F428453

General Info

Members Datasets Scaffolds Average Seq Length
379 242 758 214

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0085935|Ga0495642_0085935_109_822
Length 237
Sequence MRCALRFVVLLGFTKFELGKSNKIARLRRMSPRRSYDQYCSAARALDAVGDRWTLLIVRELLGGPRRYTDLHADLPGVSTDVLASRLKDMERDGLTTRRRLPPPGAAYVYELTGRGRELLPVLQALGEWGALALGERRPTDAVRAHWFALPLLRGLEGEGLVEVRLDEGEFHVWLVGEEGPVYGDGPAPEEPDARLTLDTQTCEAVSRGELALLDAVRAGRVEVTGEGTVAKVLREA

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
47 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
48 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
49 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
50 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
59 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
60 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
61 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
62 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
63 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
179 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
180 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
181 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
182 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
183 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
184 2643221548 Streptomyces sp. Root55 Isolate Unclassified
185 2643221578 Streptomyces sp. Root63 Isolate Unclassified
186 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
187 2643221647 Streptomyces sp. Root369 Isolate Unclassified
188 2643221670 Streptomyces sp. Root431 Isolate Unclassified
189 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
190 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
191 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
192 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
193 2643221714 Streptomyces sp. Root264 Isolate Unclassified
194 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
195 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
196 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
197 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
198 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
199 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
200 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
201 2808606448 Streptomyces sp. 193411 Isolate Unclassified
202 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
203 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
204 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
205 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
206 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
207 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
208 2862574272 Streptomyces sp. AcE210 Isolate Nodule
209 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
210 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
211 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
212 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
213 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
214 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
215 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
216 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
217 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
218 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
219 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
220 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
221 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
222 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
223 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
224 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
225 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
226 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
227 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
228 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
229 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
