F428463

General Info

Members Datasets Scaffolds Average Seq Length
379 254 375 325

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0033540|Ga0496105_0033540_1099_2235
Length 378
Sequence MAPPQIAGRWCGRLVMVAGAGLDYDVETGAPRIGSSIDRRLSRGMWTTALRKGGELMMSGKTIVALGLLMCFAGSGLEAQEFPTRPITLIVPYTAGGGNDAMARVVADSMGVTLGQQIVIENRGGAGGSIATRQVARAAPDGYTLGLGGTGTLAIDPTLYPNVGYDPRKDFAPVGLIATSALIVLVNPSLPSKTLPEFIAFAKAQPGKINYASAGSGSGIHLGTELLAYMAGIKMTHIPYKGSAPALTDLIGGHVALYFSSLPPAIGLVREGKVRALAVTGPTRSKAFPDVPTAAETLPGFEAVLHYGIIAPAGTPRPVIDKLNAAMRTALATREVQARIETDGAEAFPSTPEQYATDIDREETKWSEIVRRSGAKAE

Samples

Sample ID Description Type Environment
1 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
2 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
3 2941479691
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19
Nodule 0
Rhizoplane 7.39
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002736 3300003215 Bacteria 10050
2 Ga0055526_1000175 3300003771 Bacteria 56970
3 Ga0055526_1000552 3300003771 Bacteria 29632
4 Ga0055537_1000315 3300003773 Bacteria 33077
5 Ga0055524_1002475 3300003775 Bacteria 9488
6 Ga0055536_1000040 3300003781 Bacteria 128983
7 Ga0055534_1000997 3300003784 Bacteria 12430
8 Ga0055534_1001359 3300003784 Bacteria 9794
9 Ga0055531_10000205 3300003794 Bacteria 65042
10 Ga0070690_100024948 3300005330 Bacteria 3680
11 Ga0070670_100203174 3300005331 Bacteria 1722
12 Ga0070670_100421466 3300005331 Bacteria 1180
13 Ga0070680_100021345 3300005336 Bacteria 5145
14 Ga0070660_100082222 3300005339 Bacteria 2529
15 Ga0070689_100000603 3300005340 Bacteria 21743
16 Ga0070687_100059187 3300005343 Bacteria 2016
17 Ga0070661_100102049 3300005344 Bacteria 2135
18 Ga0070675_100063239 3300005354 Bacteria 3059
19 Ga0070671_100084667 3300005355 Bacteria 2652
20 Ga0070667_100330284 3300005367 Bacteria 1377
21 Ga0070714_100017103 3300005435 Bacteria 5871
22 Ga0070713_100404038 3300005436 Bacteria 1276
23 Ga0070710_10017508 3300005437 Bacteria 3668
24 Ga0070711_100047044 3300005439 Bacteria 2943
25 Ga0070708_100065705 3300005445 Bacteria 3253
26 Ga0070678_100045664 3300005456 Bacteria 3136
27 Ga0070681_10004653 3300005458 Bacteria 13109
28 Ga0070698_100091291 3300005471 Bacteria 3028
29 Ga0070698_100099318 3300005471 Bacteria 2884
30 Ga0070679_100016796 3300005530 Bacteria 7073
31 Ga0068853_100025409 3300005539 Bacteria 4969
32 Ga0070672_100203510 3300005543 Bacteria 1656
33 Ga0068855_100117128 3300005563 Bacteria 3053
34 Ga0068855_100144509 3300005563 Bacteria 2709
35 Ga0068856_100181164 3300005614 Bacteria 2120
36 Ga0068852_100085405 3300005616 Bacteria 2811
37 Ga0068859_100195158 3300005617 Bacteria 2109
38 Ga0068864_100053503 3300005618 Bacteria 3483
39 Ga0081455_10001481 3300005937 Bacteria 29042
40 Ga0081455_10057284 3300005937 Bacteria 3303
41 Ga0081455_10284209 3300005937 Bacteria 1194
42 Ga0081538_10018869 3300005981 Bacteria 5156
43 Ga0081540_1000085 3300005983 Bacteria 99716
44 Ga0081540_1001523 3300005983 Bacteria 19916
45 Ga0081540_1004899 3300005983 Bacteria 10082
46 Ga0081540_1014611 3300005983 Bacteria 5018
47 Ga0081540_1061762 3300005983 Bacteria 1784
48 Ga0081539_10020850 3300005985 Bacteria 4403
49 Ga0075365_10026147 3300006038 Bacteria 3702
50 Ga0075365_10043847 3300006038 Bacteria 2929
51 Ga0075368_10024970 3300006042 Bacteria 2291
52 Ga0075363_100129005 3300006048 Bacteria 1417
53 Ga0075363_100144665 3300006048 Bacteria 1340
54 Ga0075364_10051233 3300006051 Bacteria 2696
55 Ga0075364_10108143 3300006051 Bacteria 1854
56 Ga0075364_10226147 3300006051 Bacteria 1270
57 Ga0075362_10032515 3300006177 Bacteria 2264
58 Ga0075362_10069003 3300006177 Bacteria 1611
59 Ga0075367_10052071 3300006178 Bacteria 2422
60 Ga0075367_10148872 3300006178 Bacteria 1452
61 Ga0075369_10026530 3300006186 Bacteria 2415
62 Ga0075369_10148946 3300006186 Bacteria 1069
63 Ga0075366_10032598 3300006195 Bacteria 3067
64 Ga0075366_10035443 3300006195 Bacteria 2941
65 Ga0075366_10051044 3300006195 Bacteria 2457
66 Ga0075366_10110670 3300006195 Bacteria 1652
67 Ga0075370_10032071 3300006353 Bacteria 2935
68 Ga0075370_10032612 3300006353 Bacteria 2913
69 Ga0075370_10199734 3300006353 Bacteria 1179
70 Ga0075428_100112597 3300006844 Bacteria 2964
71 Ga0075428_100117178 3300006844 Bacteria 2901
72 Ga0075428_100410314 3300006844 Bacteria 1451
73 Ga0075428_100537457 3300006844 Bacteria 1250
74 Ga0075430_100000415 3300006846 Bacteria 31698
75 Ga0075430_100036301 3300006846 Bacteria 4179
76 Ga0075430_100043309 3300006846 Bacteria 3804
77 Ga0075430_100233546 3300006846 Bacteria 1525
78 Ga0075431_100039300 3300006847 Bacteria 4874
79 Ga0075431_100094111 3300006847 Bacteria 3092
80 Ga0075431_100135737 3300006847 Bacteria 2536
81 Ga0075433_10377019 3300006852 Bacteria 1253
82 Ga0075434_100199783 3300006871 Bacteria 2019
83 Ga0075429_100084666 3300006880 Bacteria 2763
84 Ga0075429_100174030 3300006880 Bacteria 1886
85 Ga0075436_100004103 3300006914 Bacteria 9988
86 Ga0075436_100065448 3300006914 Bacteria 2513
87 Ga0097620_100195147 3300006931 Bacteria 2109
88 Ga0075435_100050690 3300007076 Bacteria 3341
89 Ga0075435_100156713 3300007076 Bacteria 1916
90 Ga0099794_10003727 3300007265 Bacteria 5867
91 Ga0099795_10025843 3300007788 Bacteria 1973
92 Ga0105240_10062234 3300009093 Bacteria 4647
93 Ga0111539_10092935 3300009094 Bacteria 3544
94 Ga0105245_10666841 3300009098 Bacteria 1071
95 Ga0114129_10310693 3300009147 Bacteria 2098
96 Ga0114129_10558177 3300009147 Bacteria 1488
97 Ga0105243_10040300 3300009148 Bacteria 3646
