria 5253
232 Ga0496121_0035853 3300048924 Bacteria 4433
233 Ga0496121_0037577 3300048924 Bacteria 4298
234 Ga0496121_0322652 3300048924 Bacteria 1039
235 Ga0496122_0051420 3300048925 Bacteria 3131
236 Ga0496122_0416810 3300048925 Bacteria 676
237 Ga0496123_0054541 3300048926 Bacteria 2630
238 Ga0496123_0185321 3300048926 Bacteria 1082
239 Ga0496124_0053904 3300048927 Bacteria 3406
240 Ga0496125_0000099 3300048928 Bacteria 203333
241 Ga0496125_0002962 3300048928 Bacteria 21340
242 Ga0496125_0004213 3300048928 Bacteria 16756
243 Ga0496125_0047595 3300048928 Bacteria 3583
244 Ga0496126_0004693 3300048929 Bacteria 16145
245 Ga0496126_0032834 3300048929 Bacteria 4886
246 Ga0496126_0116363 3300048929 Bacteria 2324
247 Ga0496126_0359734 3300048929 Bacteria 1189
248 Ga0496126_0479207 3300048929 Bacteria 997
249 Ga0496126_0489142 3300048929 Bacteria 985
250 Ga0496126_0736486 3300048929 Bacteria 762
251 Ga0501031_0058749 3300049568 Bacteria 2506
252 Ga0501032_0085152 3300049569 Bacteria 2101
253 Ga0501033_0001385 3300049570 Bacteria 21559
254 Ga0501034_0155883 3300049571 Bacteria 2257
255 Ga0501034_0185596 3300049571 Bacteria 2043
256 Ga0501034_0478591 3300049571 Bacteria 1160
257 Ga0501036_0015761 3300049572 Bacteria 6313
258 Ga0501036_0237295 3300049572 Bacteria 1529
259 Ga0501036_0300990 3300049572 Bacteria 1341
260 Ga0501036_0431393 3300049572 Bacteria 1098
261 Ga0501037_0000587 3300049573 Bacteria 28616
262 Ga0501037_0055778 3300049573 Bacteria 2888
263 Ga0501037_0056461 3300049573 Bacteria 2867
264 Ga0501037_0059270 3300049573 Bacteria 2793
265 Ga0501038_0010310 3300049574 Bacteria 8545
266 Ga0501038_0018346 3300049574 Bacteria 6317
267 Ga0501038_0082039 3300049574 Bacteria 2715
268 Ga0501038_0136342 3300049574 Bacteria 2010
269 Ga0501038_0166505 3300049574 Bacteria 1787
270 Ga0501038_0189524 3300049574 Bacteria 1655
271 Ga0501039_0001784 3300049575 Bacteria 15905
272 Ga0501039_0099629 3300049575 Bacteria 2267
273 Ga0501039_0169318 3300049575 Bacteria 1717
274 Ga0501039_0193413 3300049575 Bacteria 1599
275 Ga0501040_0131150 3300049576 Bacteria 1762
276 Ga0501040_0339331 3300049576 Bacteria 1076
277 Ga0501042_0064450 3300049578 Bacteria 2618
278 Ga0501042_0105554 3300049578 Bacteria 2027
279 Ga0501042_0256826 3300049578 Bacteria 1261
280 Ga0501043_0001868 3300049579 Bacteria 18037
281 Ga0501043_0119941 3300049579 Bacteria 2062
282 Ga0501043_0261224 3300049579 Bacteria 1331
283 Ga0501043_0269121 3300049579 Bacteria 1308
284 Ga0501046_0058742 3300049580 Bacteria 3014
285 Ga0501046_0116860 3300049580 Bacteria 2032
286 Ga0501046_0133276 3300049580 Bacteria 1883
287 Ga0501047_0106721 3300049581 Bacteria 2681
288 Ga0501047_0405736 3300049581 Bacteria 1195
289 Ga0501048_0030702 3300049582 Bacteria 3888
290 Ga0501048_0214914 3300049582 Bacteria 1363
291 Ga0501067_0111708 3300049583 Bacteria 1519
292 Ga0501068_0035404 3300049584 Bacteria 2980
293 Ga0501068_0129212 3300049584 Bacteria 1579
294 Ga0501069_0368314 3300049585 Bacteria 848
295 Ga0501070_0209928 3300049586 Bacteria 1598
296 Ga0501070_0368541 3300049586 Bacteria 1164
297 Ga0501072_0062061 3300049588 Bacteria 2948
298 Ga0501072_0356914 3300049588 Bacteria 1160
299 Ga0501073_0115256 3300049589 Bacteria 1863
300 Ga0501074_0125564 3300049590 Bacteria 1835
301 Ga0501077_0237322 3300049593 Bacteria 1159
302 Ga0501077_1036544 3300049593 Bacteria 528
303 Ga0501079_0370793 3300049741 Bacteria 1122
304 Ga0501080_0135758 3300049742 Bacteria 2277
305 Ga0501080_0237544 3300049742 Bacteria 1664
306 Ga0501080_0427910 3300049742 Bacteria 1188
307 Ga0501081_0334986 3300049743 Bacteria 1114
308 Ga0501083_0232164 3300049744 Bacteria 1201
309 Ga0501035_0007767 3300049822 Bacteria 10020
310 Ga0501035_0058960 3300049822 Bacteria 3419
311 Ga0501035_0374304 3300049822 Bacteria 1188
312 Ga0501035_0489490 3300049822 Bacteria 1013
313 Ga0501044_0015223 3300049823 Bacteria 8284
314 Ga0501044_0221725 3300049823 Bacteria 1841
315 Ga0501044_0258413 3300049823 Bacteria 1680