230 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
231 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
232 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
233 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
234 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
235 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
236 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
237 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
238 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
239 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
240 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
241 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
242 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.32
Metatranscriptomes 0.53
Isolates 17.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0.53
Rhizoplane 1.85
Rhizosphere 78.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0085935 3300046528 Bacteria 1328
2 JGI24739J22299_10010470 3300001989 Bacteria 3444
3 rootH1_10002350 3300003316 Bacteria 15113
4 rootH1_10009323 3300003316 Bacteria 2486
5 rootH2_10031229 3300003320 Bacteria 1508
6 rootH1_10041183 3300003323 Bacteria 4385
7 Ga0006562J51391_1041827 3300003578 Bacteria 5388
8 Ga0006562J51391_1041828 3300003578 Bacteria 4580
9 Ga0070682_100256776 3300005337 Bacteria 1263
10 Ga0070668_100659586 3300005347 Bacteria 920
11 Ga0070694_100320213 3300005444 Bacteria 1193
12 Ga0068857_100192869 3300005577 Bacteria 1856
13 Ga0068862_100371614 3300005844 Bacteria 1331
14 Ga0075368_10006593 3300006042 Bacteria 4065
15 Ga0075363_100078788 3300006048 Bacteria 1799
16 Ga0075367_10005179 3300006178 Bacteria 6443
17 Ga0075369_10269616 3300006186 Bacteria 792
18 Ga0075429_100119098 3300006880 Bacteria 2307
19 Ga0105251_10036144 3300009011 Bacteria 2433
20 Ga0105239_10116805 3300010375 Bacteria 2961
21 Ga0182008_10007251 3300014497 Bacteria 6130
22 Ga0182007_10008935 3300015262 Bacteria 4082
23 Ga0183367_1001 3300015688 Bacteria 1225545
24 Ga0209758_1005008 3300025297 Bacteria 10570
25 Ga0207426_1001965 3300025302 Bacteria 14601
26 Ga0207426_1003725 3300025302 Bacteria 7961
27 Ga0207713_1029649 3300025735 Bacteria 2447
28 Ga0207647_10016976 3300025904 Bacteria 4956
29 Ga0207647_10020334 3300025904 Bacteria 4452
30 Ga0207700_11002203 3300025928 Bacteria 747
31 Ga0207679_10529817 3300025945 Bacteria 1055
32 Ga0207674_10084745 3300026116 Bacteria 3166
33 Ga0209813_10021539 3300027866 Bacteria 1813
34 Ga0307517_10032696 3300028786 Bacteria 6001
35 Ga0307515_10000055 3300028794 Bacteria 264365
36 Ga0307515_10092557 3300028794 Bacteria 3761
37 Ga0307511_10001391 3300030521 Bacteria 25565
38 Ga0307512_10016035 3300030522 Bacteria 6925
39 Ga0307512_10203412 3300030522 Bacteria 1067
40 Ga0307513_10006375 3300031456 Bacteria 15424
41 Ga0307508_10010455 3300031616 Bacteria 8496
42 Ga0307508_10069436 3300031616 Bacteria 3094
43 Ga0307508_10080172 3300031616 Bacteria 2846
44 Ga0307514_10012213 3300031649 Bacteria 7149
45 Ga0307514_10088565 3300031649 Bacteria 2264
46 Ga0307514_10092050 3300031649 Bacteria 2207
47 Ga0307516_10003860 3300031730 Bacteria 18943
48 Ga0307516_10033455 3300031730 Bacteria 5172
49 Ga0307410_10078952 3300031852 Bacteria 2305
50 Ga0307416_100104810 3300032002 Bacteria 2473
51 Ga0307416_101165354 3300032002 Bacteria 876
52 Ga0307416_101242195 3300032002 Bacteria 851
53 Ga0307507_10062988 3300033179 Bacteria 3438
54 Ga0395900_0561461 3300037418 Bacteria 1085
55 Ga0395898_0002902 3300037466 Bacteria 19509
56 Ga0395898_0015996 3300037466 Bacteria 7685
57 Ga0395898_0085347 3300037466 Bacteria 3043
58 Ga0395901_0078042 3300038443 Bacteria 3457
59 Ga0436365_1741998 3300039437 Bacteria 801
60 Ga0439436_0000595 3300041404 Bacteria 9593
61 Ga0439436_0001097 3300041404 Bacteria 7634
62 Ga0439439_0008805 3300041406 Bacteria 2388
63 Ga0451802_0491012 3300041460 Bacteria 2362
64 Ga0451837_0975337 3300041494 Bacteria 2290