98 Ga0105248_10044442 3300009177 Bacteria 4981
99 Ga0105249_10524337 3300009553 Bacteria 1232
100 Ga0163162_10286098 3300013306 Bacteria 1780
101 Ga0157372_10183499 3300013307 Bacteria 2423
102 Ga0163163_10255182 3300014325 Bacteria 1804
103 Ga0157380_10096719 3300014326 Bacteria 2448
104 Ga0157379_10065942 3300014968 Bacteria 3237
105 Ga0157376_10066897 3300014969 Bacteria 3038
106 Ga0157376_10346361 3300014969 Bacteria 1420
107 Ga0163161_10239311 3300017792 Bacteria 1411
108 Ga0163161_10266712 3300017792 Bacteria 1339
109 Ga0209672_104067 3300025228 Bacteria 2819
110 Ga0209565_1000076 3300025263 Bacteria 161760
111 Ga0209455_1000470 3300025272 Bacteria 30269
112 Ga0209673_1018366 3300025273 Bacteria 2545
113 Ga0209673_1019101 3300025273 Bacteria 2472
114 Ga0209130_1005427 3300025284 Bacteria 4421
115 Ga0209675_1000043 3300025291 Bacteria 235320
116 Ga0209675_1000047 3300025291 Bacteria 221683
117 Ga0209676_1000083 3300025292 Bacteria 279816
118 Ga0209025_1000106 3300025294 Bacteria 222421
119 Ga0209025_1019626 3300025294 Bacteria 3747
120 Ga0209564_1000145 3300025295 Bacteria 175251
121 Ga0209564_1000169 3300025295 Bacteria 157180
122 Ga0209564_1000553 3300025295 Bacteria 60114
123 Ga0209758_1000370 3300025297 Bacteria 79289
124 Ga0209758_1040404 3300025297 Bacteria 1760
125 Ga0209256_1001339 3300025299 Bacteria 26190
126 Ga0209051_1000310 3300025303 Bacteria 76181
127 Ga0209257_1000165 3300025304 Bacteria 172773
128 Ga0207692_10010740 3300025898 Bacteria 3873
129 Ga0207699_10061307 3300025906 Bacteria 2262
130 Ga0207699_10079203 3300025906 Bacteria 2032
131 Ga0207684_10070691 3300025910 Bacteria 2966
132 Ga0207695_10120362 3300025913 Bacteria 2594
133 Ga0207693_10021964 3300025915 Bacteria 5073
134 Ga0207662_10009892 3300025918 Bacteria 5262
135 Ga0207657_10058797 3300025919 Bacteria 3306
136 Ga0207657_10098170 3300025919 Bacteria 2434
137 Ga0207652_10437774 3300025921 Bacteria 1179
138 Ga0207650_10095963 3300025925 Bacteria 2274
139 Ga0207659_10037172 3300025926 Bacteria 3378
140 Ga0207700_10083898 3300025928 Bacteria 2496
141 Ga0207700_10355186 3300025928 Bacteria 1277
142 Ga0207644_10074344 3300025931 Bacteria 2494
143 Ga0207709_10065852 3300025935 Bacteria 2280
144 Ga0207670_10001143 3300025936 Bacteria 13975
145 Ga0207669_10089074 3300025937 Bacteria 2003
146 Ga0207704_10046902 3300025938 Bacteria 2579
147 Ga0207704_10363218 3300025938 Bacteria 1131
148 Ga0207665_10115051 3300025939 Bacteria 1894
149 Ga0207691_10155124 3300025940 Bacteria 2011
150 Ga0207711_10044455 3300025941 Bacteria 3791
151 Ga0207667_10087243 3300025949 Bacteria 3228
152 Ga0207668_10064242 3300025972 Bacteria 2593
153 Ga0207658_10056143 3300025986 Bacteria 2921
154 Ga0207677_10087568 3300026023 Bacteria 2255
155 Ga0207639_10313571 3300026041 Bacteria 1390
156 Ga0207708_10058004 3300026075 Bacteria 2954
157 Ga0207676_10326315 3300026095 Bacteria 1411
158 Ga0207675_100101582 3300026118 Bacteria 2709
159 Ga0207683_10023512 3300026121 Bacteria 5302
160 Ga0209813_10012253 3300027866 Bacteria 2261
161 Ga0265338_10242080 3300028800 Bacteria 1335
162 Ga0265330_10019803 3300031235 Bacteria 3077
163 Ga0265330_10049109 3300031235 Bacteria 1855
164 Ga0265332_10062742 3300031238 Bacteria 1588
165 Ga0265320_10008779 3300031240 Bacteria 6152
166 Ga0265325_10001607 3300031241 Bacteria 15749
167 Ga0265325_10044153 3300031241 Bacteria 2323
168 Ga0265325_10088700 3300031241 Bacteria 1528
169 Ga0265340_10013612 3300031247 Bacteria 4270
170 Ga0265340_10084499 3300031247 Bacteria 1490
171 Ga0265340_10122736 3300031247 Bacteria 1194
172 Ga0265339_10110941 3300031249 Bacteria 1419
173 Ga0265331_10114578 3300031250 Bacteria 1235
174 Ga0265327_10059142 3300031251 Bacteria 1964
175 Ga0307408_100002243 3300031548 Bacteria 13790
176 Ga0265313_10009178 3300031595 Bacteria 6453
177 Ga0265313_10054540 3300031595 Bacteria 1898
178 Ga0265314_10121974 3300031711 Bacteria 1639
179 Ga0265342_10057608 3300031712 Bacteria 2299
180 Ga0307406_10016868 3300031901 Bacteria 4249
181 Ga0307409_100469087 3300031995 Bacteria 1219
182 Ga0373929_0026703 3300035085 Bacteria 1208
183 Ga0373934_0081376 3300035086 Bacteria 1301
184 Ga0373934_0100764 3300035086 Unclassified 1168
185 Ga0373923_0000690 3300035111 Bacteria 8614
186 Ga0373936_0000146 3300035113 Bacteria 23912
187 Ga0373936_0008284 3300035113 Bacteria 3909
188 Ga0373936_0084960 3300035113 Bacteria 1321
189 Ga0373953_0079008 3300035117 Bacteria 1365
190 Ga0373954_0006243 3300035118 Bacteria 5195
191 Ga0373954_0011226 3300035118 Bacteria 3966
192 Ga0373943_0005491 3300035170 Bacteria 5703
193 Ga0373946_0005533 3300035171 Bacteria 4558
194 Ga0373955_0030817 3300035172 Bacteria 2804
195 Ga0373961_0016098 3300035241 Bacteria 1923
196 Ga0373924_0011661 3300035410 Bacteria 3268
197 Ga0373924_0049043 3300035410 Bacteria 1746
198 Ga0373931_0006360 3300035691 Bacteria 5514
199 Ga0373931_0111061 3300035691 Bacteria 1555
200 Ga0373931_0151767 3300035691 Bacteria 1351
201 Ga0373935_0000054 3300035692 Bacteria 46833
202 Ga0373935_0105595 3300035692 Bacteria 1863
203 Ga0373935_0114748 3300035692 Bacteria 1792
204 Ga0373935_0202198 3300035692 Bacteria 1373
205 Ga0373927_0011802 3300035695 Bacteria 5819
206 Ga0373933_0007429 3300035724 Bacteria 5979
207 Ga0373947_0115079 3300035725 Bacteria 1704
208 Ga0373937_0000378 3300036401 Bacteria 41426
209 Ga0373937_0017808 3300036401 Bacteria 6338
210 Ga0373925_0000075 3300037068 Bacteria 105395
211 Ga0373925_0222474 3300037068 Bacteria 1507
212 Ga0395898_0208606 3300037466 Bacteria 1864
