F428328

General Info

Members Datasets Scaffolds Average Seq Length
379 179 758 186

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10319657|Ga0105240_103196572
Length 210
Sequence LNLRFARQSAIGNRKFQMIQPWEKIRSRPLGDFRIFTIRADTKLSPLTQKEHDFFIIDSVHWVNVIAVTPDQELVMVEQYRHGSNTVELEIPGGMMDAKDASPVICGTRELREETGYEGTNARLLGDVWANPAIMSNTCYTVLVENCRCVHPLEWDHAEELVTKLVPIAELPGLVASGKIKHPLVIVALYHFDLLQRGLKKQTAKHANAE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 0.26
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 27.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10319657 3300009093 Bacteria 1770
2 rootH2_10109811 3300003320 Bacteria 1395
3 Ga0065712_10230529 3300005290 Unclassified 1008
4 Ga0065707_10514009 3300005295 Bacteria 747
5 Ga0070658_10061885 3300005327 Bacteria 3050
6 Ga0070683_100222791 3300005329 Bacteria 1792
7 Ga0070690_100001441 3300005330 Bacteria 12424
8 Ga0070690_100016729 3300005330 Bacteria 4399
9 Ga0070690_100137942 3300005330 Bacteria 1653
10 Ga0070690_100385832 3300005330 Bacteria 1025
11 Ga0070666_10047122 3300005335 Unclassified 2893
12 Ga0068868_100227007 3300005338 Bacteria 1565
13 Ga0068868_100930748 3300005338 Bacteria 791
14 Ga0068868_101113012 3300005338 Unclassified 727
15 Ga0070689_100004376 3300005340 Bacteria 9534
16 Ga0070689_100007431 3300005340 Bacteria 7659
17 Ga0070689_100009574 3300005340 Bacteria 6873
18 Ga0070689_100114746 3300005340 Unclassified 2146
19 Ga0070689_100205404 3300005340 Bacteria 1610
20 Ga0070689_100378053 3300005340 Bacteria 1193
21 Ga0070689_100422143 3300005340 Bacteria 1130
22 Ga0070689_100779073 3300005340 Bacteria 840
23 Ga0070675_100286799 3300005354 Unclassified 1448
24 Ga0070688_100027715 3300005365 Unclassified 3375
25 Ga0070688_100055524 3300005365 Bacteria 2484
26 Ga0070688_100086973 3300005365 Bacteria 2035
27 Ga0070714_100003397 3300005435 Bacteria 11864
28 Ga0070713_100039082 3300005436 Bacteria 3849
29 Ga0070701_10017446 3300005438 Bacteria 3355
30 Ga0070711_100143186 3300005439 Unclassified 1795
31 Ga0070705_100175895 3300005440 Bacteria 1445
32 Ga0070700_100797716 3300005441 Unclassified 760
33 Ga0070694_100028281 3300005444 Bacteria 3646
34 Ga0070694_100341665 3300005444 Bacteria 1157
35 Ga0070694_100753505 3300005444 Unclassified 795
36 Ga0070681_10814478 3300005458 Unclassified 851
37 Ga0070685_10003295 3300005466 Bacteria 8200
38 Ga0070685_10439769 3300005466 Bacteria 911
39 Ga0070707_101005420 3300005468 Bacteria 799
40 Ga0070679_100799296 3300005530 Unclassified 886
41 Ga0070686_100041445 3300005544 Bacteria 2878
42 Ga0070686_100092841 3300005544 Bacteria 2022
43 Ga0070686_100210908 3300005544 Unclassified 1398
44 Ga0070686_100244425 3300005544 Unclassified 1308
45 Ga0070695_100233688 3300005545 Bacteria 1330
46 Ga0070704_100017217 3300005549 Bacteria 4589
47 Ga0068855_100024683 3300005563 Bacteria 7191
48 Ga0068855_100295703 3300005563 Bacteria 1794
49 Ga0068855_100306971 3300005563 Unclassified 1756
50 Ga0068855_100875504 3300005563 Bacteria 950
51 Ga0068855_101428841 3300005563 Unclassified 712
52 Ga0068857_100208166 3300005577 Bacteria 1784
53 Ga0068857_100323959 3300005577 Bacteria 1424
54 Ga0068857_100502428 3300005577 Unclassified 1138
55 Ga0068857_100771534 3300005577 Bacteria 917
56 Ga0068856_100000311 3300005614 Bacteria 53369
57 Ga0068856_100110371 3300005614 Bacteria 2747
58 Ga0068859_100003499 3300005617 Bacteria 15988
59 Ga0068859_100145568 3300005617 Bacteria 2444
60 Ga0068859_100254931 3300005617 Bacteria 1845
61 Ga0068859_100426130 3300005617 Unclassified 1423
62 Ga0068859_100744336 3300005617 Bacteria 1069
63 Ga0068859_101230724 3300005617 Bacteria 825