65 Ga0451849_1087752 3300041505 Bacteria 904
66 Ga0451851_0243766 3300041507 Bacteria 984
67 Ga0451853_0184670 3300041512 Bacteria 4751
68 Ga0451853_1223488 3300041512 Bacteria 8138
69 Ga0451853_1979018 3300041512 Bacteria 890
70 Ga0451853_2553527 3300041512 Bacteria 793
71 Ga0439433_0002558 3300041999 Bacteria 3863
72 Ga0439442_017467 3300042002 Bacteria 1481
73 Ga0439448_0001016 3300042005 Bacteria 7007
74 Ga0439449_0000165 3300042007 Bacteria 22755
75 Ga0439449_0010818 3300042007 Bacteria 3443
76 Ga0439449_0015748 3300042007 Bacteria 2843
77 Ga0439449_0104102 3300042007 Bacteria 1050
78 Ga0439455_0020302 3300042012 Bacteria 1574
79 Ga0439457_002432 3300042014 Bacteria 5324
80 Ga0439457_003348 3300042014 Bacteria 4379
81 Ga0450894_000320 3300042131 Bacteria 8573
82 Ga0450898_017577 3300042134 Bacteria 1231
83 Ga0450899_001526 3300042135 Bacteria 2575
84 Ga0450903_000211 3300042138 Bacteria 12957
85 Ga0450906_001346 3300042145 Bacteria 5394
86 Ga0439458_0001232 3300042157 Bacteria 6470
87 Ga0466969_0006698 3300044656 Bacteria 6126
88 Ga0466969_0013372 3300044656 Bacteria 4321
89 Ga0466972_0004117 3300044658 Bacteria 7258
90 Ga0466972_0008602 3300044658 Bacteria 5121
91 Ga0466972_0035112 3300044658 Bacteria 2454
92 Ga0466965_0048721 3300044683 Bacteria 2099
93 Ga0466965_0091486 3300044683 Bacteria 1548
94 Ga0466966_0033652 3300044684 Bacteria 3317
95 Ga0466966_0052289 3300044684 Bacteria 2595
96 Ga0466961_0024117 3300044693 Bacteria 3914
97 Ga0466961_0028991 3300044693 Bacteria 3558
98 Ga0466961_0122719 3300044693 Bacteria 1630
99 Ga0466961_0153458 3300044693 Bacteria 1437
100 Ga0466963_0001652 3300044694 Bacteria 12156
101 Ga0466971_0004552 3300044719 Bacteria 5996
102 Ga0466968_0098821 3300044735 Bacteria 1301
103 Ga0466968_0111368 3300044735 Bacteria 1231
104 Ga0466968_0120558 3300044735 Bacteria 1186
105 Ga0466970_0000327 3300044765 Bacteria 23151
106 Ga0466970_0002553 3300044765 Bacteria 8783
107 Ga0466970_0009561 3300044765 Bacteria 4904
108 Ga0466957_0003642 3300044842 Bacteria 8496
109 Ga0466960_0041405 3300044901 Bacteria 2182
110 Ga0466959_0000957 3300045049 Bacteria 17164
111 Ga0466959_0055671 3300045049 Bacteria 2887
112 Ga0466959_0056275 3300045049 Bacteria 2870
113 Ga0466958_0000983 3300045836 Bacteria 12883
114 Ga0466958_0120887 3300045836 Bacteria 1640
115 Ga0466967_0115561 3300045976 Bacteria 2471
116 Ga0466967_0157211 3300045976 Bacteria 2131
117 Ga0495617_044593 3300046452 Bacteria 1479
118 Ga0495592_0086380 3300046454 Bacteria 2259
119 Ga0495603_0001463 3300046455 Bacteria 13741
120 Ga0495603_0011153 3300046455 Bacteria 5447
121 Ga0495603_0014593 3300046455 Bacteria 4750
122 Ga0495603_0052492 3300046455 Bacteria 2420
123 Ga0495603_0232946 3300046455 Bacteria 1061
124 Ga0495590_0033175 3300046457 Bacteria 1805
125 Ga0495629_0007987 3300046459 Bacteria 7785
126 Ga0495629_0008204 3300046459 Bacteria 7680
127 Ga0495629_0009870 3300046459 Bacteria 6968
128 Ga0495629_0024015 3300046459 Bacteria 4342
129 Ga0495629_0027357 3300046459 Bacteria 4048
130 Ga0495629_0074954 3300046459 Bacteria 2363
131 Ga0495629_0092137 3300046459 Bacteria 2115
132 Ga0495638_0087247 3300046460 Bacteria 1885
133 Ga0495638_0279624 3300046460 Bacteria 907
134 Ga0495651_0001162 3300046462 Bacteria 20326
135 Ga0495651_0303772 3300046462 Bacteria 1069
136 Ga0495580_0114124 3300046472 Bacteria 1876
137 Ga0495582_0051026 3300046473 Bacteria 2281
138 Ga0495605_0012335 3300046474 Bacteria 4743
139 Ga0495605_0168314 3300046474 Bacteria 969
140 Ga0495639_0002975 3300046475 Bacteria 7375
141 Ga0495662_0016374 3300046476 Bacteria 3591
142 Ga0495662_0046768 3300046476 Bacteria 2089
143 Ga0495662_0085776 3300046476 Bacteria 1533
144 Ga0495664_0053511 3300046477 Bacteria 2400
145 Ga0495585_0031731 3300046492 Bacteria 2998
146 Ga0495594_0002817 3300046499 Bacteria 9035
147 Ga0495606_0076976 3300046507 Bacteria 2083
148 Ga0495618_0007324 3300046514 Bacteria 6676
149 Ga0495618_0125108 3300046514 Bacteria 1646