213 Ga0395905_0000043 3300037471 Bacteria 247469
214 Ga0395905_0001258 3300037471 Bacteria 31334
215 Ga0395901_0271691 3300038443 Bacteria 1763
216 Ga0436365_1008402 3300039437 Bacteria 1535
217 Ga0436361_0149422 3300039447 Bacteria 7078
218 Ga0436363_0818795 3300039450 Bacteria 1510
219 Ga0439459_0005571 3300042438 Bacteria 2074
220 Ga0466967_0040942 3300045976 Bacteria 3991
221 Ga0495592_0000060 3300046454 Bacteria 100113
222 Ga0495629_0015473 3300046459 Bacteria 5478
223 Ga0495651_0014759 3300046462 Bacteria 6041
224 Ga0495651_0129261 3300046462 Bacteria 1846
225 Ga0495653_0000063 3300046463 Bacteria 93232
226 Ga0495582_0059338 3300046473 Bacteria 2111
227 Ga0495664_0000004 3300046477 Bacteria 489411
228 Ga0495608_0000005 3300046511 Bacteria 350726
229 Ga0495618_0010849 3300046514 Bacteria 5515
230 Ga0495628_0000001 3300046516 Bacteria 917742
231 Ga0495630_0025370 3300046517 Bacteria 4382
232 Ga0495630_0040099 3300046517 Bacteria 3499
233 Ga0495652_0000002 3300046529 Bacteria 946606
234 Ga0495652_0204119 3300046529 Bacteria 1498
235 Ga0495640_0000001 3300046533 Bacteria 853827
236 Ga0495640_0062373 3300046533 Bacteria 2528
237 Ga0495587_0000001 3300046536 Bacteria 724132
238 Ga0495645_0000002 3300046543 Bacteria 651644
239 Ga0495667_0000039 3300046559 Bacteria 131308
240 Ga0495667_0071226 3300046559 Bacteria 2268
241 Ga0495656_0005165 3300046615 Bacteria 4502
242 Ga0495634_0015722 3300046642 Bacteria 5427
243 Ga0495634_0133348 3300046642 Bacteria 1582
244 Ga0495635_0000002 3300046663 Bacteria 490490
245 Ga0495659_0018301 3300046664 Bacteria 2333
246 Ga0495657_0000042 3300046675 Bacteria 114669
247 Ga0495599_0000013 3300046678 Bacteria 179828
248 Ga0495623_0000604 3300046679 Bacteria 23931
249 Ga0495646_0000009 3300046680 Bacteria 200698
250 Ga0495600_0000035 3300046809 Bacteria 80552
251 Ga0495604_0000020 3300047317 Bacteria 171989
252 Ga0495674_0000002 3300047319 Bacteria 642785
253 Ga0495674_0069161 3300047319 Bacteria 3054
254 Ga0495680_0002330 3300047322 Bacteria 19470
255 Ga0495675_0016473 3300047444 Bacteria 4675
256 Ga0495684_0000016 3300047471 Bacteria 169338
257 Ga0495593_0014706 3300047673 Bacteria 4448
258 Ga0495602_0036620 3300048088 Bacteria 4564
259 Ga0495602_0294746 3300048088 Bacteria 1189
260 Ga0496100_0013927 3300048903 Bacteria 4655
261 Ga0496101_0024030 3300048904 Bacteria 4216
262 Ga0496102_0095653 3300048905 Bacteria 2753
263 Ga0496104_0000406 3300048907 Bacteria 37705
264 Ga0496104_0091653 3300048907 Bacteria 2905
265 Ga0496104_0094284 3300048907 Bacteria 2863
266 Ga0496105_0026574 3300048908 Bacteria 4724
267 Ga0496105_0033540 3300048908 Bacteria 4217
268 Ga0496105_0195962 3300048908 Bacteria 1650
269 Ga0496106_0127264 3300048909 Bacteria 1995
270 Ga0496106_0139967 3300048909 Bacteria 1903
271 Ga0496106_0159761 3300048909 Bacteria 1782
272 Ga0496108_0123671 3300048911 Bacteria 2220
273 Ga0496108_0239742 3300048911 Bacteria 1577
274 Ga0496109_0043766 3300048912 Bacteria 4059
275 Ga0496109_0191296 3300048912 Bacteria 1923
276 Ga0496109_0219471 3300048912 Bacteria 1788
277 Ga0496110_0030423 3300048913 Bacteria 4654
278 Ga0496110_0085613 3300048913 Bacteria 2813
279 Ga0496110_0093117 3300048913 Bacteria 2697
280 Ga0496110_0119865 3300048913 Bacteria 2370
281 Ga0496111_0053689 3300048914 Bacteria 2912
282 Ga0496112_0122737 3300048915 Bacteria 2568
283 Ga0496112_0129757 3300048915 Bacteria 2492
284 Ga0496114_0018547 3300048917 Bacteria 5627
285 Ga0496114_0188864 3300048917 Bacteria 1802
286 Ga0496115_0046163 3300048918 Bacteria 3480
287 Ga0496115_0056128 3300048918 Bacteria 3165
288 Ga0501031_0029599 3300049568 Bacteria 3572
289 Ga0501033_0016164 3300049570 Bacteria 5651
290 Ga0501034_0124998 3300049571 Bacteria 2557
291 Ga0501034_0515699 3300049571 Bacteria 1108
292 Ga0501036_0081616 3300049572 Bacteria 2732
293 Ga0501037_0022070 3300049573 Bacteria 4711
294 Ga0501037_0178039 3300049573 Bacteria 1510
295 Ga0501039_0016654 3300049575 Bacteria 5631
296 Ga0501042_0103515 3300049578 Bacteria 2048
297 Ga0501043_0036153 3300049579 Bacteria 3885
298 Ga0501043_0100993 3300049579 Bacteria 2267
299 Ga0501043_0266249 3300049579 Bacteria 1317
300 Ga0501046_0011557 3300049580 Bacteria 7549
301 Ga0501047_0166219 3300049581 Bacteria 2076
302 Ga0501047_0235218 3300049581 Bacteria 1684
303 Ga0501048_0010417 3300049582 Bacteria 6943
304 Ga0501067_0005882 3300049583 Bacteria 6797
305 Ga0501068_0019656 3300049584 Bacteria 3926
306 Ga0501068_0159588 3300049584 Bacteria 1421
307 Ga0501069_0004753 3300049585 Bacteria 7027
308 Ga0501070_0029517 3300049586 Bacteria 4596
309 Ga0501071_0190814 3300049587 Bacteria 1537
310 Ga0501072_0287563 3300049588 Bacteria 1307
311 Ga0501073_0028129 3300049589 Bacteria 4016
312 Ga0501074_0016242 3300049590 Bacteria 5407
313 Ga0501076_0110337 3300049592 Bacteria 2224
314 Ga0501077_0187255 3300049593 Bacteria 1315
315 Ga0501080_0123775 3300049742 Bacteria 2395
316 Ga0501083_0049048 3300049744 Bacteria 2848
317 Ga0501035_0107772 3300049822 Bacteria 2442
318 Ga0501044_0054477 3300049823 Bacteria 4110
319 Ga0501045_0011023 3300049824 Bacteria 6337
320 Ga0501045_0129453 3300049824 Bacteria 1876
321 nmdc:mga03683_86715_c1 3300050489 Bacteria 1360
322 nmdc:mga03n38_33182_c1 3300050490 Bacteria 2194
323 nmdc:mga00v17_238549_c1 3300050491 Bacteria 1179
324 nmdc:mga00v17_242057_c1 3300050491 Bacteria 1170
325 nmdc:mga00v17_65626_c1 3300050491 Bacteria 2240
326 nmdc:mga00v17_80918_c1 3300050491 Bacteria 2028