316 Ga0501044_0376998 3300049823 Bacteria 1334
317 Ga0501044_0509606 3300049823 Bacteria 1103
318 Ga0501045_0115543 3300049824 Bacteria 1990
319 Ga0501045_0332109 3300049824 Bacteria 1131
320 nmdc:mga03683_102797_c1 3300050489 Bacteria 1257
321 nmdc:mga03683_57344_c1 3300050489 Bacteria 1639
322 nmdc:mga03n38_178337_c1 3300050490 Bacteria 1087
323 nmdc:mga03n38_43678_c1 3300050490 Bacteria 1965
324 nmdc:mga03n38_70529_c1 3300050490 Bacteria 1616
325 nmdc:mga00v17_204923_c1 3300050491 Bacteria 1275
326 nmdc:mga00v17_24995_c1 3300050491 Bacteria 3467
327 nmdc:mga0yw44_13758_c1 3300050492 Bacteria 4272
328 nmdc:mga0yw44_65255_c1 3300050492 Bacteria 2243
329 nmdc:mga0yw44_87487_c1 3300050492 Bacteria 1964
330 nmdc:mga06z11_22587_c1 3300050494 Bacteria 2941
331 nmdc:mga04h51_179220_c1 3300050495 Bacteria 824
332 nmdc:mga04h51_48083_c1 3300050495 Bacteria 1420
333 nmdc:mga07m45_28326_c1 3300050496 Bacteria 3091
334 nmdc:mga08x19_326781_c1 3300050514 Bacteria 1068
335 Ga0495601_0074824 3300053077 Bacteria 2167
336 Ga0495601_0449886 3300053077 Bacteria 833
337 Ga0500635_0026965 3300053080 Bacteria 1822
338 Ga0500581_101257 3300053089 Bacteria 1416
339 Ga0500651_0075625 3300053093 Bacteria 2092
340 Ga0500651_0334819 3300053093 Bacteria 862
341 Ga0500566_0412547 3300053094 Unclassified 601
342 Ga0500641_0014059 3300053096 Bacteria 2948
343 Ga0500650_0081992 3300053098 Bacteria 1508
344 Ga0500554_033728 3300053102 Bacteria 1529
345 Ga0500554_104019 3300053102 Bacteria 951
346 Ga0500556_0000012 3300053104 Bacteria 250391
347 Ga0500572_000179 3300053111 Bacteria 22332
348 Ga0500592_000542 3300053116 Bacteria 6235
349 Ga0500595_001631 3300053119 Bacteria 11781
350 Ga0500595_008543 3300053119 Bacteria 4179
351 Ga0500595_031349 3300053119 Bacteria 1785
352 Ga0500595_034555 3300053119 Bacteria 1671
353 Ga0500607_279533 3300053121 Bacteria 636
354 Ga0500608_083244 3300053122 Bacteria 1506
355 Ga0500618_019013 3300053125 Bacteria 1694
356 Ga0500642_0000013 3300053130 Bacteria 197927
357 Ga0500652_001452 3300053131 Bacteria 7354
358 Ga0500559_0000681 3300053136 Bacteria 22593
359 Ga0500559_0001670 3300053136 Bacteria 12261
360 Ga0500559_0403720 3300053136 Bacteria 635
361 Ga0500568_0000676 3300053139 Bacteria 24605
362 Ga0500577_0104963 3300053142 Bacteria 1160
363 Ga0500616_0000035 3300053153 Bacteria 394242
364 Ga0500622_0005098 3300053156 Bacteria 7983
365 Ga0500624_004237 3300053157 Bacteria 1882
366 Ga0500627_0307632 3300053158 Bacteria 690
367 Ga0500639_017773 3300053163 Bacteria 3753
368 Ga0500636_0001334 3300053177 Bacteria 13389
369 Ga0500636_0058592 3300053177 Bacteria 2251
370 Ga0500637_0019729 3300053178 Bacteria 3640
371 Ga0500570_153932 3300053724 Bacteria 810
372 Ga0500645_045603 3300053730 Bacteria 1288
373 Ga0501084_0069886 3300054114 Bacteria 2940
374 Ga0501082_0101364 3300060353 Bacteria 2490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_1036544 Ga0501077_1036544_15_467 147
2 3300046462 Ga0495651_0362050 Ga0495651_0362050_12_515 165
3 3300048088 Ga0495602_0684263 Ga0495602_0684263_12_515 165
4 3300005983 Ga0081540_1042496 Ga0081540_10424962 167
5 3300006358 Ga0068871_100508065 Ga0068871_1005080652 174
6 3300049583 Ga0501067_0111708 Ga0501067_0111708_17_550 174
7 3300006042 Ga0075368_10046136 Ga0075368_100461361 178
8 3300006048 Ga0075363_100048182 Ga0075363_1000481823 178
9 3300006353 Ga0075370_10026528 Ga0075370_100265282 178
10 3300050489 nmdc:mga03683_57344_c1 nmdc:mga03683_57344_c1_901_1458 178
11 3300050490 nmdc:mga03n38_43678_c1 nmdc:mga03n38_43678_c1_1109_1666 178
12 3300050491 nmdc:mga00v17_204923_c1 nmdc:mga00v17_204923_c1_685_1242 178
13 3300050496 nmdc:mga07m45_28326_c1 nmdc:mga07m45_28326_c1_943_1500 178
14 iso_pu_bacteria 2824773399 2824774548 179
15 3300005329 Ga0070683_100041663 Ga0070683_1000416634 180
16 3300005535 Ga0070684_100002172 Ga0070684_1000021729 180
17 3300025912 Ga0207707_10265199 Ga0207707_102651992 180
18 3300025921 Ga0207652_10579855 Ga0207652_105798552 180
19 3300025944 Ga0207661_10000424 Ga0207661_1000042411 180