150 Ga0495628_0050128 3300046516 Bacteria 3303
151 Ga0495628_0210109 3300046516 Bacteria 1464
152 Ga0495630_0097557 3300046517 Bacteria 2223
153 Ga0495631_0302902 3300046518 Bacteria 680
154 Ga0495632_0191441 3300046519 Bacteria 934
155 Ga0495637_0062035 3300046520 Bacteria 1531
156 Ga0495643_0001873 3300046522 Bacteria 17832
157 Ga0495652_0069128 3300046529 Bacteria 2957
158 Ga0495652_0093277 3300046529 Bacteria 2458
159 Ga0495652_0209464 3300046529 Bacteria 1473
160 Ga0495640_0104381 3300046533 Bacteria 1857
161 Ga0495587_0003073 3300046536 Bacteria 11153
162 Ga0495587_0037326 3300046536 Bacteria 2918
163 Ga0495609_0014822 3300046538 Bacteria 3657
164 Ga0495609_0250600 3300046538 Bacteria 729
165 Ga0495597_0010176 3300046542 Bacteria 4608
166 Ga0495622_0070859 3300046557 Bacteria 1608
167 Ga0495622_0134970 3300046557 Bacteria 1122
168 Ga0495633_0352849 3300046558 Bacteria 666
169 Ga0495667_0051202 3300046559 Bacteria 2725
170 Ga0495667_0357459 3300046559 Bacteria 922
171 Ga0495668_0034984 3300046616 Bacteria 2815
172 Ga0495634_0022731 3300046642 Bacteria 4417
173 Ga0495611_0040581 3300046648 Bacteria 2075
174 Ga0495625_0033482 3300046660 Bacteria 3800
175 Ga0495625_0037951 3300046660 Bacteria 3529
176 Ga0495625_0255672 3300046660 Bacteria 1135
177 Ga0495635_0034579 3300046663 Bacteria 3506
178 Ga0495635_0041157 3300046663 Bacteria 3192
179 Ga0495635_0043171 3300046663 Bacteria 3111
180 Ga0495661_0009739 3300046665 Bacteria 6580
181 Ga0495588_0000688 3300046674 Bacteria 15586
182 Ga0495588_0004591 3300046674 Bacteria 6100
183 Ga0495588_0022451 3300046674 Bacteria 3119
184 Ga0495588_0064639 3300046674 Bacteria 1898
185 Ga0495588_0297371 3300046674 Bacteria 850
186 Ga0495657_0001152 3300046675 Bacteria 23182
187 Ga0495657_0022165 3300046675 Bacteria 4553
188 Ga0495623_0110848 3300046679 Bacteria 1663
189 Ga0495646_0000167 3300046680 Bacteria 32980
190 Ga0495613_0002164 3300046689 Bacteria 14899
191 Ga0495613_0044059 3300046689 Bacteria 3301
192 Ga0495613_0176040 3300046689 Bacteria 1516
193 Ga0495671_0013368 3300046692 Bacteria 4449
194 Ga0495649_0053108 3300046694 Bacteria 2195
195 Ga0495589_0004041 3300046794 Bacteria 7862
196 Ga0495589_0016697 3300046794 Bacteria 3770
197 Ga0495589_0038976 3300046794 Bacteria 2376
198 Ga0495589_0063876 3300046794 Bacteria 1805
199 Ga0495589_0098424 3300046794 Bacteria 1416
200 Ga0495600_0035777 3300046809 Bacteria 3226
201 Ga0495600_0085052 3300046809 Bacteria 2064
202 Ga0495660_0024014 3300046810 Bacteria 3474
203 Ga0495581_0010354 3300047315 Bacteria 5395
204 Ga0495604_0007085 3300047317 Bacteria 8889
205 Ga0495604_0029445 3300047317 Bacteria 4368
206 Ga0495636_0010212 3300047318 Bacteria 3704
207 Ga0495636_0013734 3300047318 Bacteria 3214
208 Ga0495636_0033665 3300047318 Bacteria 2106
209 Ga0495636_0155573 3300047318 Bacteria 1028
210 Ga0495674_0292290 3300047319 Bacteria 1332
211 Ga0495676_0003431 3300047321 Bacteria 14336
212 Ga0495676_0006468 3300047321 Bacteria 10798
213 Ga0495676_0007144 3300047321 Bacteria 10248
214 Ga0495676_0398518 3300047321 Bacteria 913
215 Ga0495680_0044837 3300047322 Bacteria 3494
216 Ga0495687_003566 3300047443 Bacteria 11171
217 Ga0495687_007829 3300047443 Bacteria 6221
218 Ga0495687_070548 3300047443 Bacteria 1403
219 Ga0495687_098776 3300047443 Bacteria 1100
220 Ga0495675_0010322 3300047444 Bacteria 5838
221 Ga0495675_0048442 3300047444 Bacteria 2703
222 Ga0495685_002115 3300047447 Bacteria 6171
223 Ga0495685_005919 3300047447 Bacteria 3994
224 Ga0495685_006026 3300047447 Bacteria 3964
225 Ga0495685_049540 3300047447 Bacteria 1426
226 Ga0495681_0003066 3300047470 Bacteria 11720
227 Ga0495684_0152175 3300047471 Bacteria 1729
228 Ga0495684_0298604 3300047471 Bacteria 1157
229 Ga0495686_0169781 3300047472 Bacteria 1269
230 Ga0495593_0000572 3300047673 Bacteria 20924
231 Ga0495593_0151379 3300047673 Bacteria 1173
232 Ga0495602_0092562 3300048088 Bacteria 2504
233 Ga0495614_0001143 3300048089 Bacteria 11395