64 Ga0068864_100107246 3300005618 Bacteria 2485
65 Ga0068864_100607104 3300005618 Unclassified 1062
66 Ga0068863_100104027 3300005841 Bacteria 2701
67 Ga0068863_100335226 3300005841 Bacteria 1471
68 Ga0068863_100412548 3300005841 Bacteria 1322
69 Ga0068863_101328838 3300005841 Bacteria 726
70 Ga0068863_101529898 3300005841 Unclassified 676
71 Ga0068858_100332576 3300005842 Unclassified 1453
72 Ga0068858_101742393 3300005842 Unclassified 615
73 Ga0068862_101240443 3300005844 Bacteria 745
74 Ga0081455_10134084 3300005937 Bacteria 1932
75 Ga0070712_100362552 3300006175 Unclassified 1189
76 Ga0097621_100296259 3300006237 Bacteria 1427
77 Ga0068871_100115881 3300006358 Bacteria 2259
78 Ga0068871_100837041 3300006358 Unclassified 850
79 Ga0075428_100666755 3300006844 Unclassified 1109
80 Ga0075428_100684628 3300006844 Unclassified 1093
81 Ga0075431_100048749 3300006847 Bacteria 4368
82 Ga0075431_100055206 3300006847 Unclassified 4097
83 Ga0075433_10707402 3300006852 Bacteria 882
84 Ga0075433_10715808 3300006852 Bacteria 876
85 Ga0075434_100863542 3300006871 Unclassified 920
86 Ga0068865_100418503 3300006881 Bacteria 1101
87 Ga0097620_100003499 3300006931 Bacteria 15988
88 Ga0097620_100145565 3300006931 Bacteria 2444
89 Ga0097620_100254938 3300006931 Bacteria 1845
90 Ga0097620_100426092 3300006931 Unclassified 1423
91 Ga0097620_100744213 3300006931 Bacteria 1069
92 Ga0097620_101230637 3300006931 Bacteria 825
93 Ga0075435_100221598 3300007076 Unclassified 1606
94 Ga0075435_100695768 3300007076 Unclassified 883
95 Ga0105240_10006527 3300009093 Bacteria 17130
96 Ga0105240_10031293 3300009093 Bacteria 6902
97 Ga0105240_10038352 3300009093 Bacteria 6146
98 Ga0105240_11006042 3300009093 Bacteria 891
99 Ga0111539_10013516 3300009094 Bacteria 10203
100 Ga0111539_10160420 3300009094 Bacteria 2630
101 Ga0111539_10253207 3300009094 Unclassified 2050
102 Ga0111539_10371730 3300009094 Unclassified 1664
103 Ga0111539_10373379 3300009094 Bacteria 1660
104 Ga0105245_10064951 3300009098 Bacteria 3299
105 Ga0105245_10397829 3300009098 Bacteria 1376
106 Ga0105245_10648671 3300009098 Bacteria 1086
107 Ga0114129_10689932 3300009147 Bacteria 1313
108 Ga0105241_10911007 3300009174 Unclassified 817
109 Ga0105242_10035039 3300009176 Bacteria 4024
110 Ga0105242_10166880 3300009176 Bacteria 1932
111 Ga0105242_10285880 3300009176 Bacteria 1500
112 Ga0105242_10310420 3300009176 Bacteria 1443
113 Ga0105238_10000026 3300009551 Bacteria 195584
114 Ga0105238_10102699 3300009551 Bacteria 2840
115 Ga0105238_10334882 3300009551 Bacteria 1501
116 Ga0105249_11149679 3300009553 Bacteria 847
117 Ga0105246_11124753 3300011119 Unclassified 719
118 Ga0157371_10579690 3300013102 Unclassified 833
119 Ga0157370_10090557 3300013104 Bacteria 2872
120 Ga0157370_10107314 3300013104 Bacteria 2612
121 Ga0157369_10731248 3300013105 Bacteria 1019
122 Ga0157374_10706691 3300013296 Bacteria 1021
123 Ga0157378_11291284 3300013297 Unclassified 771
124 Ga0157372_10376882 3300013307 Bacteria 1653
125 Ga0157372_10534345 3300013307 Bacteria 1367
126 Ga0157375_10000131 3300013308 Bacteria 74862
127 Ga0157375_10274190 3300013308 Bacteria 1849
128 Ga0163163_10000194 3300014325 Bacteria 62568
129 Ga0163163_10025979 3300014325 Bacteria 5591
130 Ga0163163_11457428 3300014325 Bacteria 746
131 Ga0157380_11568513 3300014326 Unclassified 713
132 Ga0157377_10229511 3300014745 Bacteria 1193
133 Ga0157376_10123041 3300014969 Bacteria 2303
134 Ga0207680_10034496 3300025903 Unclassified 2896
135 Ga0207705_10131660 3300025909 Unclassified 1862
136 Ga0207684_10533250 3300025910 Unclassified 1005
137 Ga0207707_10763323 3300025912 Bacteria 808
138 Ga0207695_10020149 3300025913 Bacteria 7648