20 3300048907 Ga0496104_0023937 Ga0496104_0023937_2960_3517 180
21 3300048908 Ga0496105_0059054 Ga0496105_0059054_1949_2506 180
22 3300048909 Ga0496106_0022697 Ga0496106_0022697_2371_2928 180
23 3300048910 Ga0496107_0018848 Ga0496107_0018848_3038_3595 180
24 3300048911 Ga0496108_0000392 Ga0496108_0000392_32899_33456 180
25 3300048912 Ga0496109_0005498 Ga0496109_0005498_1484_2041 180
26 3300048913 Ga0496110_0091581 Ga0496110_0091581_1529_2086 180
27 3300048915 Ga0496112_0014618 Ga0496112_0014618_5564_6121 180
28 3300048916 Ga0496113_0055802 Ga0496113_0055802_620_1177 180
29 3300048917 Ga0496114_0197569 Ga0496114_0197569_617_1174 180
30 3300005347 Ga0070668_100566110 Ga0070668_1005661101 181
31 3300006038 Ga0075365_10294928 Ga0075365_102949283 181
32 3300006048 Ga0075363_100016777 Ga0075363_1000167776 181
33 3300006178 Ga0075367_10417742 Ga0075367_104177421 181
34 3300050490 nmdc:mga03n38_178337_c1 nmdc:mga03n38_178337_c1_403_972 181
35 3300006914 Ga0075436_100256074 Ga0075436_1002560742 182
36 3300037418 Ga0395900_0210036 Ga0395900_0210036_863_1414 182
37 3300037466 Ga0395898_0023564 Ga0395898_0023564_4519_5070 182
38 3300038443 Ga0395901_0041299 Ga0395901_0041299_3172_3723 182
39 3300048915 Ga0496112_0280636 Ga0496112_0280636_565_1116 182
40 3300048928 Ga0496125_0000099 Ga0496125_0000099_26288_26854 182
41 3300048928 Ga0496125_0004213 Ga0496125_0004213_14251_14817 182
42 3300050514 nmdc:mga08x19_326781_c1 nmdc:mga08x19_326781_c1_384_935 182
43 iso_pu_bacteria 2602042107 2603857724 182
44 iso_pu_bacteria 2885383462 2885383625 182
45 iso_pu_bacteria 2919073203 2919078210 182
46 3300049569 Ga0501032_0085152 Ga0501032_0085152_863_1423 183
47 3300049571 Ga0501034_0185596 Ga0501034_0185596_719_1285 183
48 3300049572 Ga0501036_0300990 Ga0501036_0300990_674_1240 183
49 3300049572 Ga0501036_0431393 Ga0501036_0431393_60_620 183
50 3300049573 Ga0501037_0055778 Ga0501037_0055778_511_1077 183
51 3300049573 Ga0501037_0056461 Ga0501037_0056461_2278_2838 183
52 3300049574 Ga0501038_0018346 Ga0501038_0018346_5334_5894 183
53 3300049574 Ga0501038_0189524 Ga0501038_0189524_982_1548 183
54 3300049575 Ga0501039_0169318 Ga0501039_0169318_882_1448 183
55 3300049579 Ga0501043_0119941 Ga0501043_0119941_1197_1763 183
56 3300049580 Ga0501046_0133276 Ga0501046_0133276_56_622 183
57 3300049581 Ga0501047_0405736 Ga0501047_0405736_539_1105 183
58 3300049582 Ga0501048_0214914 Ga0501048_0214914_83_649 183
59 3300049584 Ga0501068_0035404 Ga0501068_0035404_56_622 183
60 3300049585 Ga0501069_0368314 Ga0501069_0368314_30_596 183
61 3300049586 Ga0501070_0209928 Ga0501070_0209928_392_958 183
62 3300049588 Ga0501072_0356914 Ga0501072_0356914_468_1028 183
63 3300049589 Ga0501073_0115256 Ga0501073_0115256_841_1407 183
64 3300049590 Ga0501074_0125564 Ga0501074_0125564_657_1223 183
65 3300049742 Ga0501080_0237544 Ga0501080_0237544_356_922 183
66 3300049822 Ga0501035_0058960 Ga0501035_0058960_895_1455 183
67 3300049822 Ga0501035_0489490 Ga0501035_0489490_87_653 183
68 3300049823 Ga0501044_0221725 Ga0501044_0221725_1114_1680 183
69 3300049823 Ga0501044_0258413 Ga0501044_0258413_275_835 183
70 3300049824 Ga0501045_0332109 Ga0501045_0332109_484_1044 183
71 3300028556 Ga0265337_1016983 Ga0265337_10169833 184
72 3300028558 Ga0265326_10001832 Ga0265326_100018322 184
73 3300028563 Ga0265319_1003977 Ga0265319_10039776 184
74 3300028573 Ga0265334_10009857 Ga0265334_100098574 184
75 3300028577 Ga0265318_10023922 Ga0265318_100239222 184
76 3300028653 Ga0265323_10000734 Ga0265323_100007349 184
77 3300028666 Ga0265336_10000750 Ga0265336_100007508 184
78 3300028800 Ga0265338_10000086 Ga0265338_10000086141 184
79 3300029957 Ga0265324_10002221 Ga0265324_100022215 184
80 3300049568 Ga0501031_0058749 Ga0501031_0058749_1856_2419 184
81 3300049570 Ga0501033_0001385 Ga0501033_0001385_1297_1860 184
82 3300049571 Ga0501034_0155883 Ga0501034_0155883_1277_1840 184
83 3300049571 Ga0501034_0478591 Ga0501034_0478591_116_679 184