234 Ga0495614_0036259 3300048089 Bacteria 2117
235 Ga0495614_0040737 3300048089 Bacteria 1993
236 Ga0496106_0032443 3300048909 Bacteria 3894
237 Ga0496108_0174389 3300048911 Bacteria 1861
238 Ga0496108_0743965 3300048911 Bacteria 848
239 Ga0496109_0061670 3300048912 Bacteria 3429
240 Ga0496109_0524298 3300048912 Bacteria 1118
241 Ga0496113_0479811 3300048916 Bacteria 999
242 Ga0496119_0160720 3300048922 Bacteria 1195
243 Ga0501031_0010035 3300049568 Bacteria 6167
244 Ga0501031_0029864 3300049568 Bacteria 3556
245 Ga0501032_0021385 3300049569 Bacteria 4496
246 Ga0501032_0069896 3300049569 Bacteria 2342
247 Ga0501032_0322493 3300049569 Bacteria 997
248 Ga0501033_0000939 3300049570 Bacteria 26506
249 Ga0501033_0048976 3300049570 Bacteria 3137
250 Ga0501033_0195208 3300049570 Bacteria 1447
251 Ga0501034_0027825 3300049571 Bacteria 5749
252 Ga0501034_0096340 3300049571 Bacteria 2955
253 Ga0501034_0394442 3300049571 Bacteria 1307
254 Ga0501036_0004688 3300049572 Bacteria 11040
255 Ga0501036_0005594 3300049572 Bacteria 10195
256 Ga0501036_0079981 3300049572 Bacteria 2764
257 Ga0501036_0120007 3300049572 Bacteria 2220
258 Ga0501036_0161810 3300049572 Bacteria 1887
259 Ga0501037_0013435 3300049573 Bacteria 6030
260 Ga0501037_0030353 3300049573 Bacteria 3995
261 Ga0501037_0050568 3300049573 Bacteria 3041
262 Ga0501037_0054717 3300049573 Bacteria 2918
263 Ga0501038_0000221 3300049574 Bacteria 48754
264 Ga0501038_0004512 3300049574 Bacteria 12952
265 Ga0501038_0193135 3300049574 Bacteria 1637
266 Ga0501038_0284643 3300049574 Bacteria 1300
267 Ga0501039_0008110 3300049575 Bacteria 7999
268 Ga0501039_0009867 3300049575 Bacteria 7282
269 Ga0501041_0010736 3300049577 Bacteria 5404
270 Ga0501042_0071303 3300049578 Bacteria 2485
271 Ga0501043_0001258 3300049579 Bacteria 22340
272 Ga0501043_0004100 3300049579 Bacteria 11897
273 Ga0501043_0079332 3300049579 Bacteria 2579
274 Ga0501043_0150156 3300049579 Bacteria 1823
275 Ga0501046_0020345 3300049580 Bacteria 5491
276 Ga0501046_0185964 3300049580 Bacteria 1551
277 Ga0501047_0000093 3300049581 Bacteria 110613
278 Ga0501047_0035691 3300049581 Bacteria 4803
279 Ga0501047_0038144 3300049581 Bacteria 4647
280 Ga0501047_0087171 3300049581 Bacteria 2999
281 Ga0501047_0179892 3300049581 Bacteria 1981
282 Ga0501048_0146752 3300049582 Bacteria 1668
283 Ga0501048_0201452 3300049582 Bacteria 1411
284 Ga0501068_0000695 3300049584 Bacteria 17241
285 Ga0501069_0002170 3300049585 Bacteria 9880
286 Ga0501070_0009440 3300049586 Bacteria 8245
287 Ga0501070_0009516 3300049586 Bacteria 8212
288 Ga0501070_0304199 3300049586 Bacteria 1299
289 Ga0501070_0405815 3300049586 Bacteria 1102
290 Ga0501073_0000769 3300049589 Bacteria 22750
291 Ga0501074_0002684 3300049590 Bacteria 12457
292 Ga0501074_0081311 3300049590 Bacteria 2323
293 Ga0501076_0022215 3300049592 Bacteria 4874
294 Ga0501035_0000536 3300049822 Bacteria 42263
295 Ga0501035_0123295 3300049822 Bacteria 2263
296 Ga0501035_0135152 3300049822 Bacteria 2147
297 Ga0501044_0012894 3300049823 Bacteria 9047
298 Ga0501044_0015496 3300049823 Bacteria 8210
299 Ga0501044_0104639 3300049823 Bacteria 2844
300 Ga0501044_0184344 3300049823 Bacteria 2053
301 Ga0501044_0630816 3300049823 Bacteria 962
302 nmdc:mga03n38_76751_c1 3300050490 Bacteria 1560
303 nmdc:mga0yw44_285040_c1 3300050492 Bacteria 1104
304 nmdc:mga06z11_5628_c1 3300050494 Bacteria 5043
305 nmdc:mga04h51_3921_c1 3300050495 Bacteria 3660
306 Ga0495601_0096767 3300053077 Bacteria 1904
307 Ga0495612_0005005 3300053078 Bacteria 5489
308 Ga0495612_0033493 3300053078 Bacteria 2079
309 Ga0500641_0137712 3300053096 Bacteria 1054
310 Ga0500608_231935 3300053122 Bacteria 736
311 Ga0500600_0307146 3300053149 Bacteria 676
312 Ga0500636_0077853 3300053177 Bacteria 1915
313 Ga0466962_0018099 3300061719 Bacteria 3389
314 Ga0466962_0066963 3300061719 Bacteria 1714
315 2547411938 2547132111 Bacteria 8013147
316 2554259100 2554235005 Bacteria 6457341
317 2585298703 2582581312 Bacteria 7308206