327 nmdc:mga0yw44_111304_c1 3300050492 Bacteria 1755
328 nmdc:mga0yw44_22335_c1 3300050492 Bacteria 3547
329 nmdc:mga0yw44_316329_c1 3300050492 Bacteria 1048
330 nmdc:mga0yw44_74853_c2 3300050492 Bacteria 1437
331 nmdc:mga0k408_31803_c1 3300050493 Bacteria 3015
332 nmdc:mga0k408_56621_c2 3300050493 Bacteria 1931
333 nmdc:mga0k408_87670_c1 3300050493 Bacteria 1828
334 nmdc:mga0k408_93807_c2 3300050493 Bacteria 1269
335 nmdc:mga06z11_205692_c1 3300050494 Bacteria 1145
336 nmdc:mga06z11_24570_c1 3300050494 Bacteria 2845
337 nmdc:mga06z11_33475_c1 3300050494 Bacteria 2514
338 nmdc:mga04h51_13753_c1 3300050495 Bacteria 2298
339 nmdc:mga07m45_56706_c1 3300050496 Bacteria 2215
340 nmdc:mga05p37_444916_c1 3300050507 Bacteria 1501
341 nmdc:mga09592_138496_c1 3300050508 Bacteria 2097
342 nmdc:mga09592_199559_c1 3300050508 Bacteria 1732
343 nmdc:mga09592_96730_c1 3300050508 Bacteria 2526
344 nmdc:mga0qj67_132633_c1 3300050509 Bacteria 2018
345 nmdc:mga0qj67_148685_c1 3300050509 Bacteria 1900
346 nmdc:mga0qj67_190929_c1 3300050509 Bacteria 1665
347 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
348 nmdc:mga06r32_111910_c1 3300050510 Bacteria 2687
349 nmdc:mga06r32_304167_c1 3300050510 Bacteria 1580
350 nmdc:mga06r32_550889_c1 3300050510 Bacteria 1127
351 nmdc:mga0n895_186049_c1 3300050512 Bacteria 2108
352 nmdc:mga0n895_361750_c1 3300050512 Bacteria 1469
353 nmdc:mga0n895_517762_c1 3300050512 Bacteria 1201
354 nmdc:mga0rr50_148925_c1 3300050513 Bacteria 1889
355 nmdc:mga0rr50_296548_c1 3300050513 Bacteria 1352
356 nmdc:mga08x19_93538_c1 3300050514 Bacteria 1987
357 nmdc:mga08x19_98465_c1 3300050514 Bacteria 1937
358 nmdc:mga0a205_147774_c1 3300050515 Bacteria 2250
359 nmdc:mga0sz30_24547_c1 3300050516 Bacteria 2461
360 Ga0495601_0000018 3300053077 Bacteria 171665
361 Ga0495601_0003815 3300053077 Bacteria 8670
362 Ga0495612_0000017 3300053078 Bacteria 152112
363 Ga0495595_0000010 3300053084 Bacteria 178819
364 Ga0495595_0020867 3300053084 Bacteria 2855
365 Ga0495619_0000014 3300053085 Bacteria 261449
366 Ga0495619_0097708 3300053085 Bacteria 1995
367 Ga0495619_0278571 3300053085 Bacteria 1159
368 Ga0500642_0132051 3300053130 Bacteria 1170
369 Ga0500616_0015381 3300053153 Bacteria 4377
370 Ga0501084_0023624 3300054114 Bacteria 5127
371 Ga0501084_0128083 3300054114 Bacteria 2137
372 Ga0501082_0015352 3300060353 Bacteria 6591
373 Ga0501082_0106746 3300060353 Bacteria 2423
374 Ga0501082_0272110 3300060353 Bacteria 1474
375 Ga0530510_0025338 3300061734 Bacteria 4240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0133348 Ga0495634_0133348_136_1008 288
2 3300060353 Ga0501082_0272110 Ga0501082_0272110_567_1448 292
3 3300006353 Ga0075370_10032071 Ga0075370_100320713 294
4 3300050510 nmdc:mga06r32_304167_c1 nmdc:mga06r32_304167_c1_294_1247 294
5 3300050494 nmdc:mga06z11_24570_c1 nmdc:mga06z11_24570_c1_1806_2771 299
6 3300025228 Ga0209672_104067 Ga0209672_1040672 300
7 3300025272 Ga0209455_1000470 Ga0209455_10004704 300
8 3300006353 Ga0075370_10199734 Ga0075370_101997341 301
9 3300006186 Ga0075369_10148946 Ga0075369_101489461 302
10 3300050489 nmdc:mga03683_86715_c1 nmdc:mga03683_86715_c1_320_1285 302
11 3300050492 nmdc:mga0yw44_316329_c1 nmdc:mga0yw44_316329_c1_47_1012 302
12 3300050492 nmdc:mga0yw44_74853_c2 nmdc:mga0yw44_74853_c2_234_1199 302
13 3300050493 nmdc:mga0k408_93807_c2 nmdc:mga0k408_93807_c2_189_1154 302
14 3300003773 Ga0055537_1000315 Ga0055537_100031530 304
15 3300003775 Ga0055524_1002475 Ga0055524_10024759 304
16 3300003784 Ga0055534_1001359 Ga0055534_10013596 304
17 3300025263 Ga0209565_1000076 Ga0209565_100007625 304
18 3300025273 Ga0209673_1018366 Ga0209673_10183662 304
19 3300025291 Ga0209675_1000047 Ga0209675_100004725 304
20 3300025294 Ga0209025_1019626 Ga0209025_10196264 304
21 3300025295 Ga0209564_1000553 Ga0209564_100055339 304
22 3300025297 Ga0209758_1040404 Ga0209758_10404042 304
23 3300025299 Ga0209256_1001339 Ga0209256_100133926 304
24 3300042438 Ga0439459_0005571 Ga0439459_0005571_318_1289 304
25 3300003771 Ga0055526_1000552 Ga0055526_10005525 305
26 3300003784 Ga0055534_1000997 Ga0055534_100099712 305
27 3300005983 Ga0081540_1004899 Ga0081540_10048996 305
28 3300006846 Ga0075430_100000415 Ga0075430_10000041510 305
29 3300025284 Ga0209130_1005427 Ga0209130_10054272 305
30 3300025291 Ga0209675_1000043 Ga0209675_100004323 305
31 3300025295 Ga0209564_1000169 Ga0209564_100016919 305
32 3300050509 nmdc:mga0qj67_19_c1 nmdc:mga0qj67_19_c1_85793_86770 305
33 3300009094 Ga0111539_10092935 Ga0111539_100929355 309
34 3300047319 Ga0495674_0069161 Ga0495674_0069161_1952_2917 309
35 3300050491 nmdc:mga00v17_238549_c1 nmdc:mga00v17_238549_c1_120_1085 310
36 3300003794 Ga0055531_10000205 Ga0055531_1000020514 312
37 3300005330 Ga0070690_100024948 Ga0070690_1000249482 312
38 3300005340 Ga0070689_100000603 Ga0070689_1000006037 312
39 3300005354 Ga0070675_100063239 Ga0070675_1000632392 312
40 3300005456 Ga0070678_100045664 Ga0070678_1000456643 312
41 3300005617 Ga0068859_100195158 Ga0068859_1001951582 312
42 3300005618 Ga0068864_100053503 Ga0068864_1000535032 312
43 3300006931 Ga0097620_100195147 Ga0097620_1001951472 312
44 3300009147 Ga0114129_10310693 Ga0114129_103106931 312
45 3300009148 Ga0105243_10040300 Ga0105243_100403003 312
46 3300014325 Ga0163163_10255182 Ga0163163_102551822 312
47 3300017792 Ga0163161_10266712 Ga0163161_102667122 312
48 3300025273 Ga0209673_1019101 Ga0209673_10191012 312
49 3300025303 Ga0209051_1000310 Ga0209051_100031051 312
50 3300025304 Ga0209257_1000165 Ga0209257_1000165144 312