84 3300049572 Ga0501036_0015761 Ga0501036_0015761_855_1418 184
85 3300049572 Ga0501036_0237295 Ga0501036_0237295_320_883 184
86 3300049573 Ga0501037_0000587 Ga0501037_0000587_16563_17126 184
87 3300049573 Ga0501037_0059270 Ga0501037_0059270_881_1459 184
88 3300049574 Ga0501038_0010310 Ga0501038_0010310_2570_3133 184
89 3300049574 Ga0501038_0082039 Ga0501038_0082039_1354_1917 184
90 3300049574 Ga0501038_0136342 Ga0501038_0136342_512_1075 184
91 3300049574 Ga0501038_0166505 Ga0501038_0166505_360_923 184
92 3300049575 Ga0501039_0001784 Ga0501039_0001784_11184_11747 184
93 3300049575 Ga0501039_0099629 Ga0501039_0099629_351_914 184
94 3300049575 Ga0501039_0193413 Ga0501039_0193413_547_1110 184
95 3300049576 Ga0501040_0131150 Ga0501040_0131150_581_1144 184
96 3300049576 Ga0501040_0339331 Ga0501040_0339331_119_682 184
97 3300049578 Ga0501042_0064450 Ga0501042_0064450_291_854 184
98 3300049578 Ga0501042_0105554 Ga0501042_0105554_784_1347 184
99 3300049578 Ga0501042_0256826 Ga0501042_0256826_660_1223 184
100 3300049579 Ga0501043_0001868 Ga0501043_0001868_10800_11363 184
101 3300049579 Ga0501043_0261224 Ga0501043_0261224_547_1110 184
102 3300049579 Ga0501043_0269121 Ga0501043_0269121_97_660 184
103 3300049580 Ga0501046_0058742 Ga0501046_0058742_995_1558 184
104 3300049580 Ga0501046_0116860 Ga0501046_0116860_1354_1917 184
105 3300049581 Ga0501047_0106721 Ga0501047_0106721_755_1318 184
106 3300049582 Ga0501048_0030702 Ga0501048_0030702_2013_2576 184
107 3300049584 Ga0501068_0129212 Ga0501068_0129212_375_938 184
108 3300049586 Ga0501070_0368541 Ga0501070_0368541_534_1097 184
109 3300049588 Ga0501072_0062061 Ga0501072_0062061_1347_1910 184
110 3300049593 Ga0501077_0237322 Ga0501077_0237322_498_1061 184
111 3300049741 Ga0501079_0370793 Ga0501079_0370793_208_771 184
112 3300049742 Ga0501080_0135758 Ga0501080_0135758_1330_1893 184
113 3300049742 Ga0501080_0427910 Ga0501080_0427910_547_1110 184
114 3300049743 Ga0501081_0334986 Ga0501081_0334986_92_655 184
115 3300049744 Ga0501083_0232164 Ga0501083_0232164_331_894 184
116 3300049822 Ga0501035_0007767 Ga0501035_0007767_8427_8990 184
117 3300049822 Ga0501035_0374304 Ga0501035_0374304_79_642 184
118 3300049823 Ga0501044_0015223 Ga0501044_0015223_1884_2447 184
119 3300049823 Ga0501044_0376998 Ga0501044_0376998_86_649 184
120 3300049823 Ga0501044_0509606 Ga0501044_0509606_79_642 184
121 3300049824 Ga0501045_0115543 Ga0501045_0115543_810_1373 184
122 3300053102 Ga0500554_104019 Ga0500554_104019_98_724 184
123 3300053111 Ga0500572_000179 Ga0500572_000179_3449_4015 184
124 3300053136 Ga0500559_0000681 Ga0500559_0000681_18869_19435 184
125 3300053163 Ga0500639_017773 Ga0500639_017773_2164_2730 184
126 3300054114 Ga0501084_0069886 Ga0501084_0069886_2182_2745 184
127 3300060353 Ga0501082_0101364 Ga0501082_0101364_98_661 184
128 3300005937 Ga0081455_10035428 Ga0081455_100354284 185
129 3300003320 rootH2_10124022 rootH2_101240221 186
130 3300005330 Ga0070690_100795982 Ga0070690_1007959821 186
131 3300005339 Ga0070660_100307058 Ga0070660_1003070581 186
132 3300005345 Ga0070692_10833979 Ga0070692_108339791 186
133 3300005353 Ga0070669_100397034 Ga0070669_1003970342 186
134 3300005355 Ga0070671_100144782 Ga0070671_1001447822 186
135 3300005356 Ga0070674_100089230 Ga0070674_1000892302 186
136 3300005366 Ga0070659_100231055 Ga0070659_1002310552 186
137 3300005367 Ga0070667_100328719 Ga0070667_1003287192 186
138 3300005439 Ga0070711_100008006 Ga0070711_1000080068 186
139 3300005441 Ga0070700_100116731 Ga0070700_1001167312 186
140 3300005455 Ga0070663_100015926 Ga0070663_1000159263 186
141 3300005455 Ga0070663_100319201 Ga0070663_1003192012 186
142 3300005455 Ga0070663_100693854 Ga0070663_1006938541 186
143 3300005457 Ga0070662_100076141 Ga0070662_1000761412 186
144 3300005459 Ga0068867_100082575 Ga0068867_1000825753 186
145 3300005539 Ga0068853_100127940 Ga0068853_1001279403 186
146 3300005543 Ga0070672_100566081 Ga0070672_1005660811 186
147 3300005548 Ga0070665_100012170 Ga0070665_1000121709 186