139 Ga0207695_10073062 3300025913 Bacteria 3496
140 Ga0207695_10251749 3300025913 Unclassified 1665
141 Ga0207695_10925787 3300025913 Unclassified 751
142 Ga0207663_10153089 3300025916 Unclassified 1620
143 Ga0207662_10030238 3300025918 Bacteria 3142
144 Ga0207652_10706699 3300025921 Unclassified 899
145 Ga0207694_10000034 3300025924 Bacteria 197650
146 Ga0207694_10158641 3300025924 Bacteria 1826
147 Ga0207659_10107583 3300025926 Unclassified 2114
148 Ga0207687_10360568 3300025927 Bacteria 1186
149 Ga0207700_10288365 3300025928 Bacteria 1414
150 Ga0207700_10639131 3300025928 Unclassified 948
151 Ga0207664_10021926 3300025929 Bacteria 4759
152 Ga0207686_10125139 3300025934 Bacteria 1756
153 Ga0207686_10234144 3300025934 Bacteria 1333
154 Ga0207686_10511029 3300025934 Unclassified 934
155 Ga0207686_10618607 3300025934 Bacteria 854
156 Ga0207670_10003355 3300025936 Bacteria 8498
157 Ga0207670_10010697 3300025936 Bacteria 5296
158 Ga0207670_10013175 3300025936 Unclassified 4866
159 Ga0207670_10087498 3300025936 Unclassified 2195
160 Ga0207670_10087835 3300025936 Archaea 2191
161 Ga0207670_10781780 3300025936 Unclassified 794
162 Ga0207670_11041742 3300025936 Unclassified 689
163 Ga0207661_10084449 3300025944 Unclassified 2630
164 Ga0207667_10119026 3300025949 Unclassified 2722
165 Ga0207667_10191181 3300025949 Bacteria 2100
166 Ga0207667_10193687 3300025949 Bacteria 2086
167 Ga0207667_10200021 3300025949 Unclassified 2050
168 Ga0207712_10739167 3300025961 Bacteria 861
169 Ga0207640_10409583 3300025981 Bacteria 1106
170 Ga0207677_10186971 3300026023 Bacteria 1635
171 Ga0207703_10311721 3300026035 Unclassified 1438
172 Ga0207639_10788624 3300026041 Unclassified 885
173 Ga0207708_10138465 3300026075 Bacteria 1907
174 Ga0207702_10003468 3300026078 Bacteria 14370
175 Ga0207641_10665783 3300026088 Unclassified 1023
176 Ga0207641_10853017 3300026088 Bacteria 903
177 Ga0207641_11091468 3300026088 Bacteria 796
178 Ga0207676_10186586 3300026095 Unclassified 1821
179 Ga0207676_10279181 3300026095 Unclassified 1516
180 Ga0207674_10016290 3300026116 Bacteria 8142
181 Ga0207674_10261622 3300026116 Bacteria 1677
182 Ga0207674_10879160 3300026116 Unclassified 864
183 Ga0207675_100482118 3300026118 Bacteria 1233
184 Ga0268265_10444883 3300028380 Bacteria 1209
185 Ga0268265_11391142 3300028380 Bacteria 704
186 Ga0265337_1000102 3300028556 Bacteria 42139
187 Ga0265337_1000754 3300028556 Bacteria 17075
188 Ga0265337_1005334 3300028556 Bacteria 5126
189 Ga0265337_1118148 3300028556 Bacteria 719
190 Ga0265326_10006709 3300028558 Bacteria 3559
191 Ga0265319_1042090 3300028563 Unclassified 1537
192 Ga0265319_1074019 3300028563 Bacteria 1088
193 Ga0265319_1131490 3300028563 Bacteria 778
194 Ga0265334_10003890 3300028573 Bacteria 6732
195 Ga0265334_10067513 3300028573 Bacteria 1336
196 Ga0265334_10158326 3300028573 Unclassified 797
197 Ga0265318_10011001 3300028577 Bacteria 3917
198 Ga0265318_10070961 3300028577 Bacteria 1291
199 Ga0265318_10086069 3300028577 Bacteria 1158
200 Ga0265318_10101950 3300028577 Bacteria 1056
201 Ga0265323_10000018 3300028653 Bacteria 91203
202 Ga0265323_10011307 3300028653 Unclassified 3604
203 Ga0265323_10017580 3300028653 Bacteria 2776
204 Ga0265323_10024680 3300028653 Bacteria 2283
205 Ga0265323_10042519 3300028653 Unclassified 1645
206 Ga0265323_10055748 3300028653 Bacteria 1388
207 Ga0265323_10086280 3300028653 Unclassified 1055
208 Ga0265322_10012947 3300028654 Bacteria 2414
209 Ga0265322_10125243 3300028654 Bacteria 732
210 Ga0265336_10002415 3300028666 Bacteria 7721
211 Ga0265336_10018647 3300028666 Bacteria 2247
212 Ga0265336_10044713 3300028666 Bacteria 1347
