F428451

General Info

Members Datasets Scaffolds Average Seq Length
379 243 379 68

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0744414|Ga0495630_0744414_232_498
Length 78
Sequence VSVEGSEQQPAAPAAKAPVDLGPQCPNCGEPWLRPTNLPGRYRCVYCLHRFEHSTIVRMSSTAILKCNNCGDSMLQAV

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
185 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
186 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 7.39
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1036774 3300001976 Bacteria 652
2 JGI24743J22301_10096145 3300001991 Bacteria 635
3 JGI24745J21846_1038815 3300002073 Bacteria 587
4 JGI24738J21930_10078378 3300002075 Bacteria 690
5 JGI24749J21850_1050366 3300002076 Bacteria 620
6 JGI25406J46586_10008866 3300003203 Bacteria 4526
7 Ga0070658_10529504 3300005327 Bacteria 1019
8 Ga0070658_10562993 3300005327 Bacteria 986
9 Ga0070658_11641218 3300005327 Unclassified 557
10 Ga0070683_100012678 3300005329 Bacteria 7330
11 Ga0070690_101600585 3300005330 Bacteria 528
12 Ga0070670_101204515 3300005331 Bacteria 692
13 Ga0068869_100010203 3300005334 Bacteria 6118
14 Ga0070682_100145809 3300005337 Bacteria 1619
15 Ga0070682_101476290 3300005337 Bacteria 584
16 Ga0068868_100100167 3300005338 Bacteria 2344
17 Ga0068868_100604635 3300005338 Bacteria 972
18 Ga0068868_100836915 3300005338 Bacteria 833
19 Ga0070660_100163712 3300005339 Bacteria 1793
20 Ga0070689_100601943 3300005340 Bacteria 952
21 Ga0070661_100056066 3300005344 Bacteria 2886
22 Ga0070668_101947881 3300005347 Bacteria 541
23 Ga0070669_100621330 3300005353 Bacteria 907
24 Ga0070675_100071902 3300005354 Bacteria 2871
25 Ga0070674_100565539 3300005356 Bacteria 956
26 Ga0070674_100632269 3300005356 Bacteria 908
27 Ga0070673_100779828 3300005364 Bacteria 882
28 Ga0070673_100786148 3300005364 Bacteria 878
29 Ga0070688_100057837 3300005365 Bacteria 2439
30 Ga0070659_100021366 3300005366 Bacteria 4929
31 Ga0070667_101970107 3300005367 Bacteria 550
32 Ga0070709_10221093 3300005434 Bacteria 1350
33 Ga0070714_100127390 3300005435 Bacteria 2272
34 Ga0070714_101229805 3300005435 Bacteria 731
35 Ga0070713_100876345 3300005436 Bacteria 863
36 Ga0070713_101394006 3300005436 Unclassified 680
37 Ga0070713_101761949 3300005436 Bacteria 601
38 Ga0070710_10017596 3300005437 Bacteria 3662
39 Ga0070710_10059969 3300005437 Bacteria 2163
40 Ga0070710_10273277 3300005437 Bacteria 1094
41 Ga0070701_10226619 3300005438 Bacteria 1117
42 Ga0070701_10743480 3300005438 Bacteria 664
43 Ga0070711_100289453 3300005439 Bacteria 1299
44 Ga0070711_101895564 3300005439 Bacteria 524
45 Ga0070705_100609149 3300005440 Bacteria 846
46 Ga0070700_100000792 3300005441 Bacteria 15526
47 Ga0070700_100240010 3300005441 Bacteria 1294
48 Ga0070708_100274461 3300005445 Bacteria 1586
49 Ga0070663_100612510 3300005455 Bacteria 917
50 Ga0070663_100845684 3300005455 Bacteria 787
51 Ga0070663_101921267 3300005455 Bacteria 532
52 Ga0070678_100042122 3300005456 Bacteria 3243
53 Ga0070678_100542194 3300005456 Bacteria 1032
54 Ga0070678_101105655 3300005456 Bacteria 732
55 Ga0070662_100010410 3300005457 Bacteria 6099
56 Ga0068867_102080287 3300005459 Bacteria 537
57 Ga0070685_10060342 3300005466 Bacteria 2217
58 Ga0070684_100001264 3300005535 Bacteria 18112
59 Ga0070684_100165067 3300005535 Bacteria 2010
60 Ga0070684_101799942 3300005535 Bacteria 578
61 Ga0070697_100646466 3300005536 Bacteria 931
62 Ga0068853_100780686 3300005539 Bacteria 914
63 Ga0068853_102453838 3300005539 Bacteria 505
64 Ga0070672_100055205 3300005543 Bacteria 3111
65 Ga0070672_100849842 3300005543 Bacteria 805
66 Ga0070686_100073843 3300005544 Bacteria 2240
67 Ga0070696_100270361 3300005546 Bacteria 1292
68 Ga0070693_100548498 3300005547 Bacteria 827
69 Ga0070665_100618732 3300005548 Bacteria 1096
70 Ga0070704_100252513 3300005549 Bacteria 1449
71 Ga0070664_100079115 3300005564 Bacteria 2829
72 Ga0070664_100113554 3300005564 Bacteria 2366
73 Ga0070664_100186521 3300005564 Bacteria 1846
74 Ga0070664_101752448 3300005564 Bacteria 589
75 Ga0068857_100050307 3300005577 Bacteria 3697
76 Ga0068857_101007465 3300005577 Bacteria 802
77 Ga0068854_100473709 3300005578 Bacteria 1050
78 Ga0068856_100231207 3300005614 Bacteria 1864
79 Ga0070702_100057750 3300005615 Bacteria 2246
80 Ga0070702_101254871 3300005615 Bacteria 600
81 Ga0068852_100164755 3300005616 Bacteria 2073
82 Ga0068864_100016038 3300005618 Bacteria 6234
83 Ga0068861_100544102 3300005719 Bacteria 1057
84 Ga0068851_10279638 3300005834 Bacteria 954
85 Ga0068851_10841878 3300005834 Bacteria 572
86 Ga0068870_10201186 3300005840 Bacteria 1208
87 Ga0068863_100685314 3300005841 Bacteria 1018
88 Ga0068858_100309145 3300005842 Bacteria 1509
89 Ga0068862_100277052 3300005844 Bacteria 1536
90 Ga0081539_10000479 3300005985 Bacteria 84481
91 Ga0075364_10768550 3300006051 Bacteria 657
92 Ga0070716_100714666 3300006173 Bacteria 767
93 Ga0070712_100107603 3300006175 Bacteria 2075
94 Ga0070712_100135920 3300006175 Bacteria 1869
95 Ga0070712_100188130 3300006175 Bacteria 1613
96 Ga0075428_100718920 3300006844 Bacteria 1064
97 Ga0075428_101920067 3300006844 Bacteria 615
98 Ga0075430_100143205 3300006846 Bacteria 1991