318 2585314852 2582581314 Bacteria 11452267
319 2616702028 2616644814 Bacteria 11555299
320 2616899268 2616644941 Bacteria 8510691
321 2643759165 2643221548 Bacteria 8053412
322 2643897214 2643221578 Bacteria 9213798
323 2643945316 2643221587 Bacteria 7586415
324 2644269985 2643221647 Bacteria 10741251
325 2644387532 2643221670 Bacteria 6497041
326 2644408358 2643221673 Bacteria 9196637
327 2644432215 2643221677 Bacteria 7584031
328 2644442740 2643221678 Bacteria 9540101
329 2644463417 2643221682 Bacteria 6743283
330 2644626839 2643221714 Bacteria 9015452
331 2768647010 2767802112 Bacteria 6465194
332 2784591378 2784132148 Bacteria 8627943
333 2785340188 2784746763 Bacteria 9783172
334 2785372504 2784746768 Bacteria 10036182
335 2786675629 2786546132 Bacteria 10419719
336 2808844897 2808606359 Bacteria 9866990
337 2808914446 2808606375 Bacteria 9466072
338 2809234969 2808606448 Bacteria 8656184
339 2812355017 2811994879 Bacteria 9313447
340 2812477799 2811994917 Bacteria 7761064
341 2819694260 2818991463 Bacteria 7948711
342 2852638569 2852635781 Bacteria 8251373
343 2862283603 2862281513 Bacteria 9621493
344 2862510993 2862507626 Bacteria 9425308
345 2862576602 2862574272 Bacteria 10567477
346 2863409640 2863404153 Bacteria 9672205
347 2873153192 2873151551 Bacteria 8625867
348 2875393159 2875391855 Bacteria 7600475
349 2877678160 2877676314 Bacteria 9512378
350 2912716625 2912715099 Bacteria 9460473
351 2912729348 2912723979 Bacteria 8557534
352 2918503044 2918501144 Bacteria 8668083
353 2919472625 2919468124 Bacteria 9133025
354 2946051532 2946045630 Bacteria 8527308
355 2946070880 2946064051 Bacteria 8957905
356 2946078521 2946072368 Bacteria 8999607
357 2947225920 2947224130 Bacteria 9938529
358 2954010050 2954002825 Bacteria 9173742
359 2954383051 2954380949 Bacteria 10050426
360 2954679929 2954673503 Bacteria 9685905
361 2954684221 2954682443 Bacteria 9862841
362 2954693778 2954691527 Bacteria 10720516
363 2954708873 2954701450 Bacteria 10834262
364 2954713416 2954711539 Bacteria 10867210
365 2954723380 2954721474 Bacteria 10456478
366 2954738450 2954731030 Bacteria 10243860
367 2954742283 2954740390 Bacteria 10229294
368 2954757310 2954749733 Bacteria 10366972
369 2954761255 2954759201 Bacteria 9358192
370 2966603891 2966598605 Bacteria 7676064
371 2990059946 2990059506 Bacteria 9321252
372 3006395599 3006393351 Bacteria 6615579
373 3006497873 3006493962 Bacteria 8825450
374 8008563884 8008558824 Bacteria 10610750
375 8008576352 8008574985 Bacteria 7815457
376 8023628081 8023623736 Bacteria 8593882
377 8048406952 8048406513 Bacteria 8936924
378 8056060476 8056060235 Bacteria 7259403
379 8056829690 8056829672 Bacteria 9045328
380 Ga0495642_0085935
381 JGI24739J22299_10010470
382 rootH1_10002350
383 rootH1_10009323
384 rootH2_10031229
385 rootH1_10041183
386 Ga0006562J51391_1041827
387 Ga0006562J51391_1041828
388 Ga0070682_100256776
389 Ga0070668_100659586
390 Ga0070694_100320213
391 Ga0068857_100192869
392 Ga0068862_100371614
393 Ga0075368_10006593
394 Ga0075363_100078788
395 Ga0075367_10005179
396 Ga0075369_10269616
397 Ga0075429_100119098
398 Ga0105251_10036144
399 Ga0105239_10116805
400 Ga0182008_10007251
401 Ga0182007_10008935
402 Ga0183367_1001
403 Ga0209758_1005008
404 Ga0207426_1001965
405 Ga0207426_1003725
406 Ga0207713_1029649
407 Ga0207647_10016976
408 Ga0207647_10020334
409 Ga0207700_11002203
410 Ga0207679_10529817
411 Ga0207674_10084745
412 Ga0209813_10021539
413 Ga0307517_10032696
414 Ga0307515_10000055
415 Ga0307515_10092557
416 Ga0307511_10001391
417 Ga0307512_10016035
418 Ga0307512_10203412
419 Ga0307513_10006375
420 Ga0307508_10010455
421 Ga0307508_10069436
422 Ga0307508_10080172
423 Ga0307514_10012213
424 Ga0307514_10088565
425 Ga0307514_10092050
426 Ga0307516_10003860
427 Ga0307516_10033455
428 Ga0307410_10078952
429 Ga0307416_100104810
430 Ga0307416_101165354
431 Ga0307416_101242195
432 Ga0307507_10062988
433 Ga0395900_0561461
434 Ga0395898_0002902
435 Ga0395898_0015996