213 Ga0265336_10147996 3300028666 Bacteria 699
214 Ga0265338_10000040 3300028800 Bacteria 232041
215 Ga0265338_10000064 3300028800 Bacteria 190219
216 Ga0265338_10000242 3300028800 Bacteria 101378
217 Ga0265338_10001348 3300028800 Bacteria 39992
218 Ga0265338_10002770 3300028800 Bacteria 25657
219 Ga0265338_10003559 3300028800 Bacteria 21779
220 Ga0265338_10004065 3300028800 Bacteria 20053
221 Ga0265338_10005718 3300028800 Bacteria 16079
222 Ga0265338_10009507 3300028800 Bacteria 11579
223 Ga0265338_10015192 3300028800 Bacteria 8486
224 Ga0265338_10016423 3300028800 Bacteria 8057
225 Ga0265338_10022925 3300028800 Bacteria 6441
226 Ga0265338_10026726 3300028800 Bacteria 5809
227 Ga0265338_10030488 3300028800 Bacteria 5312
228 Ga0265338_10065598 3300028800 Unclassified 3147
229 Ga0265338_10082526 3300028800 Bacteria 2691
230 Ga0265338_10120823 3300028800 Bacteria 2088
231 Ga0265338_10193245 3300028800 Bacteria 1541
232 Ga0265338_10306343 3300028800 Bacteria 1153
233 Ga0265338_10373743 3300028800 Unclassified 1020
234 Ga0265338_10397410 3300028800 Unclassified 983
235 Ga0265338_10673847 3300028800 Bacteria 715
236 Ga0265324_10000392 3300029957 Bacteria 31749
237 Ga0265324_10008907 3300029957 Unclassified 3952
238 Ga0265324_10016177 3300029957 Bacteria 2730
239 Ga0265324_10117316 3300029957 Bacteria 904
240 Ga0265332_10201332 3300031238 Bacteria 827
241 Ga0265328_10117970 3300031239 Bacteria 989
242 Ga0265320_10000870 3300031240 Bacteria 22823
243 Ga0265320_10001499 3300031240 Bacteria 17011
244 Ga0265320_10008991 3300031240 Bacteria 6058
245 Ga0265320_10009492 3300031240 Bacteria 5865
246 Ga0265320_10039790 3300031240 Bacteria 2348
247 Ga0265320_10057857 3300031240 Unclassified 1858
248 Ga0265325_10017385 3300031241 Unclassified 3997
249 Ga0265325_10080682 3300031241 Unclassified 1617
250 Ga0265340_10001390 3300031247 Bacteria 13870
251 Ga0265340_10013390 3300031247 Unclassified 4306
252 Ga0265340_10107643 3300031247 Unclassified 1291
253 Ga0265339_10003473 3300031249 Bacteria 11017
254 Ga0265327_10002080 3300031251 Bacteria 22363
255 Ga0265327_10004619 3300031251 Bacteria 12100
256 Ga0265316_10000659 3300031344 Bacteria 38376
257 Ga0265316_10011788 3300031344 Bacteria 7863
258 Ga0265316_10013268 3300031344 Bacteria 7331
259 Ga0265316_10151614 3300031344 Bacteria 1736
260 Ga0265316_10154359 3300031344 Bacteria 1718
261 Ga0265316_10210035 3300031344 Unclassified 1440
262 Ga0265313_10003321 3300031595 Bacteria 13157
263 Ga0265313_10017945 3300031595 Bacteria 3995
264 Ga0265314_10049509 3300031711 Bacteria 2941
265 Ga0265314_10091783 3300031711 Bacteria 1975
266 Ga0265314_10097758 3300031711 Bacteria 1895
267 Ga0265342_10072114 3300031712 Bacteria 2011
268 Ga0265342_10160615 3300031712 Bacteria 1242
269 Ga0316576_10000291 3300031727 Bacteria 22107
270 Ga0307416_100283167 3300032002 Bacteria 1636
271 Ga0307414_10285993 3300032004 Bacteria 1388
272 Ga0307411_10490083 3300032005 Bacteria 1037
273 Ga0316583_10069888 3300032133 Bacteria 1228
274 Ga0373959_0000110 3300034820 Bacteria 18362
275 Ga0373944_0006169 3300035089 Unclassified 3177
276 Ga0373954_0044765 3300035118 Bacteria 2066
277 Ga0373956_0002939 3300035119 Bacteria 6896
278 Ga0373956_0110932 3300035119 Bacteria 1277
279 Ga0373942_0205955 3300035207 Unclassified 654
280 Ga0316574_0286925 3300035398 Bacteria 1048
281 Ga0373924_0256966 3300035410 Unclassified 774
282 Ga0373931_0439132 3300035691 Unclassified 833
283 Ga0373927_0852999 3300035695 Bacteria 601
284 Ga0373937_0004433 3300036401 Bacteria 11932
285 Ga0373937_0231086 3300036401 Bacteria 1742
286 Ga0373937_0302039 3300036401 Bacteria 1513