148 3300005563 Ga0068855_100472711 Ga0068855_1004727111 186
149 3300005578 Ga0068854_101229175 Ga0068854_1012291751 186
150 3300005718 Ga0068866_10100615 Ga0068866_101006151 186
151 3300005719 Ga0068861_100542164 Ga0068861_1005421642 186
152 3300005842 Ga0068858_100308147 Ga0068858_1003081472 186
153 3300005842 Ga0068858_100311688 Ga0068858_1003116883 186
154 3300005844 Ga0068862_100263543 Ga0068862_1002635432 186
155 3300006028 Ga0070717_10043898 Ga0070717_100438982 186
156 3300006038 Ga0075365_10027550 Ga0075365_100275502 186
157 3300006038 Ga0075365_10055700 Ga0075365_100557001 186
158 3300006042 Ga0075368_10055674 Ga0075368_100556743 186
159 3300006042 Ga0075368_10267390 Ga0075368_102673901 186
160 3300006048 Ga0075363_100002095 Ga0075363_1000020959 186
161 3300006048 Ga0075363_100550817 Ga0075363_1005508171 186
162 3300006051 Ga0075364_10031364 Ga0075364_100313645 186
163 3300006173 Ga0070716_100352942 Ga0070716_1003529421 186
164 3300006175 Ga0070712_100175554 Ga0070712_1001755543 186
165 3300006178 Ga0075367_10024320 Ga0075367_100243203 186
166 3300006186 Ga0075369_10062733 Ga0075369_100627333 186
167 3300006353 Ga0075370_10398418 Ga0075370_103984182 186
168 3300006881 Ga0068865_100674620 Ga0068865_1006746201 186
169 3300007265 Ga0099794_10025719 Ga0099794_100257193 186
170 3300007788 Ga0099795_10002407 Ga0099795_100024075 186
171 3300007788 Ga0099795_10020030 Ga0099795_100200302 186
172 3300009098 Ga0105245_10334863 Ga0105245_103348632 186
173 3300009101 Ga0105247_10318454 Ga0105247_103184541 186
174 3300009148 Ga0105243_10068365 Ga0105243_100683652 186
175 3300009176 Ga0105242_10332099 Ga0105242_103320992 186
176 3300009177 Ga0105248_10352510 Ga0105248_103525102 186
177 3300009177 Ga0105248_10532416 Ga0105248_105324161 186
178 3300009553 Ga0105249_10220033 Ga0105249_102200332 186
179 3300010159 Ga0099796_10063637 Ga0099796_100636372 186
180 3300010375 Ga0105239_11261223 Ga0105239_112612232 186
181 3300010375 Ga0105239_11304047 Ga0105239_113040472 186
182 3300013306 Ga0163162_10585837 Ga0163162_105858372 186
183 3300013306 Ga0163162_11143856 Ga0163162_111438562 186
184 3300013308 Ga0157375_10112823 Ga0157375_101128232 186
185 3300014326 Ga0157380_10406036 Ga0157380_104060362 186
186 3300014326 Ga0157380_10408652 Ga0157380_104086522 186
187 3300014968 Ga0157379_10310788 Ga0157379_103107881 186
188 3300014969 Ga0157376_10316550 Ga0157376_103165502 186
189 3300017792 Ga0163161_10060661 Ga0163161_100606612 186
190 3300017792 Ga0163161_10221619 Ga0163161_102216193 186
191 3300025295 Ga0209564_1000503 Ga0209564_100050346 186
192 3300025295 Ga0209564_1037404 Ga0209564_10374042 186
193 3300025898 Ga0207692_10119036 Ga0207692_101190362 186
194 3300025900 Ga0207710_10085020 Ga0207710_100850202 186
195 3300025901 Ga0207688_10196059 Ga0207688_101960592 186
196 3300025907 Ga0207645_10508778 Ga0207645_105087781 186
197 3300025915 Ga0207693_10176785 Ga0207693_101767851 186
198 3300025916 Ga0207663_10009838 Ga0207663_100098388 186
199 3300025919 Ga0207657_10135439 Ga0207657_101354392 186
200 3300025926 Ga0207659_10487775 Ga0207659_104877752 186
201 3300025931 Ga0207644_10173758 Ga0207644_101737582 186
202 3300025933 Ga0207706_10088343 Ga0207706_100883432 186
203 3300025935 Ga0207709_10155958 Ga0207709_101559582 186
204 3300025937 Ga0207669_10006347 Ga0207669_100063472 186
205 3300025937 Ga0207669_10225987 Ga0207669_102259872 186
206 3300025938 Ga0207704_10178412 Ga0207704_101784122 186
207 3300025940 Ga0207691_10203965 Ga0207691_102039652 186
208 3300025942 Ga0207689_10591500 Ga0207689_105915001 186
209 3300025961 Ga0207712_10213059 Ga0207712_102130592 186
210 3300025972 Ga0207668_10026845 Ga0207668_100268452 186
211 3300025972 Ga0207668_10384342 Ga0207668_103843422 186
212 3300025972 Ga0207668_10536929 Ga0207668_105369292 186
213 3300025981 Ga0207640_11034023 Ga0207640_110340232 186
214 3300026023 Ga0207677_11022865 Ga0207677_110228652 186
215 3300026035 Ga0207703_10190739 Ga0207703_101907392 186
216 3300026041 Ga0207639_10082041 Ga0207639_100820412 186