99 Ga0075434_100928342 3300006871 Bacteria 885
100 Ga0075429_100449646 3300006880 Bacteria 1129
101 Ga0075429_100981404 3300006880 Bacteria 739
102 Ga0105251_10603608 3300009011 Bacteria 521
103 Ga0105240_10008779 3300009093 Bacteria 14400
104 Ga0105240_10858279 3300009093 Bacteria 979
105 Ga0111539_10083219 3300009094 Bacteria 3763
106 Ga0111539_11264770 3300009094 Bacteria 857
107 Ga0105245_10004499 3300009098 Bacteria 12324
108 Ga0105245_10228349 3300009098 Bacteria 1799
109 Ga0105245_12467511 3300009098 Bacteria 573
110 Ga0105245_13109409 3300009098 Bacteria 514
111 Ga0105247_10186933 3300009101 Bacteria 1385
112 Ga0114129_10603357 3300009147 Bacteria 1422
113 Ga0105243_10122816 3300009148 Bacteria 2192
114 Ga0105243_10628078 3300009148 Bacteria 1038
115 Ga0105241_10886086 3300009174 Bacteria 828
116 Ga0105242_11195889 3300009176 Bacteria 779
117 Ga0105242_11987440 3300009176 Bacteria 623
118 Ga0105248_10061918 3300009177 Bacteria 4202
119 Ga0105237_10001714 3300009545 Bacteria 28350
120 Ga0105238_10736152 3300009551 Bacteria 999
121 Ga0105238_12112387 3300009551 Bacteria 597
122 Ga0105249_10343980 3300009553 Bacteria 1509
123 Ga0105249_11144761 3300009553 Bacteria 849
124 Ga0105239_10013800 3300010375 Bacteria 8967
125 Ga0105239_13404298 3300010375 Unclassified 517
126 Ga0105246_10159002 3300011119 Bacteria 1719
127 Ga0105246_10519638 3300011119 Bacteria 1014
128 Ga0105246_10692746 3300011119 Bacteria 892
129 Ga0105246_10914493 3300011119 Bacteria 788
130 Ga0157369_10410805 3300013105 Bacteria 1404
131 Ga0157369_11010325 3300013105 Bacteria 851
132 Ga0157369_11605925 3300013105 Bacteria 661
133 Ga0157374_10032318 3300013296 Bacteria 4763
134 Ga0163162_11279121 3300013306 Bacteria 833
135 Ga0157372_10021302 3300013307 Bacteria 7002
136 Ga0157372_11515091 3300013307 Bacteria 772
137 Ga0157372_11834895 3300013307 Unclassified 697
138 Ga0157372_12426561 3300013307 Unclassified 602
139 Ga0157375_10018422 3300013308 Bacteria 6333
140 Ga0157375_10418021 3300013308 Bacteria 1507
141 Ga0163163_10035149 3300014325 Bacteria 4860
142 Ga0163163_11309733 3300014325 Bacteria 786
143 Ga0157380_10049902 3300014326 Bacteria 3303
144 Ga0157380_10050732 3300014326 Bacteria 3279
145 Ga0157380_10562657 3300014326 Bacteria 1121
146 Ga0157377_10022125 3300014745 Bacteria 3353
147 Ga0157376_10042297 3300014969 Bacteria 3735
148 Ga0206353_11943317 3300020082 Bacteria 1091
149 Ga0207426_1038686 3300025302 Bacteria 1500
150 Ga0207656_10373653 3300025321 Bacteria 714
151 Ga0207692_10081670 3300025898 Bacteria 1730
152 Ga0207692_10090297 3300025898 Bacteria 1660
153 Ga0207692_10212911 3300025898 Bacteria 1142
154 Ga0207692_10774023 3300025898 Bacteria 626
155 Ga0207642_10925956 3300025899 Bacteria 559
156 Ga0207688_10000837 3300025901 Bacteria 15455
157 Ga0207688_10065269 3300025901 Bacteria 2057
158 Ga0207688_10348423 3300025901 Bacteria 912
159 Ga0207699_10785263 3300025906 Bacteria 700
160 Ga0207699_10816081 3300025906 Bacteria 686
161 Ga0207643_10125631 3300025908 Bacteria 1522
162 Ga0207643_10297352 3300025908 Bacteria 1004
163 Ga0207705_10379669 3300025909 Bacteria 1091
164 Ga0207695_10015973 3300025913 Bacteria 8812
165 Ga0207693_10058643 3300025915 Bacteria 3015
166 Ga0207693_10065826 3300025915 Bacteria 2837
167 Ga0207693_10373471 3300025915 Bacteria 1115
168 Ga0207663_10841633 3300025916 Bacteria 732
169 Ga0207660_10820938 3300025917 Archaea 759
170 Ga0207660_11723814 3300025917 Bacteria 504
171 Ga0207662_10626102 3300025918 Bacteria 750
172 Ga0207657_10666070 3300025919 Bacteria 810
173 Ga0207649_10035189 3300025920 Bacteria 3008
174 Ga0207646_10381184 3300025922 Bacteria 1274
175 Ga0207659_10105901 3300025926 Bacteria 2129
176 Ga0207659_10713995 3300025926 Bacteria 859
177 Ga0207687_10048480 3300025927 Bacteria 2950
178 Ga0207700_10325197 3300025928 Bacteria 1334
179 Ga0207700_11313291 3300025928 Bacteria 644
180 Ga0207664_11548439 3300025929 Bacteria 585
181 Ga0207644_10156599 3300025931 Bacteria 1767
182 Ga0207644_10172056 3300025931 Bacteria 1692
183 Ga0207690_10120680 3300025932 Bacteria 1904
184 Ga0207690_10405067 3300025932 Bacteria 1088
185 Ga0207690_10466123 3300025932 Bacteria 1017
186 Ga0207706_10116754 3300025933 Bacteria 2347
187 Ga0207686_10677447 3300025934 Bacteria 818
188 Ga0207709_10091369 3300025935 Bacteria 1990
189 Ga0207709_11138777 3300025935 Bacteria 641
190 Ga0207709_11870354 3300025935 Bacteria 500
191 Ga0207670_10769441 3300025936 Bacteria 801
192 Ga0207669_10544918 3300025937 Bacteria 935
193 Ga0207704_10290276 3300025938 Bacteria 1248
194 Ga0207665_11421298 3300025939 Bacteria 552
195 Ga0207665_11519765 3300025939 Bacteria 532
196 Ga0207691_10027488 3300025940 Bacteria 5333
197 Ga0207711_10433764 3300025941 Bacteria 1223
198 Ga0207689_10016750 3300025942 Bacteria 6203
199 Ga0207689_10350979 3300025942 Bacteria 1226
200 Ga0207661_10020564 3300025944 Bacteria 4936
201 Ga0207679_10024320 3300025945 Bacteria 4152
202 Ga0207679_10049767 3300025945 Bacteria 3059
203 Ga0207679_10164367 3300025945 Bacteria 1821
204 Ga0207651_10580033 3300025960 Bacteria 978
205 Ga0207712_10217249 3300025961 Bacteria 1526