287 Ga0373937_0441617 3300036401 Bacteria 1235
288 Ga0373937_0596881 3300036401 Bacteria 1048
289 Ga0373937_1371307 3300036401 Unclassified 655
290 Ga0316584_0281142 3300036712 Bacteria 1209
291 Ga0373925_0118995 3300037068 Unclassified 2049
292 Ga0395899_0095187 3300037312 Bacteria 2154
293 Ga0395898_0051640 3300037466 Bacteria 4020
294 Ga0395901_0045693 3300038443 Bacteria 4546
295 Ga0451577_0003685 3300042876 Bacteria 16776
296 Ga0451577_0005119 3300042876 Bacteria 13506
297 Ga0451577_1055535 3300042876 Bacteria 728
298 Ga0453684_0006647 3300044712 Bacteria 21845
299 Ga0453684_0019824 3300044712 Bacteria 10203
300 Ga0453684_0233149 3300044712 Bacteria 2124
301 Ga0453684_0249726 3300044712 Bacteria 2038
302 Ga0466957_0480709 3300044842 Unclassified 859
303 Ga0451576_0022392 3300045051 Bacteria 6851
304 Ga0451576_0045417 3300045051 Bacteria 4627
305 Ga0451576_0080986 3300045051 Unclassified 3378
306 Ga0451576_0104055 3300045051 Bacteria 2953
307 Ga0451576_0109108 3300045051 Bacteria 2880
308 Ga0451576_0159747 3300045051 Unclassified 2352
309 Ga0451576_0290695 3300045051 Bacteria 1709
310 Ga0451576_0465431 3300045051 Bacteria 1328
311 Ga0451576_0493922 3300045051 Bacteria 1286
312 Ga0451576_0503951 3300045051 Bacteria 1272
313 Ga0451576_0818145 3300045051 Bacteria 978
314 Ga0451576_1240042 3300045051 Bacteria 778
315 Ga0495592_0000053 3300046454 Bacteria 108449
316 Ga0495592_0150027 3300046454 Bacteria 1613
317 Ga0495592_0640177 3300046454 Unclassified 645
318 Ga0495629_0063415 3300046459 Bacteria 2581
319 Ga0495641_0032897 3300046461 Unclassified 2465
320 Ga0495582_0101143 3300046473 Unclassified 1614
321 Ga0495662_0021254 3300046476 Bacteria 3137
322 Ga0495664_0098669 3300046477 Bacteria 1759
323 Ga0495608_0241691 3300046511 Unclassified 1128
324 Ga0495618_0001265 3300046514 Bacteria 17122
325 Ga0495618_0001525 3300046514 Bacteria 15539
326 Ga0495628_0000091 3300046516 Bacteria 71204
327 Ga0495628_0079957 3300046516 Bacteria 2542
328 Ga0495628_0828712 3300046516 Unclassified 646
329 Ga0495630_0034822 3300046517 Bacteria 3762
330 Ga0495630_0050876 3300046517 Bacteria 3100
331 Ga0495630_0152872 3300046517 Unclassified 1756
332 Ga0495652_0059108 3300046529 Bacteria 3245
333 Ga0495586_0000121 3300046535 Bacteria 47320
334 Ga0495586_0001363 3300046535 Bacteria 13572
335 Ga0495586_0001589 3300046535 Bacteria 12503
336 Ga0495645_0000721 3300046543 Bacteria 22692
337 Ga0495645_0013010 3300046543 Bacteria 5875
338 Ga0495645_0022993 3300046543 Bacteria 4512
339 Ga0495622_0024361 3300046557 Bacteria 2826
340 Ga0495667_0256913 3300046559 Bacteria 1111
341 Ga0495634_0000333 3300046642 Bacteria 45524
342 Ga0495635_0054980 3300046663 Unclassified 2742
343 Ga0495635_0103116 3300046663 Bacteria 1949
344 Ga0495599_0009675 3300046678 Bacteria 5900
345 Ga0495599_0054905 3300046678 Unclassified 2495
346 Ga0495658_0012924 3300046683 Unclassified 4241
347 Ga0495658_0109774 3300046683 Unclassified 1657
348 Ga0495669_0421484 3300046684 Unclassified 647
349 Ga0495613_0013038 3300046689 Bacteria 6178
350 Ga0495613_0075297 3300046689 Unclassified 2457
351 Ga0495613_0232252 3300046689 Bacteria 1292
352 Ga0495624_0039184 3300046690 Bacteria 3039
353 Ga0495581_0101911 3300047315 Unclassified 1668
354 Ga0495674_0483262 3300047319 Unclassified 992
355 Ga0495680_0002752 3300047322 Bacteria 17756
356 Ga0495680_0201608 3300047322 Unclassified 1427
357 Ga0495675_0040895 3300047444 Bacteria 2955
358 Ga0495675_0115126 3300047444 Bacteria 1677
359 Ga0495675_0150567 3300047444 Bacteria 1438
360 Ga0495684_0098084 3300047471 Bacteria 2216
361 Ga0495684_0467981 3300047471 Bacteria 873
362 Ga0496115_0011372 3300048918 Bacteria 6669