217 3300026067 Ga0207678_10039011 Ga0207678_100390112 186
218 3300026067 Ga0207678_10127040 Ga0207678_101270403 186
219 3300026067 Ga0207678_10158751 Ga0207678_101587512 186
220 3300026067 Ga0207678_10216624 Ga0207678_102166242 186
221 3300026075 Ga0207708_10040367 Ga0207708_100403673 186
222 3300026089 Ga0207648_10076696 Ga0207648_100766962 186
223 3300026118 Ga0207675_100071110 Ga0207675_1000711102 186
224 3300026118 Ga0207675_101033348 Ga0207675_1010333481 186
225 3300026121 Ga0207683_10207189 Ga0207683_102071892 186
226 3300027671 Ga0209588_1000650 Ga0209588_10006509 186
227 3300027866 Ga0209813_10013764 Ga0209813_100137642 186
228 3300027866 Ga0209813_10175241 Ga0209813_101752411 186
229 3300028379 Ga0268266_10003339 Ga0268266_1000333911 186
230 3300028380 Ga0268265_10300506 Ga0268265_103005062 186
231 3300028380 Ga0268265_11054252 Ga0268265_110542521 186
232 3300028794 Ga0307515_10085986 Ga0307515_100859863 186
233 3300031235 Ga0265330_10003218 Ga0265330_100032181 186
234 3300031235 Ga0265330_10009433 Ga0265330_100094332 186
235 3300031238 Ga0265332_10004481 Ga0265332_100044817 186
236 3300031241 Ga0265325_10011137 Ga0265325_100111376 186
237 3300031247 Ga0265340_10003676 Ga0265340_100036767 186
238 3300031247 Ga0265340_10140735 Ga0265340_101407351 186
239 3300031247 Ga0265340_10321406 Ga0265340_103214061 186
240 3300031249 Ga0265339_10000326 Ga0265339_100003266 186
241 3300031249 Ga0265339_10045045 Ga0265339_100450453 186
242 3300031249 Ga0265339_10228037 Ga0265339_102280372 186
243 3300031344 Ga0265316_10053216 Ga0265316_100532164 186
244 3300031507 Ga0307509_10280731 Ga0307509_102807312 186
245 3300031711 Ga0265314_10293674 Ga0265314_102936741 186
246 3300031712 Ga0265342_10017593 Ga0265342_100175933 186
247 3300033180 Ga0307510_10018868 Ga0307510_100188686 186
248 3300035086 Ga0373934_0032988 Ga0373934_0032988_169_735 186
249 3300035117 Ga0373953_0006236 Ga0373953_0006236_687_1253 186
250 3300035118 Ga0373954_0005882 Ga0373954_0005882_3641_4207 186
251 3300035119 Ga0373956_0045347 Ga0373956_0045347_1007_1573 186
252 3300035121 Ga0373960_0238107 Ga0373960_0238107_70_630 186
253 3300035172 Ga0373955_0018206 Ga0373955_0018206_477_1043 186
254 3300035724 Ga0373933_0020530 Ga0373933_0020530_1405_1971 186
255 3300036401 Ga0373937_0551828 Ga0373937_0551828_465_1031 186
256 3300036459 Ga0372808_023270 Ga0372808_023270_307_873 186
257 3300041452 Ga0451793_1164240 Ga0451793_1164240_152_718 186
258 3300046454 Ga0495592_0028573 Ga0495592_0028573_172_738 186
259 3300046459 Ga0495629_0021986 Ga0495629_0021986_688_1254 186
260 3300046460 Ga0495638_0063608 Ga0495638_0063608_1698_2264 186
261 3300046460 Ga0495638_0073620 Ga0495638_0073620_480_1046 186
262 3300046471 Ga0495650_0058224 Ga0495650_0058224_834_1394 186
263 3300046477 Ga0495664_0305229 Ga0495664_0305229_147_713 186
264 3300046501 Ga0495607_0084051 Ga0495607_0084051_214_780 186
265 3300046506 Ga0495583_0060908 Ga0495583_0060908_887_1453 186
266 3300046511 Ga0495608_0012482 Ga0495608_0012482_3531_4097 186
267 3300046516 Ga0495628_0067673 Ga0495628_0067673_465_1031 186
268 3300046518 Ga0495631_0056061 Ga0495631_0056061_950_1516 186
269 3300046518 Ga0495631_0104077 Ga0495631_0104077_507_1067 186
270 3300046518 Ga0495631_0123619 Ga0495631_0123619_129_689 186
271 3300046519 Ga0495632_0032033 Ga0495632_0032033_93_659 186
272 3300046519 Ga0495632_0065369 Ga0495632_0065369_522_1082 186
273 3300046520 Ga0495637_0029203 Ga0495637_0029203_1544_2110 186
274 3300046522 Ga0495643_0128844 Ga0495643_0128844_297_863 186
275 3300046522 Ga0495643_0179210 Ga0495643_0179210_109_669 186
276 3300046523 Ga0495644_0050662 Ga0495644_0050662_178_738 186
277 3300046524 Ga0495648_0168706 Ga0495648_0168706_546_1112 186
278 3300046529 Ga0495652_0251169 Ga0495652_0251169_57_623 186
279 3300046537 Ga0495598_0046786 Ga0495598_0046786_590_1150 186
280 3300046543 Ga0495645_0046990 Ga0495645_0046990_1756_2322 186
281 3300046558 Ga0495633_0126864 Ga0495633_0126864_411_971 186