206 Ga0207668_10888912 3300025972 Bacteria 792
207 Ga0207668_12048337 3300025972 Bacteria 515
208 Ga0207640_10132339 3300025981 Bacteria 1805
209 Ga0207658_10807475 3300025986 Bacteria 852
210 Ga0207677_10590948 3300026023 Bacteria 973
211 Ga0207677_11262215 3300026023 Bacteria 678
212 Ga0207639_10653276 3300026041 Bacteria 973
213 Ga0207678_10400441 3300026067 Bacteria 1188
214 Ga0207678_11423328 3300026067 Bacteria 613
215 Ga0207678_11953748 3300026067 Bacteria 511
216 Ga0207708_10000262 3300026075 Bacteria 41463
217 Ga0207708_10004380 3300026075 Bacteria 10403
218 Ga0207702_10246014 3300026078 Bacteria 1677
219 Ga0207641_10619231 3300026088 Bacteria 1061
220 Ga0207648_10052870 3300026089 Bacteria 3551
221 Ga0207648_10182841 3300026089 Bacteria 1856
222 Ga0207676_10008675 3300026095 Bacteria 7228
223 Ga0207674_10041571 3300026116 Bacteria 4753
224 Ga0207674_10388228 3300026116 Bacteria 1350
225 Ga0207675_100106982 3300026118 Bacteria 2637
226 Ga0207675_100139894 3300026118 Bacteria 2299
227 Ga0207683_10007689 3300026121 Bacteria 9229
228 Ga0207683_10063901 3300026121 Bacteria 3243
229 Ga0207683_11945547 3300026121 Unclassified 537
230 Ga0207698_10449504 3300026142 Bacteria 1243
231 Ga0207698_12458135 3300026142 Bacteria 531
232 Ga0207428_10258797 3300027907 Bacteria 1296
233 Ga0207428_10702687 3300027907 Bacteria 723
234 Ga0207428_10979482 3300027907 Bacteria 595
235 Ga0268266_10298285 3300028379 Bacteria 1503
236 Ga0265337_1031822 3300028556 Bacteria 1564
237 Ga0265337_1032031 3300028556 Bacteria 1557
238 Ga0265337_1149587 3300028556 Bacteria 632
239 Ga0265326_10000318 3300028558 Bacteria 20961
240 Ga0265326_10177403 3300028558 Bacteria 610
241 Ga0265319_1004825 3300028563 Bacteria 6603
242 Ga0265319_1028387 3300028563 Bacteria 1973
243 Ga0265319_1030952 3300028563 Bacteria 1866
244 Ga0265319_1148239 3300028563 Bacteria 727
245 Ga0265318_10001193 3300028577 Bacteria 15929
246 Ga0265318_10025225 3300028577 Bacteria 2349
247 Ga0265318_10138714 3300028577 Bacteria 893
248 Ga0265323_10079935 3300028653 Bacteria 1106
249 Ga0265322_10004970 3300028654 Bacteria 3945
250 Ga0265336_10000002 3300028666 Bacteria 830172
251 Ga0265336_10107054 3300028666 Bacteria 833
252 Ga0265338_10000001 3300028800 Bacteria 1177449
253 Ga0265338_10021887 3300028800 Bacteria 6644
254 Ga0265338_10113701 3300028800 Bacteria 2174
255 Ga0265338_10388581 3300028800 Bacteria 997
256 Ga0265330_10330910 3300031235 Bacteria 643
257 Ga0265320_10005515 3300031240 Bacteria 8112
258 Ga0265325_10174633 3300031241 Bacteria 1004
259 Ga0265340_10000001 3300031247 Bacteria 1647668
260 Ga0265339_10116150 3300031249 Bacteria 1380
261 Ga0265316_10053966 3300031344 Bacteria 3147
262 Ga0265316_10349819 3300031344 Bacteria 1070
263 Ga0265313_10019432 3300031595 Bacteria 3780
264 Ga0265313_10190897 3300031595 Bacteria 856
265 Ga0265314_10020150 3300031711 Bacteria 5150
266 Ga0265314_10147461 3300031711 Bacteria 1447
267 Ga0307405_11041846 3300031731 Bacteria 700
268 Ga0307410_11066862 3300031852 Bacteria 699
269 Ga0307406_10903777 3300031901 Bacteria 752
270 Ga0307407_10069640 3300031903 Bacteria 2089
271 Ga0307409_101622628 3300031995 Bacteria 675
272 Ga0307409_102417997 3300031995 Bacteria 554
273 Ga0307416_100174533 3300032002 Bacteria 2006
274 Ga0307416_100689324 3300032002 Bacteria 1110
275 Ga0307416_100798948 3300032002 Bacteria 1039
276 Ga0307414_11270421 3300032004 Bacteria 683
277 Ga0307414_12168617 3300032004 Bacteria 519
278 Ga0307415_100921218 3300032126 Bacteria 807
279 Ga0307415_101918090 3300032126 Bacteria 575
280 Ga0373943_0522934 3300035170 Bacteria 695
281 Ga0373943_0937598 3300035170 Bacteria 518
282 Ga0373935_0501662 3300035692 Bacteria 881
283 Ga0373937_1172923 3300036401 Bacteria 717
284 Ga0373925_0359037 3300037068 Unclassified 1184
285 Ga0395899_0215350 3300037312 Bacteria 1333
286 Ga0395900_0502500 3300037418 Bacteria 1163
287 Ga0395898_0330174 3300037466 Bacteria 1454
288 Ga0395898_0528072 3300037466 Bacteria 1122
289 Ga0436364_1309349 3300037853 Bacteria 712
290 Ga0395901_0349171 3300038443 Bacteria 1527
291 Ga0395901_0528008 3300038443 Bacteria 1198
292 Ga0395901_1019911 3300038443 Bacteria 802
293 Ga0395901_1433088 3300038443 Bacteria 648
294 Ga0436363_1578901 3300039450 Bacteria 956
295 Ga0451793_1116914 3300041452 Bacteria 547
296 Ga0439450_031869 3300042008 Bacteria 1188
297 Ga0439463_073202 3300042016 Bacteria 878
298 Ga0450902_044482 3300042137 Bacteria 758
299 Ga0439459_0022943 3300042438 Bacteria 1212
300 Ga0439464_0151491 3300042439 Bacteria 726
301 Ga0466972_0500411 3300044658 Bacteria 572
302 Ga0466963_0176769 3300044694 Bacteria 1490
303 Ga0466963_0387496 3300044694 Bacteria 985
304 Ga0466963_0944534 3300044694 Bacteria 607
305 Ga0466963_0963511 3300044694 Bacteria 601
306 Ga0466964_0241689 3300044706 Bacteria 886
307 Ga0466971_0691121 3300044719 Bacteria 513
308 Ga0466957_0754997 3300044842 Bacteria 689
309 Ga0466958_0197471 3300045836 Bacteria 1280
310 Ga0466967_0463147 3300045976 Bacteria 1240
311 Ga0495592_0224016 3300046454 Bacteria 1256
312 Ga0495603_0260585 3300046455 Bacteria 998
313 Ga0495629_0184659 3300046459 Bacteria 1444
314 Ga0495641_0227004 3300046461 Bacteria 838