363 Ga0501032_0192458 3300049569 Bacteria 1333
364 Ga0501033_0201849 3300049570 Bacteria 1420
365 Ga0501034_0118002 3300049571 Bacteria 2641
366 Ga0501039_0210812 3300049575 Bacteria 1528
367 Ga0501043_0365557 3300049579 Unclassified 1094
368 nmdc:mga0qj67_201196_c1 3300050509 Unclassified 1618
369 nmdc:mga06r32_40211_c1 3300050510 Bacteria 4438
370 nmdc:mga06r32_48886_c1 3300050510 Unclassified 4044
371 nmdc:mga08y16_113693_c1 3300050511 Bacteria 2818
372 nmdc:mga08y16_213522_c1 3300050511 Bacteria 1998
373 nmdc:mga08y16_403709_c1 3300050511 Unclassified 1398
374 nmdc:mga0n895_856110_c1 3300050512 Unclassified 897
375 nmdc:mga0rr50_671329_c1 3300050513 Unclassified 884
376 Ga0495601_0181319 3300053077 Bacteria 1377
377 Ga0495601_0379787 3300053077 Bacteria 917
378 Ga0500650_0005257 3300053098 Bacteria 4798
379 Ga0500636_0156487 3300053177 Bacteria 1247
380 Ga0105240_10319657
381 rootH2_10109811
382 Ga0065712_10230529
383 Ga0065707_10514009
384 Ga0070658_10061885
385 Ga0070683_100222791
386 Ga0070690_100001441
387 Ga0070690_100016729
388 Ga0070690_100137942
389 Ga0070690_100385832
390 Ga0070666_10047122
391 Ga0068868_100227007
392 Ga0068868_100930748
393 Ga0068868_101113012
394 Ga0070689_100004376
395 Ga0070689_100007431
396 Ga0070689_100009574
397 Ga0070689_100114746
398 Ga0070689_100205404
399 Ga0070689_100378053
400 Ga0070689_100422143
401 Ga0070689_100779073
402 Ga0070675_100286799
403 Ga0070688_100027715
404 Ga0070688_100055524
405 Ga0070688_100086973
406 Ga0070714_100003397
407 Ga0070713_100039082
408 Ga0070701_10017446
409 Ga0070711_100143186
410 Ga0070705_100175895
411 Ga0070700_100797716
412 Ga0070694_100028281
413 Ga0070694_100341665
414 Ga0070694_100753505
415 Ga0070681_10814478
416 Ga0070685_10003295
417 Ga0070685_10439769
418 Ga0070707_101005420
419 Ga0070679_100799296
420 Ga0070686_100041445
421 Ga0070686_100092841
422 Ga0070686_100210908
423 Ga0070686_100244425
424 Ga0070695_100233688
425 Ga0070704_100017217
426 Ga0068855_100024683
427 Ga0068855_100295703
428 Ga0068855_100306971
429 Ga0068855_100875504
430 Ga0068855_101428841
431 Ga0068857_100208166
432 Ga0068857_100323959
433 Ga0068857_100502428
434 Ga0068857_100771534
435 Ga0068856_100000311
436 Ga0068856_100110371
437 Ga0068859_100003499
438 Ga0068859_100145568
439 Ga0068859_100254931
440 Ga0068859_100426130
441 Ga0068859_100744336
442 Ga0068859_101230724
443 Ga0068864_100107246
444 Ga0068864_100607104
445 Ga0068863_100104027
446 Ga0068863_100335226
447 Ga0068863_100412548
448 Ga0068863_101328838
449 Ga0068863_101529898
450 Ga0068858_100332576
451 Ga0068858_101742393
452 Ga0068862_101240443
453 Ga0081455_10134084
454 Ga0070712_100362552
455 Ga0097621_100296259
456 Ga0068871_100115881
457 Ga0068871_100837041
458 Ga0075428_100666755
459 Ga0075428_100684628
460 Ga0075431_100048749
461 Ga0075431_100055206
462 Ga0075433_10707402
463 Ga0075433_10715808
464 Ga0075434_100863542
465 Ga0068865_100418503
466 Ga0097620_100003499
467 Ga0097620_100145565
468 Ga0097620_100254938
469 Ga0097620_100426092
470 Ga0097620_100744213
471 Ga0097620_101230637
472 Ga0075435_100221598
473 Ga0075435_100695768
474 Ga0105240_10006527
475 Ga0105240_10031293
476 Ga0105240_10038352
477 Ga0105240_11006042
478 Ga0111539_10013516
479 Ga0111539_10160420
480 Ga0111539_10253207
481 Ga0111539_10371730
482 Ga0111539_10373379
483 Ga0105245_10064951
484 Ga0105245_10397829
485 Ga0105245_10648671
486 Ga0114129_10689932
487 Ga0105241_10911007
488 Ga0105242_10035039
489 Ga0105242_10166880
490 Ga0105242_10285880
491 Ga0105242_10310420
492 Ga0105238_10000026
493 Ga0105238_10102699
494 Ga0105238_10334882
495 Ga0105249_11149679
496 Ga0105246_11124753