282 3300046615 Ga0495656_0058948 Ga0495656_0058948_658_1218 186
283 3300046615 Ga0495656_0165149 Ga0495656_0165149_22_582 186
284 3300046616 Ga0495668_0110556 Ga0495668_0110556_221_787 186
285 3300046660 Ga0495625_0224715 Ga0495625_0224715_496_1062 186
286 3300046663 Ga0495635_0017098 Ga0495635_0017098_2795_3361 186
287 3300046665 Ga0495661_0008801 Ga0495661_0008801_783_1349 186
288 3300046665 Ga0495661_0462982 Ga0495661_0462982_31_591 186
289 3300046680 Ga0495646_0013713 Ga0495646_0013713_3617_4183 186
290 3300046689 Ga0495613_0153296 Ga0495613_0153296_19_585 186
291 3300046691 Ga0495670_0080363 Ga0495670_0080363_544_1110 186
292 3300046692 Ga0495671_0037470 Ga0495671_0037470_160_720 186
293 3300046794 Ga0495589_0249904 Ga0495589_0249904_144_704 186
294 3300046809 Ga0495600_0060921 Ga0495600_0060921_1406_1972 186
295 3300047322 Ga0495680_0109233 Ga0495680_0109233_1066_1632 186
296 3300047469 Ga0495673_0031926 Ga0495673_0031926_1118_1684 186
297 3300047470 Ga0495681_0045948 Ga0495681_0045948_816_1376 186
298 3300047472 Ga0495686_0067267 Ga0495686_0067267_1560_2129 186
299 3300047673 Ga0495593_0092967 Ga0495593_0092967_182_748 186
300 3300048091 Ga0495626_0126994 Ga0495626_0126994_98_664 186
301 3300048903 Ga0496100_0402077 Ga0496100_0402077_433_996 186
302 3300048905 Ga0496102_0139912 Ga0496102_0139912_29_589 186
303 3300048907 Ga0496104_0045990 Ga0496104_0045990_2251_2811 186
304 3300048908 Ga0496105_0565213 Ga0496105_0565213_58_618 186
305 3300048912 Ga0496109_0140303 Ga0496109_0140303_863_1423 186
306 3300048913 Ga0496110_0479034 Ga0496110_0479034_307_867 186
307 3300048916 Ga0496113_0564701 Ga0496113_0564701_56_616 186
308 3300048918 Ga0496115_0048094 Ga0496115_0048094_1832_2398 186
309 3300048919 Ga0496116_0001611 Ga0496116_0001611_850_1416 186
310 3300048920 Ga0496117_0013012 Ga0496117_0013012_1848_2414 186
311 3300048920 Ga0496117_0081715 Ga0496117_0081715_1162_1728 186
312 3300048920 Ga0496117_0201086 Ga0496117_0201086_509_1075 186
313 3300048921 Ga0496118_0025336 Ga0496118_0025336_1159_1725 186
314 3300048921 Ga0496118_0056431 Ga0496118_0056431_659_1225 186
315 3300048921 Ga0496118_0102730 Ga0496118_0102730_562_1128 186
316 3300048923 Ga0496120_0039825 Ga0496120_0039825_683_1249 186
317 3300048923 Ga0496120_0126436 Ga0496120_0126436_264_830 186
318 3300048924 Ga0496121_0028031 Ga0496121_0028031_3346_3912 186
319 3300048924 Ga0496121_0035853 Ga0496121_0035853_19_588 186
320 3300048924 Ga0496121_0037577 Ga0496121_0037577_2736_3302 186
321 3300048924 Ga0496121_0322652 Ga0496121_0322652_101_667 186
322 3300048925 Ga0496122_0051420 Ga0496122_0051420_2117_2683 186
323 3300048925 Ga0496122_0416810 Ga0496122_0416810_16_582 186
324 3300048926 Ga0496123_0054541 Ga0496123_0054541_1246_1812 186
325 3300048926 Ga0496123_0185321 Ga0496123_0185321_10_576 186
326 3300048927 Ga0496124_0053904 Ga0496124_0053904_719_1285 186
327 3300048928 Ga0496125_0002962 Ga0496125_0002962_5077_5643 186
328 3300048928 Ga0496125_0047595 Ga0496125_0047595_2321_2887 186
329 3300048929 Ga0496126_0004693 Ga0496126_0004693_6296_6862 186
330 3300048929 Ga0496126_0032834 Ga0496126_0032834_451_1017 186
331 3300048929 Ga0496126_0116363 Ga0496126_0116363_884_1450 186
332 3300048929 Ga0496126_0359734 Ga0496126_0359734_500_1066 186
333 3300048929 Ga0496126_0479207 Ga0496126_0479207_315_875 186
334 3300048929 Ga0496126_0489142 Ga0496126_0489142_262_822 186
335 3300048929 Ga0496126_0736486 Ga0496126_0736486_65_631 186
336 3300050489 nmdc:mga03683_102797_c1 nmdc:mga03683_102797_c1_410_970 186
337 3300050490 nmdc:mga03n38_70529_c1 nmdc:mga03n38_70529_c1_37_597 186
338 3300050491 nmdc:mga00v17_24995_c1 nmdc:mga00v17_24995_c1_2192_2758 186
339 3300050492 nmdc:mga0yw44_13758_c1 nmdc:mga0yw44_13758_c1_158_718 186
340 3300050492 nmdc:mga0yw44_65255_c1 nmdc:mga0yw44_65255_c1_936_1502 186
341 3300050492 nmdc:mga0yw44_87487_c1 nmdc:mga0yw44_87487_c1_800_1366 186
342 3300050494 nmdc:mga06z11_22587_c1 nmdc:mga06z11_22587_c1_2168_2728 186