315 Ga0495582_0649205 3300046473 Bacteria 611
316 Ga0495639_0578904 3300046475 Bacteria 576
317 Ga0495584_0247216 3300046491 Bacteria 907
318 Ga0495608_0259962 3300046511 Bacteria 1081
319 Ga0495618_0000805 3300046514 Bacteria 21850
320 Ga0495630_0744414 3300046517 Bacteria 749
321 Ga0495645_0000021 3300046543 Bacteria 137604
322 Ga0495667_0863683 3300046559 Bacteria 556
323 Ga0495659_0514409 3300046664 Bacteria 526
324 Ga0495588_0218614 3300046674 Bacteria 1006
325 Ga0495646_0055342 3300046680 Bacteria 2383
326 Ga0495581_0868353 3300047315 Unclassified 516
327 Ga0495674_1112852 3300047319 Bacteria 601
328 Ga0495676_0049680 3300047321 Bacteria 3370
329 Ga0495676_0534490 3300047321 Bacteria 767
330 Ga0495679_035911 3300047446 Bacteria 1568
331 Ga0495684_0001866 3300047471 Bacteria 16862
332 Ga0495593_0497475 3300047673 Bacteria 611
333 Ga0495614_0162896 3300048089 Unclassified 998
334 Ga0496100_0020501 3300048903 Bacteria 3964
335 Ga0496100_0423926 3300048903 Bacteria 1016
336 Ga0496100_1470346 3300048903 Unclassified 538
337 Ga0496101_0012856 3300048904 Bacteria 5599
338 Ga0496101_1228978 3300048904 Bacteria 587
339 Ga0496102_0723030 3300048905 Bacteria 918
340 Ga0496102_1078880 3300048905 Bacteria 723
341 Ga0496103_0134282 3300048906 Bacteria 1581
342 Ga0496104_0000037 3300048907 Bacteria 178518
343 Ga0496104_0002837 3300048907 Bacteria 14958
344 Ga0496105_0518837 3300048908 Bacteria 933
345 Ga0496105_0644453 3300048908 Bacteria 818
346 Ga0496106_0019719 3300048909 Bacteria 5001
347 Ga0496107_0177961 3300048910 Bacteria 1579
348 Ga0496108_0003122 3300048911 Bacteria 13314
349 Ga0496109_0003253 3300048912 Bacteria 13541
350 Ga0496109_0882573 3300048912 Bacteria 832
351 Ga0496110_0001297 3300048913 Bacteria 17951
352 Ga0496110_0283558 3300048913 Bacteria 1508
353 Ga0496111_0000296 3300048914 Bacteria 24338
354 Ga0496111_0029881 3300048914 Bacteria 3872
355 Ga0496112_0010188 3300048915 Bacteria 8517
356 Ga0496113_0042890 3300048916 Bacteria 3344
357 Ga0496113_1206933 3300048916 Bacteria 591
358 Ga0496114_0208345 3300048917 Bacteria 1714
359 Ga0496114_0808101 3300048917 Bacteria 817
360 Ga0496115_0000012 3300048918 Bacteria 215509
361 Ga0496122_0157299 3300048925 Bacteria 1392
362 Ga0501067_0346322 3300049583 Bacteria 828
363 nmdc:mga05p37_1427897_c1 3300050507 Bacteria 695
364 nmdc:mga09592_1075723_c1 3300050508 Bacteria 669
365 nmdc:mga09592_404754_c1 3300050508 Bacteria 1179
366 nmdc:mga09592_914352_c1 3300050508 Bacteria 737
367 nmdc:mga08y16_190976_c1 3300050511 Bacteria 2124
368 nmdc:mga08y16_228173_c1 3300050511 Bacteria 1926
369 nmdc:mga08y16_235493_c1 3300050511 Bacteria 1893
370 nmdc:mga08y16_675829_c1 3300050511 Bacteria 1034
371 nmdc:mga08y16_72471_c1 3300050511 Bacteria 3589
372 nmdc:mga0n895_754408_c1 3300050512 Bacteria 966
373 nmdc:mga0rr50_484726_c1 3300050513 Bacteria 1050
374 Ga0495601_0021478 3300053077 Bacteria 3954
375 Ga0495601_0053347 3300053077 Bacteria 2555
376 Ga0495612_0000214 3300053078 Bacteria 24528
377 Ga0495655_0175042 3300053083 Bacteria 689
378 Ga0495619_0189537 3300053085 Bacteria 1423
379 Ga0466962_0146762 3300061719 Bacteria 1144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_11641218 Ga0070658_116412181 59
2 3300005455 Ga0070663_100845684 Ga0070663_1008456841 59
3 3300005539 Ga0068853_102453838 Ga0068853_1024538381 59
4 3300005564 Ga0070664_100186521 Ga0070664_1001865212 59
5 3300005577 Ga0068857_101007465 Ga0068857_1010074651 59
6 3300025945 Ga0207679_10164367 Ga0207679_101643674 59
7 3300026067 Ga0207678_10400441 Ga0207678_104004412 59
8 3300026116 Ga0207674_10388228 Ga0207674_103882282 59
9 3300005438 Ga0070701_10743480 Ga0070701_107434802 62
10 3300013307 Ga0157372_11834895 Ga0157372_118348952 62
11 3300041452 Ga0451793_1116914 Ga0451793_1116914_15_236 62
12 3300048917 Ga0496114_0808101 Ga0496114_0808101_332_553 62
13 3300005337 Ga0070682_101476290 Ga0070682_1014762902 63
14 3300005455 Ga0070663_100612510 Ga0070663_1006125102 63
15 3300005547 Ga0070693_100548498 Ga0070693_1005484982 63
16 3300006846 Ga0075430_100143205 Ga0075430_1001432052 63
17 3300010375 Ga0105239_13404298 Ga0105239_134042982 63
18 3300013105 Ga0157369_11605925 Ga0157369_116059252 63
19 3300013307 Ga0157372_12426561 Ga0157372_124265612 63
20 3300025302 Ga0207426_1038686 Ga0207426_10386862 63
21 3300026023 Ga0207677_11262215 Ga0207677_112622151 63
22 3300026067 Ga0207678_11953748 Ga0207678_119537481 63
23 3300028556 Ga0265337_1149587 Ga0265337_11495871 63
24 3300028558 Ga0265326_10177403 Ga0265326_101774031 63
25 3300028563 Ga0265319_1004825 Ga0265319_10048255 63
26 3300028577 Ga0265318_10025225 Ga0265318_100252253 63
27 3300028800 Ga0265338_10021887 Ga0265338_100218873 63
28 3300031240 Ga0265320_10005515 Ga0265320_100055156 63
29 3300031344 Ga0265316_10053966 Ga0265316_100539663 63
30 3300031595 Ga0265313_10019432 Ga0265313_100194323 63
31 3300031711 Ga0265314_10020150 Ga0265314_100201503 63
32 3300039450 Ga0436363_1578901 Ga0436363_1578901_382_606 63
33 3300047321 Ga0495676_0534490 Ga0495676_0534490_465_689 63
34 3300003203 JGI25406J46586_10008866 JGI25406J46586_100088663 64