497 Ga0157371_10579690
498 Ga0157370_10090557
499 Ga0157370_10107314
500 Ga0157369_10731248
501 Ga0157374_10706691
502 Ga0157378_11291284
503 Ga0157372_10376882
504 Ga0157372_10534345
505 Ga0157375_10000131
506 Ga0157375_10274190
507 Ga0163163_10000194
508 Ga0163163_10025979
509 Ga0163163_11457428
510 Ga0157380_11568513
511 Ga0157377_10229511
512 Ga0157376_10123041
513 Ga0207680_10034496
514 Ga0207705_10131660
515 Ga0207684_10533250
516 Ga0207707_10763323
517 Ga0207695_10020149
518 Ga0207695_10073062
519 Ga0207695_10251749
520 Ga0207695_10925787
521 Ga0207663_10153089
522 Ga0207662_10030238
523 Ga0207652_10706699
524 Ga0207694_10000034
525 Ga0207694_10158641
526 Ga0207659_10107583
527 Ga0207687_10360568
528 Ga0207700_10288365
529 Ga0207700_10639131
530 Ga0207664_10021926
531 Ga0207686_10125139
532 Ga0207686_10234144
533 Ga0207686_10511029
534 Ga0207686_10618607
535 Ga0207670_10003355
536 Ga0207670_10010697
537 Ga0207670_10013175
538 Ga0207670_10087498
539 Ga0207670_10087835
540 Ga0207670_10781780
541 Ga0207670_11041742
542 Ga0207661_10084449
543 Ga0207667_10119026
544 Ga0207667_10191181
545 Ga0207667_10193687
546 Ga0207667_10200021
547 Ga0207712_10739167
548 Ga0207640_10409583
549 Ga0207677_10186971
550 Ga0207703_10311721
551 Ga0207639_10788624
552 Ga0207708_10138465
553 Ga0207702_10003468
554 Ga0207641_10665783
555 Ga0207641_10853017
556 Ga0207641_11091468
557 Ga0207676_10186586
558 Ga0207676_10279181
559 Ga0207674_10016290
560 Ga0207674_10261622
561 Ga0207674_10879160
562 Ga0207675_100482118
563 Ga0268265_10444883
564 Ga0268265_11391142
565 Ga0265337_1000102
566 Ga0265337_1000754
567 Ga0265337_1005334
568 Ga0265337_1118148
569 Ga0265326_10006709
570 Ga0265319_1042090
571 Ga0265319_1074019
572 Ga0265319_1131490
573 Ga0265334_10003890
574 Ga0265334_10067513
575 Ga0265334_10158326
576 Ga0265318_10011001
577 Ga0265318_10070961
578 Ga0265318_10086069
579 Ga0265318_10101950
580 Ga0265323_10000018
581 Ga0265323_10011307
582 Ga0265323_10017580
583 Ga0265323_10024680
584 Ga0265323_10042519
585 Ga0265323_10055748
586 Ga0265323_10086280
587 Ga0265322_10012947
588 Ga0265322_10125243
589 Ga0265336_10002415
590 Ga0265336_10018647
591 Ga0265336_10044713
592 Ga0265336_10147996
593 Ga0265338_10000040
594 Ga0265338_10000064
595 Ga0265338_10000242
596 Ga0265338_10001348
597 Ga0265338_10002770
598 Ga0265338_10003559
599 Ga0265338_10004065
600 Ga0265338_10005718
601 Ga0265338_10009507
602 Ga0265338_10015192
603 Ga0265338_10016423
604 Ga0265338_10022925
605 Ga0265338_10026726
606 Ga0265338_10030488
607 Ga0265338_10065598
608 Ga0265338_10082526
609 Ga0265338_10120823
610 Ga0265338_10193245
611 Ga0265338_10306343
612 Ga0265338_10373743
613 Ga0265338_10397410
614 Ga0265338_10673847
615 Ga0265324_10000392
616 Ga0265324_10008907
617 Ga0265324_10016177
618 Ga0265324_10117316
619 Ga0265332_10201332
620 Ga0265328_10117970
621 Ga0265320_10000870
622 Ga0265320_10001499
623 Ga0265320_10008991
624 Ga0265320_10009492
625 Ga0265320_10039790
626 Ga0265320_10057857
627 Ga0265325_10017385
628 Ga0265325_10080682
629 Ga0265340_10001390
630 Ga0265340_10013390
631 Ga0265340_10107643
632 Ga0265339_10003473
633 Ga0265327_10002080
634 Ga0265327_10004619
635 Ga0265316_10000659
636 Ga0265316_10011788
637 Ga0265316_10013268
638 Ga0265316_10151614
639 Ga0265316_10154359
640 Ga0265316_10210035
641 Ga0265313_10003321
642 Ga0265313_10017945
643 Ga0265314_10049509
644 Ga0265314_10091783
645 Ga0265314_10097758
646 Ga0265342_10072114
647 Ga0265342_10160615
648 Ga0316576_10000291
649 Ga0307416_100283167
650 Ga0307414_10285993
651 Ga0307411_10490083
652 Ga0316583_10069888
653 Ga0373959_0000110
654 Ga0373944_0006169