51 3300025918 Ga0207662_10009892 Ga0207662_100098922 312
52 3300025926 Ga0207659_10037172 Ga0207659_100371723 312
53 3300025935 Ga0207709_10065852 Ga0207709_100658522 312
54 3300025936 Ga0207670_10001143 Ga0207670_100011432 312
55 3300025937 Ga0207669_10089074 Ga0207669_100890742 312
56 3300025938 Ga0207704_10046902 Ga0207704_100469022 312
57 3300025972 Ga0207668_10064242 Ga0207668_100642422 312
58 3300025986 Ga0207658_10056143 Ga0207658_100561432 312
59 3300026121 Ga0207683_10023512 Ga0207683_100235125 312
60 3300035241 Ga0373961_0016098 Ga0373961_0016098_224_1207 312
61 3300035691 Ga0373931_0111061 Ga0373931_0111061_410_1393 312
62 3300037068 Ga0373925_0222474 Ga0373925_0222474_47_1021 312
63 3300037471 Ga0395905_0000043 Ga0395905_0000043_38530_39498 312
64 3300048911 Ga0496108_0239742 Ga0496108_0239742_133_1116 312
65 3300048912 Ga0496109_0219471 Ga0496109_0219471_197_1180 312
66 3300048913 Ga0496110_0085613 Ga0496110_0085613_1460_2443 312
67 3300048915 Ga0496112_0122737 Ga0496112_0122737_1478_2461 312
68 3300050507 nmdc:mga05p37_444916_c1 nmdc:mga05p37_444916_c1_219_1181 312
69 3300005367 Ga0070667_100330284 Ga0070667_1003302841 313
70 3300031247 Ga0265340_10084499 Ga0265340_100844992 313
71 3300035725 Ga0373947_0115079 Ga0373947_0115079_536_1513 313
72 3300005355 Ga0070671_100084667 Ga0070671_1000846672 314
73 3300005439 Ga0070711_100047044 Ga0070711_1000470443 314
74 3300005471 Ga0070698_100091291 Ga0070698_1000912912 314
75 3300005539 Ga0068853_100025409 Ga0068853_1000254093 314
76 3300009093 Ga0105240_10062234 Ga0105240_100622342 314
77 3300009177 Ga0105248_10044442 Ga0105248_100444424 314
78 3300014968 Ga0157379_10065942 Ga0157379_100659422 314
79 3300014969 Ga0157376_10066897 Ga0157376_100668974 314
80 3300025898 Ga0207692_10010740 Ga0207692_100107403 314
81 3300025913 Ga0207695_10120362 Ga0207695_101203622 314
82 3300025931 Ga0207644_10074344 Ga0207644_100743442 314
83 3300025938 Ga0207704_10363218 Ga0207704_103632181 314
84 3300025941 Ga0207711_10044455 Ga0207711_100444553 314
85 3300026041 Ga0207639_10313571 Ga0207639_103135712 314
86 3300035085 Ga0373929_0026703 Ga0373929_0026703_43_1026 314
87 3300035691 Ga0373931_0006360 Ga0373931_0006360_2405_3388 314
88 3300039437 Ga0436365_1008402 Ga0436365_1008402_210_1277 314
89 3300048903 Ga0496100_0013927 Ga0496100_0013927_3502_4485 314
90 3300048904 Ga0496101_0024030 Ga0496101_0024030_1480_2463 314
91 3300048905 Ga0496102_0095653 Ga0496102_0095653_186_1169 314
92 3300048907 Ga0496104_0091653 Ga0496104_0091653_1041_2024 314
93 3300048907 Ga0496104_0094284 Ga0496104_0094284_1222_2202 314
94 3300048908 Ga0496105_0026574 Ga0496105_0026574_3201_4181 314
95 3300048908 Ga0496105_0033540 Ga0496105_0033540_1099_2235 314
96 3300048909 Ga0496106_0127264 Ga0496106_0127264_205_1188 314
97 3300048909 Ga0496106_0139967 Ga0496106_0139967_749_1729 314
98 3300048911 Ga0496108_0123671 Ga0496108_0123671_990_1973 314
99 3300048912 Ga0496109_0043766 Ga0496109_0043766_2186_3169 314
100 3300048912 Ga0496109_0191296 Ga0496109_0191296_210_1190 314
101 3300048913 Ga0496110_0093117 Ga0496110_0093117_500_1483 314
102 3300048915 Ga0496112_0129757 Ga0496112_0129757_513_1493 314
103 3300048917 Ga0496114_0018547 Ga0496114_0018547_1646_2629 314
104 3300048917 Ga0496114_0188864 Ga0496114_0188864_51_1055 314
105 3300048918 Ga0496115_0046163 Ga0496115_0046163_1140_2123 314
106 3300005937 Ga0081455_10057284 Ga0081455_100572844 315
107 3300006038 Ga0075365_10026147 Ga0075365_100261472 315
108 3300006844 Ga0075428_100112597 Ga0075428_1001125972 315
109 3300007788 Ga0099795_10025843 Ga0099795_100258432 315
110 3300031241 Ga0265325_10088700 Ga0265325_100887002 315
111 3300031249 Ga0265339_10110941 Ga0265339_101109411 315
112 3300035086 Ga0373934_0081376 Ga0373934_0081376_147_1163 315
113 3300035111 Ga0373923_0000690 Ga0373923_0000690_3359_4375 315
114 3300035113 Ga0373936_0000146 Ga0373936_0000146_6906_7922 315
115 3300035113 Ga0373936_0008284 Ga0373936_0008284_2216_3196 315
116 3300035117 Ga0373953_0079008 Ga0373953_0079008_215_1231 315
117 3300035118 Ga0373954_0006243 Ga0373954_0006243_3154_4170 315
118 3300035170 Ga0373943_0005491 Ga0373943_0005491_413_1429 315
119 3300035171 Ga0373946_0005533 Ga0373946_0005533_361_1377 315
120 3300035410 Ga0373924_0011661 Ga0373924_0011661_2149_3165 315
121 3300035692 Ga0373935_0000054 Ga0373935_0000054_39992_41008 315
122 3300035692 Ga0373935_0202198 Ga0373935_0202198_291_1268 315
123 3300035695 Ga0373927_0011802 Ga0373927_0011802_1096_2112 315
124 3300035724 Ga0373933_0007429 Ga0373933_0007429_2988_4004 315
125 3300036401 Ga0373937_0000378 Ga0373937_0000378_14035_15051 315
126 3300037068 Ga0373925_0000075 Ga0373925_0000075_101831_102847 315
127 3300046454 Ga0495592_0000060 Ga0495592_0000060_97594_98610 315
128 3300046459 Ga0495629_0015473 Ga0495629_0015473_2381_3397 315
129 3300046462 Ga0495651_0014759 Ga0495651_0014759_2664_3680 315
130 3300046463 Ga0495653_0000063 Ga0495653_0000063_105_1121 315
131 3300046473 Ga0495582_0059338 Ga0495582_0059338_968_1945 315
132 3300046477 Ga0495664_0000004 Ga0495664_0000004_474384_475400 315
133 3300046511 Ga0495608_0000005 Ga0495608_0000005_68136_69152 315
134 3300046514 Ga0495618_0010849 Ga0495618_0010849_2376_3392 315
135 3300046516 Ga0495628_0000001 Ga0495628_0000001_474373_475389 315
136 3300046517 Ga0495630_0025370 Ga0495630_0025370_1955_2971 315
137 3300046529 Ga0495652_0000002 Ga0495652_0000002_688907_689923 315
138 3300046533 Ga0495640_0000001 Ga0495640_0000001_782911_783927 315