35 3300005327 Ga0070658_10562993 Ga0070658_105629932 64
36 3300005338 Ga0068868_100604635 Ga0068868_1006046351 64
37 3300005338 Ga0068868_100836915 Ga0068868_1008369152 64
38 3300005347 Ga0070668_101947881 Ga0070668_1019478812 64
39 3300005353 Ga0070669_100621330 Ga0070669_1006213302 64
40 3300005356 Ga0070674_100632269 Ga0070674_1006322692 64
41 3300005364 Ga0070673_100779828 Ga0070673_1007798281 64
42 3300005441 Ga0070700_100240010 Ga0070700_1002400102 64
43 3300005455 Ga0070663_101921267 Ga0070663_1019212672 64
44 3300005456 Ga0070678_100542194 Ga0070678_1005421942 64
45 3300005459 Ga0068867_102080287 Ga0068867_1020802872 64
46 3300005535 Ga0070684_100165067 Ga0070684_1001650673 64
47 3300005543 Ga0070672_100055205 Ga0070672_1000552054 64
48 3300005543 Ga0070672_100849842 Ga0070672_1008498422 64
49 3300005564 Ga0070664_101752448 Ga0070664_1017524482 64
50 3300005615 Ga0070702_101254871 Ga0070702_1012548712 64
51 3300005834 Ga0068851_10279638 Ga0068851_102796382 64
52 3300005840 Ga0068870_10201186 Ga0068870_102011862 64
53 3300005985 Ga0081539_10000479 Ga0081539_100004796 64
54 3300006051 Ga0075364_10768550 Ga0075364_107685502 64
55 3300006844 Ga0075428_100718920 Ga0075428_1007189202 64
56 3300006844 Ga0075428_101920067 Ga0075428_1019200671 64
57 3300006880 Ga0075429_100449646 Ga0075429_1004496462 64
58 3300006880 Ga0075429_100981404 Ga0075429_1009814042 64
59 3300009094 Ga0111539_10083219 Ga0111539_100832193 64
60 3300009094 Ga0111539_11264770 Ga0111539_112647702 64
61 3300009098 Ga0105245_10228349 Ga0105245_102283492 64
62 3300009098 Ga0105245_13109409 Ga0105245_131094092 64
63 3300009147 Ga0114129_10603357 Ga0114129_106033572 64
64 3300009148 Ga0105243_10122816 Ga0105243_101228162 64
65 3300009176 Ga0105242_11987440 Ga0105242_119874402 64
66 3300009553 Ga0105249_11144761 Ga0105249_111447612 64
67 3300011119 Ga0105246_10159002 Ga0105246_101590022 64
68 3300011119 Ga0105246_10692746 Ga0105246_106927462 64
69 3300013307 Ga0157372_11515091 Ga0157372_115150912 64
70 3300013308 Ga0157375_10418021 Ga0157375_104180212 64
71 3300014325 Ga0163163_11309733 Ga0163163_113097332 64
72 3300014326 Ga0157380_10049902 Ga0157380_100499022 64
73 3300014326 Ga0157380_10562657 Ga0157380_105626572 64
74 3300025901 Ga0207688_10065269 Ga0207688_100652692 64
75 3300025901 Ga0207688_10348423 Ga0207688_103484231 64
76 3300025908 Ga0207643_10125631 Ga0207643_101256312 64
77 3300025917 Ga0207660_10820938 Ga0207660_108209382 64
78 3300025918 Ga0207662_10626102 Ga0207662_106261022 64
79 3300025926 Ga0207659_10713995 Ga0207659_107139952 64
80 3300025931 Ga0207644_10172056 Ga0207644_101720563 64
81 3300025932 Ga0207690_10405067 Ga0207690_104050672 64
82 3300025932 Ga0207690_10466123 Ga0207690_104661232 64
83 3300025935 Ga0207709_11870354 Ga0207709_118703542 64
84 3300025938 Ga0207704_10290276 Ga0207704_102902762 64
85 3300025940 Ga0207691_10027488 Ga0207691_100274886 64
86 3300025942 Ga0207689_10350979 Ga0207689_103509792 64
87 3300025945 Ga0207679_10049767 Ga0207679_100497674 64
88 3300025972 Ga0207668_10888912 Ga0207668_108889122 64
89 3300026067 Ga0207678_11423328 Ga0207678_114233282 64
90 3300026075 Ga0207708_10004380 Ga0207708_100043809 64
91 3300026089 Ga0207648_10052870 Ga0207648_100528703 64
92 3300026089 Ga0207648_10182841 Ga0207648_101828412 64
93 3300026118 Ga0207675_100106982 Ga0207675_1001069823 64
94 3300026121 Ga0207683_10063901 Ga0207683_100639015 64
95 3300026142 Ga0207698_12458135 Ga0207698_124581352 64
96 3300027907 Ga0207428_10258797 Ga0207428_102587972 64
97 3300027907 Ga0207428_10979482 Ga0207428_109794822 64
98 3300028563 Ga0265319_1028387 Ga0265319_10283872 64
99 3300031241 Ga0265325_10174633 Ga0265325_101746332 64
100 3300031595 Ga0265313_10190897 Ga0265313_101908972 64
101 3300031731 Ga0307405_11041846 Ga0307405_110418462 64
102 3300031852 Ga0307410_11066862 Ga0307410_110668622 64
103 3300031901 Ga0307406_10903777 Ga0307406_109037772 64
104 3300031903 Ga0307407_10069640 Ga0307407_100696402 64
105 3300031995 Ga0307409_101622628 Ga0307409_1016226282 64
106 3300031995 Ga0307409_102417997 Ga0307409_1024179971 64
107 3300032002 Ga0307416_100174533 Ga0307416_1001745332 64
108 3300032002 Ga0307416_100689324 Ga0307416_1006893242 64
109 3300032002 Ga0307416_100798948 Ga0307416_1007989482 64
110 3300032004 Ga0307414_11270421 Ga0307414_112704212 64
111 3300032004 Ga0307414_12168617 Ga0307414_121686172 64
112 3300032126 Ga0307415_100921218 Ga0307415_1009212182 64
113 3300032126 Ga0307415_101918090 Ga0307415_1019180902 64
114 3300037312 Ga0395899_0215350 Ga0395899_0215350_221_448 64
115 3300037466 Ga0395898_0330174 Ga0395898_0330174_857_1084 64
116 3300038443 Ga0395901_0349171 Ga0395901_0349171_938_1165 64
117 3300038443 Ga0395901_0528008 Ga0395901_0528008_102_329 64
118 3300038443 Ga0395901_1433088 Ga0395901_1433088_364_591 64
119 3300042008 Ga0439450_031869 Ga0439450_031869_805_1032 64
120 3300042016 Ga0439463_073202 Ga0439463_073202_535_762 64
121 3300042137 Ga0450902_044482 Ga0450902_044482_438_665 64
122 3300042438 Ga0439459_0022943 Ga0439459_0022943_571_798 64
123 3300042439 Ga0439464_0151491 Ga0439464_0151491_315_542 64
124 3300044658 Ga0466972_0500411 Ga0466972_0500411_184_414 64