655 Ga0373954_0044765
656 Ga0373956_0002939
657 Ga0373956_0110932
658 Ga0373942_0205955
659 Ga0316574_0286925
660 Ga0373924_0256966
661 Ga0373931_0439132
662 Ga0373927_0852999
663 Ga0373937_0004433
664 Ga0373937_0231086
665 Ga0373937_0302039
666 Ga0373937_0441617
667 Ga0373937_0596881
668 Ga0373937_1371307
669 Ga0316584_0281142
670 Ga0373925_0118995
671 Ga0395899_0095187
672 Ga0395898_0051640
673 Ga0395901_0045693
674 Ga0451577_0003685
675 Ga0451577_0005119
676 Ga0451577_1055535
677 Ga0453684_0006647
678 Ga0453684_0019824
679 Ga0453684_0233149
680 Ga0453684_0249726
681 Ga0466957_0480709
682 Ga0451576_0022392
683 Ga0451576_0045417
684 Ga0451576_0080986
685 Ga0451576_0104055
686 Ga0451576_0109108
687 Ga0451576_0159747
688 Ga0451576_0290695
689 Ga0451576_0465431
690 Ga0451576_0493922
691 Ga0451576_0503951
692 Ga0451576_0818145
693 Ga0451576_1240042
694 Ga0495592_0000053
695 Ga0495592_0150027
696 Ga0495592_0640177
697 Ga0495629_0063415
698 Ga0495641_0032897
699 Ga0495582_0101143
700 Ga0495662_0021254
701 Ga0495664_0098669
702 Ga0495608_0241691
703 Ga0495618_0001265
704 Ga0495618_0001525
705 Ga0495628_0000091
706 Ga0495628_0079957
707 Ga0495628_0828712
708 Ga0495630_0034822
709 Ga0495630_0050876
710 Ga0495630_0152872
711 Ga0495652_0059108
712 Ga0495586_0000121
713 Ga0495586_0001363
714 Ga0495586_0001589
715 Ga0495645_0000721
716 Ga0495645_0013010
717 Ga0495645_0022993
718 Ga0495622_0024361
719 Ga0495667_0256913
720 Ga0495634_0000333
721 Ga0495635_0054980
722 Ga0495635_0103116
723 Ga0495599_0009675
724 Ga0495599_0054905
725 Ga0495658_0012924
726 Ga0495658_0109774
727 Ga0495669_0421484
728 Ga0495613_0013038
729 Ga0495613_0075297
730 Ga0495613_0232252
731 Ga0495624_0039184
732 Ga0495581_0101911
733 Ga0495674_0483262
734 Ga0495680_0002752
735 Ga0495680_0201608
736 Ga0495675_0040895
737 Ga0495675_0115126
738 Ga0495675_0150567
739 Ga0495684_0098084
740 Ga0495684_0467981
741 Ga0496115_0011372
742 Ga0501032_0192458
743 Ga0501033_0201849
744 Ga0501034_0118002
745 Ga0501039_0210812
746 Ga0501043_0365557
747 nmdc:mga0qj67_201196_c1
748 nmdc:mga06r32_40211_c1
749 nmdc:mga06r32_48886_c1
750 nmdc:mga08y16_113693_c1
751 nmdc:mga08y16_213522_c1
752 nmdc:mga08y16_403709_c1
753 nmdc:mga0n895_856110_c1
754 nmdc:mga0rr50_671329_c1
755 Ga0495601_0181319
756 Ga0495601_0379787
757 Ga0500650_0005257
758 Ga0500636_0156487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

60

186

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9269 4 182
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9229 6 184
5i8u-assembly4.cif.gz_E crystal structure of the rv1700 (mt adprase) e142q mutant 0.9197 6 184
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9121 4 182
5i8u-assembly2.cif.gz_A crystal structure of the rv1700 (mt adprase) e142q mutant 0.9112 4 184
ID Description Score Start End Superfamily
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9312 1 177 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9212 1 177 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9121 4 182 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9036 6 184 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8929 4 182 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A6L3EWK9-F1-model_v4 NUDIX hydrolase 0.9817 1 133 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A7C8DA32-F1-model_v4 deleted 0.977 1 182
AF-A0A520RT23-F1-model_v4 NUDIX hydrolase 0.9752 1 180 GO:0006753
GO:0016787
GO:0019693
AF-A0A6L3EWK9-F1-model_v4 NUDIX hydrolase 0.9744 1 133 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A2T2U804-F1-model_v4 NUDIX hydrolase 0.9719 1 180 GO:0005829
GO:0006753
GO:0016462
GO:0019693

Map