139 3300046536 Ga0495587_0000001 Ga0495587_0000001_1642_2658 315
140 3300046543 Ga0495645_0000002 Ga0495645_0000002_474386_475402 315
141 3300046559 Ga0495667_0000039 Ga0495667_0000039_32531_33547 315
142 3300046559 Ga0495667_0071226 Ga0495667_0071226_677_1654 315
143 3300046642 Ga0495634_0015722 Ga0495634_0015722_2113_3129 315
144 3300046663 Ga0495635_0000002 Ga0495635_0000002_11535_12551 315
145 3300046675 Ga0495657_0000042 Ga0495657_0000042_16052_17068 315
146 3300046678 Ga0495599_0000013 Ga0495599_0000013_176224_177240 315
147 3300046679 Ga0495623_0000604 Ga0495623_0000604_13399_14415 315
148 3300046680 Ga0495646_0000009 Ga0495646_0000009_2475_3491 315
149 3300046809 Ga0495600_0000035 Ga0495600_0000035_6025_7041 315
150 3300047317 Ga0495604_0000020 Ga0495604_0000020_22733_23749 315
151 3300047319 Ga0495674_0000002 Ga0495674_0000002_474374_475390 315
152 3300047322 Ga0495680_0002330 Ga0495680_0002330_38_1054 315
153 3300047444 Ga0495675_0016473 Ga0495675_0016473_1501_2517 315
154 3300047471 Ga0495684_0000016 Ga0495684_0000016_66090_67106 315
155 3300047673 Ga0495593_0014706 Ga0495593_0014706_2140_3156 315
156 3300048088 Ga0495602_0036620 Ga0495602_0036620_2140_3156 315
157 3300049579 Ga0501043_0266249 Ga0501043_0266249_256_1224 315
158 3300049581 Ga0501047_0235218 Ga0501047_0235218_211_1179 315
159 3300049592 Ga0501076_0110337 Ga0501076_0110337_219_1196 315
160 3300050491 nmdc:mga00v17_65626_c1 nmdc:mga00v17_65626_c1_695_1678 315
161 3300050509 nmdc:mga0qj67_132633_c1 nmdc:mga0qj67_132633_c1_421_1404 315
162 3300050512 nmdc:mga0n895_361750_c1 nmdc:mga0n895_361750_c1_264_1238 315
163 3300050513 nmdc:mga0rr50_296548_c1 nmdc:mga0rr50_296548_c1_215_1189 315
164 3300053077 Ga0495601_0000018 Ga0495601_0000018_7610_8626 315
165 3300053078 Ga0495612_0000017 Ga0495612_0000017_148722_149738 315
166 3300053084 Ga0495595_0000010 Ga0495595_0000010_176200_177216 315
167 3300053085 Ga0495619_0000014 Ga0495619_0000014_56864_57880 315
168 3300054114 Ga0501084_0128083 Ga0501084_0128083_368_1318 315
169 3300005331 Ga0070670_100203174 Ga0070670_1002031743 316
170 3300005331 Ga0070670_100421466 Ga0070670_1004214661 316
171 3300005981 Ga0081538_10018869 Ga0081538_100188696 316
172 3300005985 Ga0081539_10020850 Ga0081539_100208503 316
173 3300006038 Ga0075365_10043847 Ga0075365_100438473 316
174 3300006042 Ga0075368_10024970 Ga0075368_100249702 316
175 3300006048 Ga0075363_100129005 Ga0075363_1001290052 316
176 3300006051 Ga0075364_10108143 Ga0075364_101081431 316
177 3300006051 Ga0075364_10226147 Ga0075364_102261472 316
178 3300006178 Ga0075367_10052071 Ga0075367_100520712 316
179 3300006186 Ga0075369_10026530 Ga0075369_100265302 316
180 3300006195 Ga0075366_10035443 Ga0075366_100354434 316
181 3300006195 Ga0075366_10051044 Ga0075366_100510442 316
182 3300006353 Ga0075370_10032612 Ga0075370_100326123 316
183 3300006846 Ga0075430_100233546 Ga0075430_1002335462 316
184 3300025925 Ga0207650_10095963 Ga0207650_100959631 316
185 3300027866 Ga0209813_10012253 Ga0209813_100122532 316
186 3300031241 Ga0265325_10044153 Ga0265325_100441532 316
187 3300031247 Ga0265340_10013612 Ga0265340_100136125 316
188 3300039450 Ga0436363_0818795 Ga0436363_0818795_364_1374 316
189 3300046517 Ga0495630_0040099 Ga0495630_0040099_1009_1974 316
190 3300046533 Ga0495640_0062373 Ga0495640_0062373_393_1358 316
191 3300050490 nmdc:mga03n38_33182_c1 nmdc:mga03n38_33182_c1_1088_2053 316
192 3300050491 nmdc:mga00v17_242057_c1 nmdc:mga00v17_242057_c1_118_1083 316
193 3300050491 nmdc:mga00v17_80918_c1 nmdc:mga00v17_80918_c1_730_1695 316
194 3300050492 nmdc:mga0yw44_111304_c1 nmdc:mga0yw44_111304_c1_246_1211 316
195 3300050493 nmdc:mga0k408_87670_c1 nmdc:mga0k408_87670_c1_405_1370 316
196 3300050495 nmdc:mga04h51_13753_c1 nmdc:mga04h51_13753_c1_929_1894 316
197 3300050496 nmdc:mga07m45_56706_c1 nmdc:mga07m45_56706_c1_379_1344 316
198 3300050508 nmdc:mga09592_199559_c1 nmdc:mga09592_199559_c1_247_1221 316
199 3300050509 nmdc:mga0qj67_148685_c1 nmdc:mga0qj67_148685_c1_472_1446 316
200 3300050516 nmdc:mga0sz30_24547_c1 nmdc:mga0sz30_24547_c1_1088_2053 316
201 3300053153 Ga0500616_0015381 Ga0500616_0015381_3345_4307 316
202 iso_pu_bacteria 2881101125 2881102037 316
203 3300005937 Ga0081455_10284209 Ga0081455_102842091 317
204 3300005983 Ga0081540_1000085 Ga0081540_100008587 317
205 3300025939 Ga0207665_10115051 Ga0207665_101150512 317
206 3300031235 Ga0265330_10049109 Ga0265330_100491092 317
207 3300031250 Ga0265331_10114578 Ga0265331_101145781 317
208 3300031595 Ga0265313_10054540 Ga0265313_100545402 317
209 3300049568 Ga0501031_0029599 Ga0501031_0029599_1774_2751 317
210 3300049570 Ga0501033_0016164 Ga0501033_0016164_3260_4237 317
211 3300049571 Ga0501034_0124998 Ga0501034_0124998_551_1561 317
212 3300049572 Ga0501036_0081616 Ga0501036_0081616_726_1736 317
213 3300049573 Ga0501037_0022070 Ga0501037_0022070_832_1809 317
214 3300049575 Ga0501039_0016654 Ga0501039_0016654_3420_4397 317
215 3300049578 Ga0501042_0103515 Ga0501042_0103515_325_1335 317
216 3300049579 Ga0501043_0100993 Ga0501043_0100993_389_1399 317
217 3300049580 Ga0501046_0011557 Ga0501046_0011557_973_1950 317
218 3300049581 Ga0501047_0166219 Ga0501047_0166219_198_1208 317
219 3300049582 Ga0501048_0010417 Ga0501048_0010417_4221_5231 317
220 3300049583 Ga0501067_0005882 Ga0501067_0005882_5705_6682 317
221 3300049584 Ga0501068_0019656 Ga0501068_0019656_998_2008 317
222 3300049585 Ga0501069_0004753 Ga0501069_0004753_862_1839 317