125 3300044694 Ga0466963_0944534 Ga0466963_0944534_337_567 64
126 3300044706 Ga0466964_0241689 Ga0466964_0241689_411_641 64
127 3300044719 Ga0466971_0691121 Ga0466971_0691121_10_240 64
128 3300045976 Ga0466967_0463147 Ga0466967_0463147_653_880 64
129 3300046473 Ga0495582_0649205 Ga0495582_0649205_248_475 64
130 3300048912 Ga0496109_0882573 Ga0496109_0882573_332_559 64
131 3300050507 nmdc:mga05p37_1427897_c1 nmdc:mga05p37_1427897_c1_271_498 64
132 3300050508 nmdc:mga09592_1075723_c1 nmdc:mga09592_1075723_c1_69_296 64
133 3300050508 nmdc:mga09592_404754_c1 nmdc:mga09592_404754_c1_474_701 64
134 3300050508 nmdc:mga09592_914352_c1 nmdc:mga09592_914352_c1_66_293 64
135 3300050511 nmdc:mga08y16_190976_c1 nmdc:mga08y16_190976_c1_689_916 64
136 3300050511 nmdc:mga08y16_235493_c1 nmdc:mga08y16_235493_c1_1266_1493 64
137 3300050511 nmdc:mga08y16_675829_c1 nmdc:mga08y16_675829_c1_201_428 64
138 3300050511 nmdc:mga08y16_72471_c1 nmdc:mga08y16_72471_c1_3080_3307 64
139 3300053083 Ga0495655_0175042 Ga0495655_0175042_259_486 64
140 3300009551 Ga0105238_12112387 Ga0105238_121123872 65
141 3300011119 Ga0105246_10914493 Ga0105246_109144932 65
142 3300013105 Ga0157369_10410805 Ga0157369_104108051 65
143 3300025919 Ga0207657_10666070 Ga0207657_106660702 65
144 3300025935 Ga0207709_11138777 Ga0207709_111387772 65
145 3300037466 Ga0395898_0528072 Ga0395898_0528072_186_413 65
146 3300045836 Ga0466958_0197471 Ga0466958_0197471_451_678 65
147 3300046664 Ga0495659_0514409 Ga0495659_0514409_15_245 65
148 3300049583 Ga0501067_0346322 Ga0501067_0346322_431_658 65
149 3300061719 Ga0466962_0146762 Ga0466962_0146762_890_1117 65
150 3300005445 Ga0070708_100274461 Ga0070708_1002744612 67
151 3300048916 Ga0496113_1206933 Ga0496113_1206933_71_307 67
152 3300005535 Ga0070684_101799942 Ga0070684_1017999422 68
153 3300009093 Ga0105240_10008779 Ga0105240_1000877913 68
154 3300025913 Ga0207695_10015973 Ga0207695_100159735 68
155 3300005434 Ga0070709_10221093 Ga0070709_102210932 69
156 3300005435 Ga0070714_100127390 Ga0070714_1001273901 69
157 3300005435 Ga0070714_101229805 Ga0070714_1012298052 69
158 3300005436 Ga0070713_100876345 Ga0070713_1008763452 69
159 3300005436 Ga0070713_101761949 Ga0070713_1017619492 69
160 3300005437 Ga0070710_10059969 Ga0070710_100599691 69
161 3300005437 Ga0070710_10273277 Ga0070710_102732772 69
162 3300005439 Ga0070711_100289453 Ga0070711_1002894532 69
163 3300005439 Ga0070711_101895564 Ga0070711_1018955641 69
164 3300005536 Ga0070697_100646466 Ga0070697_1006464662 69
165 3300006175 Ga0070712_100135920 Ga0070712_1001359202 69
166 3300006175 Ga0070712_100188130 Ga0070712_1001881303 69
167 3300009545 Ga0105237_10001714 Ga0105237_1000171425 69
168 3300009551 Ga0105238_10736152 Ga0105238_107361522 69
169 3300020082 Ga0206353_11943317 Ga0206353_119433172 69
170 3300025898 Ga0207692_10081670 Ga0207692_100816702 69
171 3300025898 Ga0207692_10212911 Ga0207692_102129113 69
172 3300025898 Ga0207692_10774023 Ga0207692_107740232 69
173 3300025906 Ga0207699_10785263 Ga0207699_107852632 69
174 3300025906 Ga0207699_10816081 Ga0207699_108160812 69
175 3300025915 Ga0207693_10058643 Ga0207693_100586432 69
176 3300025915 Ga0207693_10373471 Ga0207693_103734712 69
177 3300025916 Ga0207663_10841633 Ga0207663_108416332 69
178 3300025922 Ga0207646_10381184 Ga0207646_103811842 69
179 3300025928 Ga0207700_11313291 Ga0207700_113132912 69
180 3300025929 Ga0207664_11548439 Ga0207664_115484392 69
181 3300025939 Ga0207665_11519765 Ga0207665_115197651 69
182 3300028556 Ga0265337_1032031 Ga0265337_10320312 69
183 3300028558 Ga0265326_10000318 Ga0265326_100003183 69
184 3300028563 Ga0265319_1030952 Ga0265319_10309523 69
185 3300028577 Ga0265318_10001193 Ga0265318_100011933 69
186 3300028653 Ga0265323_10079935 Ga0265323_100799352 69
187 3300028654 Ga0265322_10004970 Ga0265322_100049703 69
188 3300028666 Ga0265336_10000002 Ga0265336_1000000269 69
189 3300028800 Ga0265338_10000001 Ga0265338_10000001745 69
190 3300028800 Ga0265338_10113701 Ga0265338_101137012 69
191 3300031235 Ga0265330_10330910 Ga0265330_103309102 69
192 3300031247 Ga0265340_10000001 Ga0265340_10000001744 69
193 3300031249 Ga0265339_10116150 Ga0265339_101161501 69
194 3300031344 Ga0265316_10349819 Ga0265316_103498192 69
195 3300031711 Ga0265314_10147461 Ga0265314_101474612 69
196 3300035170 Ga0373943_0522934 Ga0373943_0522934_108_353 69
197 3300035170 Ga0373943_0937598 Ga0373943_0937598_145_393 69
198 3300035692 Ga0373935_0501662 Ga0373935_0501662_334_579 69
199 3300037068 Ga0373925_0359037 Ga0373925_0359037_140_385 69
200 3300044694 Ga0466963_0176769 Ga0466963_0176769_1132_1383 69
201 3300044694 Ga0466963_0387496 Ga0466963_0387496_657_908 69
202 3300044694 Ga0466963_0963511 Ga0466963_0963511_297_542 69
203 3300046455 Ga0495603_0260585 Ga0495603_0260585_546_791 69
204 3300046461 Ga0495641_0227004 Ga0495641_0227004_216_464 69
205 3300046475 Ga0495639_0578904 Ga0495639_0578904_99_344 69
206 3300046674 Ga0495588_0218614 Ga0495588_0218614_460_705 69
207 3300047315 Ga0495581_0868353 Ga0495581_0868353_140_385 69
208 3300047319 Ga0495674_1112852 Ga0495674_1112852_146_394 69
209 3300047321 Ga0495676_0049680 Ga0495676_0049680_2943_3188 69