343 3300050495 nmdc:mga04h51_179220_c1 nmdc:mga04h51_179220_c1_59_619 186
344 3300050495 nmdc:mga04h51_48083_c1 nmdc:mga04h51_48083_c1_746_1312 186
345 3300053077 Ga0495601_0074824 Ga0495601_0074824_1567_2133 186
346 3300053077 Ga0495601_0449886 Ga0495601_0449886_48_614 186
347 3300053080 Ga0500635_0026965 Ga0500635_0026965_1134_1700 186
348 3300053089 Ga0500581_101257 Ga0500581_101257_750_1316 186
349 3300053093 Ga0500651_0075625 Ga0500651_0075625_616_1182 186
350 3300053093 Ga0500651_0334819 Ga0500651_0334819_262_852 186
351 3300053094 Ga0500566_0412547 Ga0500566_0412547_19_585 186
352 3300053096 Ga0500641_0014059 Ga0500641_0014059_1844_2461 186
353 3300053098 Ga0500650_0081992 Ga0500650_0081992_732_1349 186
354 3300053102 Ga0500554_033728 Ga0500554_033728_375_992 186
355 3300053104 Ga0500556_0000012 Ga0500556_0000012_64981_65547 186
356 3300053116 Ga0500592_000542 Ga0500592_000542_2719_3285 186
357 3300053119 Ga0500595_001631 Ga0500595_001631_11193_11759 186
358 3300053119 Ga0500595_008543 Ga0500595_008543_3572_4138 186
359 3300053119 Ga0500595_031349 Ga0500595_031349_191_751 186
360 3300053119 Ga0500595_034555 Ga0500595_034555_366_929 186
361 3300053121 Ga0500607_279533 Ga0500607_279533_34_624 186
362 3300053122 Ga0500608_083244 Ga0500608_083244_246_863 186
363 3300053125 Ga0500618_019013 Ga0500618_019013_50_631 186
364 3300053130 Ga0500642_0000013 Ga0500642_0000013_139852_140418 186
365 3300053131 Ga0500652_001452 Ga0500652_001452_6716_7282 186
366 3300053136 Ga0500559_0001670 Ga0500559_0001670_6008_6625 186
367 3300053136 Ga0500559_0403720 Ga0500559_0403720_21_587 186
368 3300053139 Ga0500568_0000676 Ga0500568_0000676_8927_9493 186
369 3300053142 Ga0500577_0104963 Ga0500577_0104963_558_1124 186
370 3300053153 Ga0500616_0000035 Ga0500616_0000035_328868_329434 186
371 3300053156 Ga0500622_0005098 Ga0500622_0005098_3820_4386 186
372 3300053157 Ga0500624_004237 Ga0500624_004237_887_1504 186
373 3300053158 Ga0500627_0307632 Ga0500627_0307632_85_651 186
374 3300053177 Ga0500636_0001334 Ga0500636_0001334_12029_12646 186
375 3300053177 Ga0500636_0058592 Ga0500636_0058592_538_1104 186
376 3300053178 Ga0500637_0019729 Ga0500637_0019729_2979_3545 186
377 3300053724 Ga0500570_153932 Ga0500570_153932_30_596 186
378 3300053730 Ga0500645_045603 Ga0500645_045603_683_1249 186
379 iso_pu_bacteria 2893066018 2893068125 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10649

DUF2478

Protein of unknown function (DUF2478)

8

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ymu-assembly1.cif.gz_B signal transduction protein chey mutant with met 17 replaced by gly (m17g) 0.6704 86 169
1ye8-assembly1.cif.gz_A crystal structure of thep1 from the hyperthermophile aquifex aeolicus 0.6453 8 154
3fgz-assembly2.cif.gz_B crystal structure of chey triple mutant f14e, n59m, e89r complexed with bef3- and mn2+ 0.6215 86 170
7w59-assembly1.cif.gz_Y the cryo-em structure of human pre-c*-i complex 0.6136 86 155
5lkm-assembly1.cif.gz_B-2 rada bound to dtdp 0.5829 87 133
ID Description Score Start End Superfamily
af_Q58954_2_168_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6932 8 173 3.40.50.300
af_Q9VP84_8_188_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6877 9 173 3.40.50.300
1ye8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6876 9 154 3.40.50.300
af_Q58954_2_168_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.683 8 173 3.40.50.300
af_Q6ID68_6_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6739 9 168 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A850IYG7-F1-model_v4 deleted 0.9608 1 186
AF-A0A840HIE9-F1-model_v4 Molybdate transport system ATP-binding protein 0.944 6 176 GO:0005524
AF-A0A844SBU9-F1-model_v4 deleted 0.9409 7 167
AF-A0A3S0G7L5-F1-model_v4 DUF2478 domain-containing protein 0.9374 7 170
AF-H0TY36-F1-model_v4 Putative molybdenum ABC transporter, ATP-binding protein 0.937 8 173 GO:0005524

Feature Viewer

pLDDT pTM Quality
82.69 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map