223 3300049586 Ga0501070_0029517 Ga0501070_0029517_3389_4366 317
224 3300049589 Ga0501073_0028129 Ga0501073_0028129_992_1969 317
225 3300049590 Ga0501074_0016242 Ga0501074_0016242_997_2007 317
226 3300049742 Ga0501080_0123775 Ga0501080_0123775_997_2007 317
227 3300049744 Ga0501083_0049048 Ga0501083_0049048_1631_2641 317
228 3300049822 Ga0501035_0107772 Ga0501035_0107772_869_1846 317
229 3300049823 Ga0501044_0054477 Ga0501044_0054477_231_1208 317
230 3300049824 Ga0501045_0011023 Ga0501045_0011023_3013_4023 317
231 3300054114 Ga0501084_0023624 Ga0501084_0023624_3139_4116 317
232 3300060353 Ga0501082_0015352 Ga0501082_0015352_1933_2910 317
233 3300005543 Ga0070672_100203510 Ga0070672_1002035102 318
234 3300005983 Ga0081540_1001523 Ga0081540_100152315 318
235 3300006177 Ga0075362_10032515 Ga0075362_100325152 318
236 3300006195 Ga0075366_10032598 Ga0075366_100325983 318
237 3300009553 Ga0105249_10524337 Ga0105249_105243372 318
238 3300013306 Ga0163162_10286098 Ga0163162_102860982 318
239 3300014326 Ga0157380_10096719 Ga0157380_100967193 318
240 3300014969 Ga0157376_10346361 Ga0157376_103463612 318
241 3300017792 Ga0163161_10239311 Ga0163161_102393112 318
242 3300025940 Ga0207691_10155124 Ga0207691_101551242 318
243 3300031251 Ga0265327_10059142 Ga0265327_100591422 318
244 3300046615 Ga0495656_0005165 Ga0495656_0005165_2910_3890 318
245 3300046664 Ga0495659_0018301 Ga0495659_0018301_1278_2258 318
246 3300049579 Ga0501043_0036153 Ga0501043_0036153_1137_2096 318
247 3300050494 nmdc:mga06z11_205692_c1 nmdc:mga06z11_205692_c1_74_1126 318
248 3300005339 Ga0070660_100082222 Ga0070660_1000822222 319
249 3300005458 Ga0070681_10004653 Ga0070681_100046538 319
250 3300005530 Ga0070679_100016796 Ga0070679_1000167963 319
251 3300006177 Ga0075362_10069003 Ga0075362_100690032 319
252 3300006844 Ga0075428_100410314 Ga0075428_1004103141 319
253 3300006846 Ga0075430_100036301 Ga0075430_1000363015 319
254 3300006847 Ga0075431_100039300 Ga0075431_1000393006 319
255 3300006847 Ga0075431_100094111 Ga0075431_1000941113 319
256 3300006880 Ga0075429_100174030 Ga0075429_1001740301 319
257 3300006914 Ga0075436_100065448 Ga0075436_1000654482 319
258 3300007076 Ga0075435_100050690 Ga0075435_1000506902 319
259 3300025919 Ga0207657_10098170 Ga0207657_100981702 319
260 3300026023 Ga0207677_10087568 Ga0207677_100875682 319
261 3300031235 Ga0265330_10019803 Ga0265330_100198032 319
262 3300031240 Ga0265320_10008779 Ga0265320_100087792 319
263 3300031548 Ga0307408_100002243 Ga0307408_1000022437 319
264 3300031595 Ga0265313_10009178 Ga0265313_100091784 319
265 3300031711 Ga0265314_10121974 Ga0265314_101219742 319
266 3300035692 Ga0373935_0114748 Ga0373935_0114748_633_1619 319
267 3300050508 nmdc:mga09592_96730_c1 nmdc:mga09592_96730_c1_599_1573 319
268 3300050513 nmdc:mga0rr50_148925_c1 nmdc:mga0rr50_148925_c1_672_1649 319
269 3300050514 nmdc:mga08x19_98465_c1 nmdc:mga08x19_98465_c1_320_1297 319
270 3300031901 Ga0307406_10016868 Ga0307406_100168683 320
271 3300031995 Ga0307409_100469087 Ga0307409_1004690872 320
272 iso_pu_bacteria 2941479691 2941484857 320
273 3300031712 Ga0265342_10057608 Ga0265342_100576082 321
274 3300035691 Ga0373931_0151767 Ga0373931_0151767_156_1130 321
275 3300035692 Ga0373935_0105595 Ga0373935_0105595_733_1707 321
276 3300037471 Ga0395905_0001258 Ga0395905_0001258_17928_18905 321
277 3300025906 Ga0207699_10079203 Ga0207699_100792032 322
278 3300005435 Ga0070714_100017103 Ga0070714_1000171038 323
279 3300005437 Ga0070710_10017508 Ga0070710_100175082 323
280 3300009147 Ga0114129_10558177 Ga0114129_105581772 323
281 3300025906 Ga0207699_10061307 Ga0207699_100613072 323
282 iso_pu_bacteria 2834641062 2834645674 323
283 iso_pu_bacteria 8003400568 8003405420 323
284 3300005336 Ga0070680_100021345 Ga0070680_1000213453 324
285 3300005344 Ga0070661_100102049 Ga0070661_1001020492 324
286 3300005445 Ga0070708_100065705 Ga0070708_1000657052 324
287 3300005563 Ga0068855_100117128 Ga0068855_1001171282 324
288 3300005563 Ga0068855_100144509 Ga0068855_1001445093 324
289 3300005614 Ga0068856_100181164 Ga0068856_1001811642 324
290 3300005616 Ga0068852_100085405 Ga0068852_1000854053 324
291 3300005937 Ga0081455_10001481 Ga0081455_100014814 324
292 3300007076 Ga0075435_100156713 Ga0075435_1001567132 324
293 3300013307 Ga0157372_10183499 Ga0157372_101834992 324
294 3300025910 Ga0207684_10070691 Ga0207684_100706912 324
295 3300025919 Ga0207657_10058797 Ga0207657_100587973 324
296 3300025921 Ga0207652_10437774 Ga0207652_104377742 324
297 3300025949 Ga0207667_10087243 Ga0207667_100872432 324
298 3300035118 Ga0373954_0011226 Ga0373954_0011226_751_1725 324
299 3300037466 Ga0395898_0208606 Ga0395898_0208606_597_1622 324
300 3300038443 Ga0395901_0271691 Ga0395901_0271691_46_1083 324
301 3300039447 Ga0436361_0149422 Ga0436361_0149422_5976_6992 324
302 3300046462 Ga0495651_0129261 Ga0495651_0129261_493_1467 324
303 3300046529 Ga0495652_0204119 Ga0495652_0204119_286_1260 324
304 3300048913 Ga0496110_0030423 Ga0496110_0030423_1257_2273 324
305 3300048914 Ga0496111_0053689 Ga0496111_0053689_249_1265 324
306 3300050512 nmdc:mga0n895_517762_c1 nmdc:mga0n895_517762_c1_153_1169 324
307 3300050515 nmdc:mga0a205_147774_c1 nmdc:mga0a205_147774_c1_437_1453 324
308 3300006844 Ga0075428_100537457 Ga0075428_1005374572 325
309 3300035113 Ga0373936_0084960 Ga0373936_0084960_167_1144 325
310 3300035172 Ga0373955_0030817 Ga0373955_0030817_153_1130 325
311 3300035410 Ga0373924_0049043 Ga0373924_0049043_132_1109 325
312 3300036401 Ga0373937_0017808 Ga0373937_0017808_2326_3303 325