210 3300047471 Ga0495684_0001866 Ga0495684_0001866_14262_14510 69
211 3300047673 Ga0495593_0497475 Ga0495593_0497475_232_480 69
212 3300048089 Ga0495614_0162896 Ga0495614_0162896_130_375 69
213 3300048903 Ga0496100_0423926 Ga0496100_0423926_392_640 69
214 3300048904 Ga0496101_1228978 Ga0496101_1228978_321_569 69
215 3300053077 Ga0495601_0053347 Ga0495601_0053347_855_1100 69
216 3300053078 Ga0495612_0000214 Ga0495612_0000214_6839_7084 69
217 3300001976 JGI24752J21851_1036774 JGI24752J21851_10367741 70
218 3300001991 JGI24743J22301_10096145 JGI24743J22301_100961451 70
219 3300002073 JGI24745J21846_1038815 JGI24745J21846_10388151 70
220 3300002075 JGI24738J21930_10078378 JGI24738J21930_100783781 70
221 3300002076 JGI24749J21850_1050366 JGI24749J21850_10503661 70
222 3300005327 Ga0070658_10529504 Ga0070658_105295041 70
223 3300005329 Ga0070683_100012678 Ga0070683_1000126786 70
224 3300005330 Ga0070690_101600585 Ga0070690_1016005852 70
225 3300005331 Ga0070670_101204515 Ga0070670_1012045152 70
226 3300005334 Ga0068869_100010203 Ga0068869_1000102037 70
227 3300005337 Ga0070682_100145809 Ga0070682_1001458093 70
228 3300005338 Ga0068868_100100167 Ga0068868_1001001672 70
229 3300005339 Ga0070660_100163712 Ga0070660_1001637122 70
230 3300005340 Ga0070689_100601943 Ga0070689_1006019432 70
231 3300005344 Ga0070661_100056066 Ga0070661_1000560664 70
232 3300005354 Ga0070675_100071902 Ga0070675_1000719023 70
233 3300005356 Ga0070674_100565539 Ga0070674_1005655392 70
234 3300005364 Ga0070673_100786148 Ga0070673_1007861482 70
235 3300005365 Ga0070688_100057837 Ga0070688_1000578371 70
236 3300005366 Ga0070659_100021366 Ga0070659_1000213662 70
237 3300005367 Ga0070667_101970107 Ga0070667_1019701072 70
238 3300005436 Ga0070713_101394006 Ga0070713_1013940062 70
239 3300005437 Ga0070710_10017596 Ga0070710_100175964 70
240 3300005438 Ga0070701_10226619 Ga0070701_102266192 70
241 3300005440 Ga0070705_100609149 Ga0070705_1006091492 70
242 3300005441 Ga0070700_100000792 Ga0070700_1000007929 70
243 3300005456 Ga0070678_100042122 Ga0070678_1000421223 70
244 3300005456 Ga0070678_101105655 Ga0070678_1011056552 70
245 3300005457 Ga0070662_100010410 Ga0070662_1000104106 70
246 3300005466 Ga0070685_10060342 Ga0070685_100603423 70
247 3300005535 Ga0070684_100001264 Ga0070684_1000012644 70
248 3300005539 Ga0068853_100780686 Ga0068853_1007806862 70
249 3300005544 Ga0070686_100073843 Ga0070686_1000738432 70
250 3300005546 Ga0070696_100270361 Ga0070696_1002703612 70
251 3300005548 Ga0070665_100618732 Ga0070665_1006187322 70
252 3300005549 Ga0070704_100252513 Ga0070704_1002525132 70
253 3300005564 Ga0070664_100079115 Ga0070664_1000791152 70
254 3300005564 Ga0070664_100113554 Ga0070664_1001135542 70
255 3300005577 Ga0068857_100050307 Ga0068857_1000503074 70
256 3300005578 Ga0068854_100473709 Ga0068854_1004737092 70
257 3300005614 Ga0068856_100231207 Ga0068856_1002312072 70
258 3300005615 Ga0070702_100057750 Ga0070702_1000577502 70
259 3300005616 Ga0068852_100164755 Ga0068852_1001647552 70
260 3300005618 Ga0068864_100016038 Ga0068864_1000160384 70
261 3300005719 Ga0068861_100544102 Ga0068861_1005441022 70
262 3300005834 Ga0068851_10841878 Ga0068851_108418782 70
263 3300005841 Ga0068863_100685314 Ga0068863_1006853141 70
264 3300005842 Ga0068858_100309145 Ga0068858_1003091451 70
265 3300005844 Ga0068862_100277052 Ga0068862_1002770521 70
266 3300006173 Ga0070716_100714666 Ga0070716_1007146662 70
267 3300006175 Ga0070712_100107603 Ga0070712_1001076033 70
268 3300006871 Ga0075434_100928342 Ga0075434_1009283422 70
269 3300009011 Ga0105251_10603608 Ga0105251_106036081 70
270 3300009093 Ga0105240_10858279 Ga0105240_108582792 70
271 3300009098 Ga0105245_10004499 Ga0105245_100044992 70
272 3300009098 Ga0105245_12467511 Ga0105245_124675112 70
273 3300009101 Ga0105247_10186933 Ga0105247_101869332 70
274 3300009148 Ga0105243_10628078 Ga0105243_106280782 70
275 3300009174 Ga0105241_10886086 Ga0105241_108860861 70
276 3300009176 Ga0105242_11195889 Ga0105242_111958892 70
277 3300009177 Ga0105248_10061918 Ga0105248_100619185 70
278 3300009553 Ga0105249_10343980 Ga0105249_103439802 70
279 3300010375 Ga0105239_10013800 Ga0105239_1001380010 70
280 3300011119 Ga0105246_10519638 Ga0105246_105196382 70
281 3300013105 Ga0157369_11010325 Ga0157369_110103252 70
282 3300013296 Ga0157374_10032318 Ga0157374_100323182 70
283 3300013306 Ga0163162_11279121 Ga0163162_112791212 70
284 3300013307 Ga0157372_10021302 Ga0157372_100213025 70
285 3300013308 Ga0157375_10018422 Ga0157375_100184227 70
286 3300014325 Ga0163163_10035149 Ga0163163_100351494 70
287 3300014326 Ga0157380_10050732 Ga0157380_100507323 70
288 3300014745 Ga0157377_10022125 Ga0157377_100221252 70
289 3300014969 Ga0157376_10042297 Ga0157376_100422972 70
290 3300025321 Ga0207656_10373653 Ga0207656_103736532 70
291 3300025898 Ga0207692_10090297 Ga0207692_100902972 70
292 3300025899 Ga0207642_10925956 Ga0207642_109259562 70
293 3300025901 Ga0207688_10000837 Ga0207688_100008373 70
294 3300025908 Ga0207643_10297352 Ga0207643_102973522 70
295 3300025909 Ga0207705_10379669 Ga0207705_103796691 70
296 3300025915 Ga0207693_10065826 Ga0207693_100658263 70