436 Ga0395898_0085347
437 Ga0395901_0078042
438 Ga0436365_1741998
439 Ga0439436_0000595
440 Ga0439436_0001097
441 Ga0439439_0008805
442 Ga0451802_0491012
443 Ga0451837_0975337
444 Ga0451849_1087752
445 Ga0451851_0243766
446 Ga0451853_0184670
447 Ga0451853_1223488
448 Ga0451853_1979018
449 Ga0451853_2553527
450 Ga0439433_0002558
451 Ga0439442_017467
452 Ga0439448_0001016
453 Ga0439449_0000165
454 Ga0439449_0010818
455 Ga0439449_0015748
456 Ga0439449_0104102
457 Ga0439455_0020302
458 Ga0439457_002432
459 Ga0439457_003348
460 Ga0450894_000320
461 Ga0450898_017577
462 Ga0450899_001526
463 Ga0450903_000211
464 Ga0450906_001346
465 Ga0439458_0001232
466 Ga0466969_0006698
467 Ga0466969_0013372
468 Ga0466972_0004117
469 Ga0466972_0008602
470 Ga0466972_0035112
471 Ga0466965_0048721
472 Ga0466965_0091486
473 Ga0466966_0033652
474 Ga0466966_0052289
475 Ga0466961_0024117
476 Ga0466961_0028991
477 Ga0466961_0122719
478 Ga0466961_0153458
479 Ga0466963_0001652
480 Ga0466971_0004552
481 Ga0466968_0098821
482 Ga0466968_0111368
483 Ga0466968_0120558
484 Ga0466970_0000327
485 Ga0466970_0002553
486 Ga0466970_0009561
487 Ga0466957_0003642
488 Ga0466960_0041405
489 Ga0466959_0000957
490 Ga0466959_0055671
491 Ga0466959_0056275
492 Ga0466958_0000983
493 Ga0466958_0120887
494 Ga0466967_0115561
495 Ga0466967_0157211
496 Ga0495617_044593
497 Ga0495592_0086380
498 Ga0495603_0001463
499 Ga0495603_0011153
500 Ga0495603_0014593
501 Ga0495603_0052492
502 Ga0495603_0232946
503 Ga0495590_0033175
504 Ga0495629_0007987
505 Ga0495629_0008204
506 Ga0495629_0009870
507 Ga0495629_0024015
508 Ga0495629_0027357
509 Ga0495629_0074954
510 Ga0495629_0092137
511 Ga0495638_0087247
512 Ga0495638_0279624
513 Ga0495651_0001162
514 Ga0495651_0303772
515 Ga0495580_0114124
516 Ga0495582_0051026
517 Ga0495605_0012335
518 Ga0495605_0168314
519 Ga0495639_0002975
520 Ga0495662_0016374
521 Ga0495662_0046768
522 Ga0495662_0085776
523 Ga0495664_0053511
524 Ga0495585_0031731
525 Ga0495594_0002817
526 Ga0495606_0076976
527 Ga0495618_0007324
528 Ga0495618_0125108
529 Ga0495628_0050128
530 Ga0495628_0210109
531 Ga0495630_0097557
532 Ga0495631_0302902
533 Ga0495632_0191441
534 Ga0495637_0062035
535 Ga0495643_0001873
536 Ga0495652_0069128
537 Ga0495652_0093277
538 Ga0495652_0209464
539 Ga0495640_0104381
540 Ga0495587_0003073
541 Ga0495587_0037326
542 Ga0495609_0014822
543 Ga0495609_0250600
544 Ga0495597_0010176
545 Ga0495622_0070859
546 Ga0495622_0134970
547 Ga0495633_0352849
548 Ga0495667_0051202
549 Ga0495667_0357459
550 Ga0495668_0034984
551 Ga0495634_0022731
552 Ga0495611_0040581
553 Ga0495625_0033482
554 Ga0495625_0037951
555 Ga0495625_0255672
556 Ga0495635_0034579
557 Ga0495635_0041157
558 Ga0495635_0043171
559 Ga0495661_0009739
560 Ga0495588_0000688
561 Ga0495588_0004591
562 Ga0495588_0022451
563 Ga0495588_0064639
564 Ga0495588_0297371
565 Ga0495657_0001152
566 Ga0495657_0022165
567 Ga0495623_0110848
568 Ga0495646_0000167
569 Ga0495613_0002164
570 Ga0495613_0044059
571 Ga0495613_0176040
572 Ga0495671_0013368
573 Ga0495649_0053108
574 Ga0495589_0004041
575 Ga0495589_0016697
576 Ga0495589_0038976
577 Ga0495589_0063876
578 Ga0495589_0098424
579 Ga0495600_0035777
580 Ga0495600_0085052
581 Ga0495660_0024014
582 Ga0495581_0010354
583 Ga0495604_0007085
584 Ga0495604_0029445
585 Ga0495636_0010212
586 Ga0495636_0013734
587 Ga0495636_0033665
588 Ga0495636_0155573
589 Ga0495674_0292290
590 Ga0495676_0003431
591 Ga0495676_0006468
592 Ga0495676_0007144
593 Ga0495676_0398518
594 Ga0495680_0044837
595 Ga0495687_003566
596 Ga0495687_007829
597 Ga0495687_070548
598 Ga0495687_098776
599 Ga0495675_0010322
600 Ga0495675_0048442
601 Ga0495685_002115
602 Ga0495685_005919
603 Ga0495685_006026
604 Ga0495685_049540
605 Ga0495681_0003066
606 Ga0495684_0152175
607 Ga0495684_0298604
608 Ga0495686_0169781
609 Ga0495593_0000572
610 Ga0495593_0151379
611 Ga0495602_0092562
612 Ga0495614_0001143
613 Ga0495614_0036259
614 Ga0495614_0040737
615 Ga0496106_0032443