313 3300048088 Ga0495602_0294746 Ga0495602_0294746_196_1173 325
314 3300053077 Ga0495601_0003815 Ga0495601_0003815_1392_2372 325
315 3300053084 Ga0495595_0020867 Ga0495595_0020867_811_1788 325
316 3300053085 Ga0495619_0097708 Ga0495619_0097708_157_1137 325
317 3300003771 Ga0055526_1000175 Ga0055526_10001758 326
318 3300005343 Ga0070687_100059187 Ga0070687_1000591872 326
319 3300005436 Ga0070713_100404038 Ga0070713_1004040381 326
320 3300005471 Ga0070698_100099318 Ga0070698_1000993183 326
321 3300005983 Ga0081540_1014611 Ga0081540_10146113 326
322 3300005983 Ga0081540_1061762 Ga0081540_10617622 326
323 3300006051 Ga0075364_10051233 Ga0075364_100512333 326
324 3300006178 Ga0075367_10148872 Ga0075367_101488722 326
325 3300006844 Ga0075428_100117178 Ga0075428_1001171782 326
326 3300006846 Ga0075430_100043309 Ga0075430_1000433093 326
327 3300006847 Ga0075431_100135737 Ga0075431_1001357371 326
328 3300006852 Ga0075433_10377019 Ga0075433_103770191 326
329 3300006871 Ga0075434_100199783 Ga0075434_1001997833 326
330 3300006880 Ga0075429_100084666 Ga0075429_1000846661 326
331 3300006914 Ga0075436_100004103 Ga0075436_10000410310 326
332 3300007265 Ga0099794_10003727 Ga0099794_100037275 326
333 3300009098 Ga0105245_10666841 Ga0105245_106668411 326
334 3300025295 Ga0209564_1000145 Ga0209564_1000145116 326
335 3300025915 Ga0207693_10021964 Ga0207693_100219645 326
336 3300025928 Ga0207700_10083898 Ga0207700_100838982 326
337 3300025928 Ga0207700_10355186 Ga0207700_103551861 326
338 3300026075 Ga0207708_10058004 Ga0207708_100580042 326
339 3300026118 Ga0207675_100101582 Ga0207675_1001015822 326
340 3300028800 Ga0265338_10242080 Ga0265338_102420802 326
341 3300031238 Ga0265332_10062742 Ga0265332_100627422 326
342 3300031241 Ga0265325_10001607 Ga0265325_100016074 326
343 3300031247 Ga0265340_10122736 Ga0265340_101227361 326
344 3300035086 Ga0373934_0100764 Ga0373934_0100764_16_999 326
345 3300045976 Ga0466967_0040942 Ga0466967_0040942_678_1658 326
346 3300048907 Ga0496104_0000406 Ga0496104_0000406_13748_14728 326
347 3300048908 Ga0496105_0195962 Ga0496105_0195962_414_1394 326
348 3300048909 Ga0496106_0159761 Ga0496106_0159761_237_1217 326
349 3300048913 Ga0496110_0119865 Ga0496110_0119865_405_1385 326
350 3300048918 Ga0496115_0056128 Ga0496115_0056128_1129_2109 326
351 3300049571 Ga0501034_0515699 Ga0501034_0515699_91_1071 326
352 3300049573 Ga0501037_0178039 Ga0501037_0178039_508_1491 326
353 3300049584 Ga0501068_0159588 Ga0501068_0159588_69_1052 326
354 3300049587 Ga0501071_0190814 Ga0501071_0190814_344_1327 326
355 3300049588 Ga0501072_0287563 Ga0501072_0287563_250_1230 326
356 3300049593 Ga0501077_0187255 Ga0501077_0187255_146_1129 326
357 3300049824 Ga0501045_0129453 Ga0501045_0129453_22_1005 326
358 3300050492 nmdc:mga0yw44_22335_c1 nmdc:mga0yw44_22335_c1_96_1121 326
359 3300050494 nmdc:mga06z11_33475_c1 nmdc:mga06z11_33475_c1_323_1306 326
360 3300050508 nmdc:mga09592_138496_c1 nmdc:mga09592_138496_c1_411_1466 326
361 3300050509 nmdc:mga0qj67_190929_c1 nmdc:mga0qj67_190929_c1_175_1230 326
362 3300050510 nmdc:mga06r32_111910_c1 nmdc:mga06r32_111910_c1_388_1443 326
363 3300050510 nmdc:mga06r32_550889_c1 nmdc:mga06r32_550889_c1_87_1112 326
364 3300050512 nmdc:mga0n895_186049_c1 nmdc:mga0n895_186049_c1_346_1326 326
365 3300050514 nmdc:mga08x19_93538_c1 nmdc:mga08x19_93538_c1_139_1122 326
366 3300053085 Ga0495619_0278571 Ga0495619_0278571_52_1098 326
367 3300053130 Ga0500642_0132051 Ga0500642_0132051_20_1003 326
368 3300060353 Ga0501082_0106746 Ga0501082_0106746_270_1250 326
369 3300061734 Ga0530510_0025338 Ga0530510_0025338_2292_3275 326
370 3300003781 Ga0055536_1000040 Ga0055536_100004065 327
371 3300025292 Ga0209676_1000083 Ga0209676_100008370 327
372 3300025294 Ga0209025_1000106 Ga0209025_100010614 327
373 3300006195 Ga0075366_10110670 Ga0075366_101106702 329
374 3300050493 nmdc:mga0k408_56621_c2 nmdc:mga0k408_56621_c2_856_1845 329
375 3300003215 JGI25153J46596_10002736 JGI25153J46596_100027365 330
376 3300006048 Ga0075363_100144665 Ga0075363_1001446652 330
377 3300025297 Ga0209758_1000370 Ga0209758_100037038 330
378 3300026095 Ga0207676_10326315 Ga0207676_103263152 330
379 3300050493 nmdc:mga0k408_31803_c1 nmdc:mga0k408_31803_c1_911_1906 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

102

375

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9554 34 327
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9522 34 327
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9495 31 330
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9488 32 330
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9464 31 330
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9378 130 247 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9326 131 252 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9306 31 330 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9276 130 252 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9253 31 330 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A537U4L1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9731 60 330
AF-A0A537U4L1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.966 60 330
AF-A0A0Q4Y6X1-F1-model_v4 ABC transporter substrate-binding protein 0.9629 56 330
AF-A0A4V2HUY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9629 94 330
AF-A0A4Q7NEM1-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9608 27 330

Feature Viewer

pLDDT pTM Quality
90.38 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map