297 3300025917 Ga0207660_11723814 Ga0207660_117238142 70
298 3300025920 Ga0207649_10035189 Ga0207649_100351892 70
299 3300025926 Ga0207659_10105901 Ga0207659_101059013 70
300 3300025927 Ga0207687_10048480 Ga0207687_100484804 70
301 3300025928 Ga0207700_10325197 Ga0207700_103251972 70
302 3300025931 Ga0207644_10156599 Ga0207644_101565992 70
303 3300025932 Ga0207690_10120680 Ga0207690_101206802 70
304 3300025933 Ga0207706_10116754 Ga0207706_101167542 70
305 3300025934 Ga0207686_10677447 Ga0207686_106774472 70
306 3300025935 Ga0207709_10091369 Ga0207709_100913691 70
307 3300025936 Ga0207670_10769441 Ga0207670_107694412 70
308 3300025937 Ga0207669_10544918 Ga0207669_105449182 70
309 3300025939 Ga0207665_11421298 Ga0207665_114212982 70
310 3300025941 Ga0207711_10433764 Ga0207711_104337642 70
311 3300025942 Ga0207689_10016750 Ga0207689_100167507 70
312 3300025944 Ga0207661_10020564 Ga0207661_100205642 70
313 3300025945 Ga0207679_10024320 Ga0207679_100243203 70
314 3300025960 Ga0207651_10580033 Ga0207651_105800332 70
315 3300025961 Ga0207712_10217249 Ga0207712_102172492 70
316 3300025972 Ga0207668_12048337 Ga0207668_120483372 70
317 3300025981 Ga0207640_10132339 Ga0207640_101323393 70
318 3300025986 Ga0207658_10807475 Ga0207658_108074752 70
319 3300026023 Ga0207677_10590948 Ga0207677_105909482 70
320 3300026041 Ga0207639_10653276 Ga0207639_106532762 70
321 3300026075 Ga0207708_10000262 Ga0207708_1000026224 70
322 3300026078 Ga0207702_10246014 Ga0207702_102460143 70
323 3300026088 Ga0207641_10619231 Ga0207641_106192312 70
324 3300026095 Ga0207676_10008675 Ga0207676_100086758 70
325 3300026116 Ga0207674_10041571 Ga0207674_100415713 70
326 3300026118 Ga0207675_100139894 Ga0207675_1001398943 70
327 3300026121 Ga0207683_10007689 Ga0207683_100076896 70
328 3300026121 Ga0207683_11945547 Ga0207683_119455472 70
329 3300026142 Ga0207698_10449504 Ga0207698_104495042 70
330 3300027907 Ga0207428_10702687 Ga0207428_107026872 70
331 3300028379 Ga0268266_10298285 Ga0268266_102982852 70
332 3300028556 Ga0265337_1031822 Ga0265337_10318222 70
333 3300028563 Ga0265319_1148239 Ga0265319_11482392 70
334 3300028577 Ga0265318_10138714 Ga0265318_101387141 70
335 3300028666 Ga0265336_10107054 Ga0265336_101070542 70
336 3300028800 Ga0265338_10388581 Ga0265338_103885812 70
337 3300036401 Ga0373937_1172923 Ga0373937_1172923_222_470 70
338 3300037418 Ga0395900_0502500 Ga0395900_0502500_431_673 70
339 3300037853 Ga0436364_1309349 Ga0436364_1309349_406_654 70
340 3300038443 Ga0395901_1019911 Ga0395901_1019911_506_748 70
341 3300044842 Ga0466957_0754997 Ga0466957_0754997_331_579 70
342 3300046454 Ga0495592_0224016 Ga0495592_0224016_412_660 70
343 3300046459 Ga0495629_0184659 Ga0495629_0184659_851_1099 70
344 3300046491 Ga0495584_0247216 Ga0495584_0247216_598_840 70
345 3300046511 Ga0495608_0259962 Ga0495608_0259962_291_539 70
346 3300046514 Ga0495618_0000805 Ga0495618_0000805_3998_4246 70
347 3300046517 Ga0495630_0744414 Ga0495630_0744414_232_498 70
348 3300046543 Ga0495645_0000021 Ga0495645_0000021_22053_22301 70
349 3300046559 Ga0495667_0863683 Ga0495667_0863683_64_312 70
350 3300046680 Ga0495646_0055342 Ga0495646_0055342_504_749 70
351 3300047446 Ga0495679_035911 Ga0495679_035911_232_480 70
352 3300048903 Ga0496100_0020501 Ga0496100_0020501_3446_3688 70
353 3300048903 Ga0496100_1470346 Ga0496100_1470346_242_490 70
354 3300048904 Ga0496101_0012856 Ga0496101_0012856_2302_2544 70
355 3300048905 Ga0496102_0723030 Ga0496102_0723030_511_753 70
356 3300048905 Ga0496102_1078880 Ga0496102_1078880_344_592 70
357 3300048906 Ga0496103_0134282 Ga0496103_0134282_218_460 70
358 3300048907 Ga0496104_0000037 Ga0496104_0000037_47153_47401 70
359 3300048907 Ga0496104_0002837 Ga0496104_0002837_5772_6014 70
360 3300048908 Ga0496105_0518837 Ga0496105_0518837_608_856 70
361 3300048908 Ga0496105_0644453 Ga0496105_0644453_293_541 70
362 3300048909 Ga0496106_0019719 Ga0496106_0019719_184_426 70
363 3300048910 Ga0496107_0177961 Ga0496107_0177961_406_648 70
364 3300048911 Ga0496108_0003122 Ga0496108_0003122_5849_6091 70
365 3300048912 Ga0496109_0003253 Ga0496109_0003253_4723_4965 70
366 3300048913 Ga0496110_0001297 Ga0496110_0001297_8295_8543 70
367 3300048913 Ga0496110_0283558 Ga0496110_0283558_324_566 70
368 3300048914 Ga0496111_0000296 Ga0496111_0000296_6401_6649 70
369 3300048914 Ga0496111_0029881 Ga0496111_0029881_1430_1672 70
370 3300048915 Ga0496112_0010188 Ga0496112_0010188_3399_3641 70
371 3300048916 Ga0496113_0042890 Ga0496113_0042890_2825_3067 70
372 3300048917 Ga0496114_0208345 Ga0496114_0208345_1091_1333 70
373 3300048918 Ga0496115_0000012 Ga0496115_0000012_180005_180253 70
374 3300048925 Ga0496122_0157299 Ga0496122_0157299_995_1243 70
375 3300050511 nmdc:mga08y16_228173_c1 nmdc:mga08y16_228173_c1_228_470 70
376 3300050512 nmdc:mga0n895_754408_c1 nmdc:mga0n895_754408_c1_205_447 70
377 3300050513 nmdc:mga0rr50_484726_c1 nmdc:mga0rr50_484726_c1_72_314 70
378 3300053077 Ga0495601_0021478 Ga0495601_0021478_3417_3665 70
379 3300053085 Ga0495619_0189537 Ga0495619_0189537_279_527 70

Feature Viewer

pLDDT pTM Quality
63.59 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map