616 Ga0496108_0174389
617 Ga0496108_0743965
618 Ga0496109_0061670
619 Ga0496109_0524298
620 Ga0496113_0479811
621 Ga0496119_0160720
622 Ga0501031_0010035
623 Ga0501031_0029864
624 Ga0501032_0021385
625 Ga0501032_0069896
626 Ga0501032_0322493
627 Ga0501033_0000939
628 Ga0501033_0048976
629 Ga0501033_0195208
630 Ga0501034_0027825
631 Ga0501034_0096340
632 Ga0501034_0394442
633 Ga0501036_0004688
634 Ga0501036_0005594
635 Ga0501036_0079981
636 Ga0501036_0120007
637 Ga0501036_0161810
638 Ga0501037_0013435
639 Ga0501037_0030353
640 Ga0501037_0050568
641 Ga0501037_0054717
642 Ga0501038_0000221
643 Ga0501038_0004512
644 Ga0501038_0193135
645 Ga0501038_0284643
646 Ga0501039_0008110
647 Ga0501039_0009867
648 Ga0501041_0010736
649 Ga0501042_0071303
650 Ga0501043_0001258
651 Ga0501043_0004100
652 Ga0501043_0079332
653 Ga0501043_0150156
654 Ga0501046_0020345
655 Ga0501046_0185964
656 Ga0501047_0000093
657 Ga0501047_0035691
658 Ga0501047_0038144
659 Ga0501047_0087171
660 Ga0501047_0179892
661 Ga0501048_0146752
662 Ga0501048_0201452
663 Ga0501068_0000695
664 Ga0501069_0002170
665 Ga0501070_0009440
666 Ga0501070_0009516
667 Ga0501070_0304199
668 Ga0501070_0405815
669 Ga0501073_0000769
670 Ga0501074_0002684
671 Ga0501074_0081311
672 Ga0501076_0022215
673 Ga0501035_0000536
674 Ga0501035_0123295
675 Ga0501035_0135152
676 Ga0501044_0012894
677 Ga0501044_0015496
678 Ga0501044_0104639
679 Ga0501044_0184344
680 Ga0501044_0630816
681 nmdc:mga03n38_76751_c1
682 nmdc:mga0yw44_285040_c1
683 nmdc:mga06z11_5628_c1
684 nmdc:mga04h51_3921_c1
685 Ga0495601_0096767
686 Ga0495612_0005005
687 Ga0495612_0033493
688 Ga0500641_0137712
689 Ga0500608_231935
690 Ga0500600_0307146
691 Ga0500636_0077853
692 Ga0466962_0018099
693 Ga0466962_0066963
694 2547411938
695 2554259100
696 2585298703
697 2585314852
698 2616702028
699 2616899268
700 2643759165
701 2643897214
702 2643945316
703 2644269985
704 2644387532
705 2644408358
706 2644432215
707 2644442740
708 2644463417
709 2644626839
710 2768647010
711 2784591378
712 2785340188
713 2785372504
714 2786675629
715 2808844897
716 2808914446
717 2809234969
718 2812355017
719 2812477799
720 2819694260
721 2852638569
722 2862283603
723 2862510993
724 2862576602
725 2863409640
726 2873153192
727 2875393159
728 2877678160
729 2912716625
730 2912729348
731 2918503044
732 2919472625
733 2946051532
734 2946070880
735 2946078521
736 2947225920
737 2954010050
738 2954383051
739 2954679929
740 2954684221
741 2954693778
742 2954708873
743 2954713416
744 2954723380
745 2954738450
746 2954742283
747 2954757310
748 2954761255
749 2966603891
750 2990059946
751 3006395599
752 3006497873
753 8008563884
754 8008576352
755 8023628081
756 8048406952
757 8056060476
758 8056829690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

48

138

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9165 11 100
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9138 12 103
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.904 11 100
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8948 10 100
7kd3-assembly1.cif.gz_B structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.8913 8 103
ID Description Score Start End Superfamily
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.904 11 100 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8762 10 100 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8598 15 84 1.10.10.10
4hqmA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8543 9 100 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8486 25 96 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y2D3M9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9567 12 103 GO:0003677
AF-A0A2A5EAD9-F1-model_v4 Transcriptional regulator 0.9439 9 103 GO:0003677
GO:0005737
AF-D3RXF9-F1-model_v4 Transcriptional regulator, HxlR family 0.9415 10 100 GO:0003677
AF-A0A5P9J887-F1-model_v4 HTH-type transcriptional activator HxlR 0.9401 12 103 GO:0003677
AF-A0A847B9B3-F1-model_v4 deleted 0.9379 10 105

Map