F428255

General Info

Members Datasets Scaffolds Average Seq Length
379 244 758 249

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100210144|Ga0068868_1002101442
Length 279
Sequence MNLTEVATSGPVLLAVLLSVAAGAVSFASPCVVPLVPGYLAYLAGLVGADAPAVTEDEVKAQDAERRAAVTGELPVATAIPRRLRRWRVAGAACLFVLGFTVVFVVGLGSVVWLADALLANEALLQRIGGVVTVAMGLVFLGLVPALQRDTRPHRVPQLGLVGAPLLGATFGLGWTPCLGPTLAGVVALASGTDAGSAGVRGVVLLLAYCVGLGVPFVLIALGAGRAVRAQAWLRNHSRRIQVVGGVGMIIVGLLLATGLWAEIIALLRGPIAGFSTPL

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
77 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
78 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2558860280 Kutzneria sp. 744 Isolate Unclassified
230 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
231 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
232 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
233 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
234 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
235 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
236 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
237 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
238 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
239 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
240 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
241 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
242 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
243 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
244 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0.53
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 7.92
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100210144 3300005338 Bacteria 1626
2 JGI24741J21665_1005689 3300001915 Bacteria 2575
3 rootL2_10314730 3300003322 Bacteria 1241
4 rootH1_10168119 3300003323 Bacteria 1472
5 Ga0070658_10017588 3300005327 Bacteria 5718
6 Ga0070658_10050106 3300005327 Bacteria 3384
7 Ga0070683_100092267 3300005329 Bacteria 2844
8 Ga0070670_100028851 3300005331 Bacteria 4776
9 Ga0068869_100011725 3300005334 Bacteria 5761
10 Ga0068869_100301707 3300005334 Bacteria 1293
11 Ga0070666_10066481 3300005335 Bacteria 2447
12 Ga0070666_10203019 3300005335 Bacteria 1395
13 Ga0070682_100042830 3300005337 Bacteria 2797
14 Ga0068868_100048231 3300005338 Bacteria 3340
15 Ga0070689_100132504 3300005340 Bacteria 1999
16 Ga0070691_10006947 3300005341 Bacteria 5182
17 Ga0070691_10038761 3300005341 Bacteria 2251
18 Ga0070661_100076936 3300005344 Bacteria 2459
19 Ga0070661_100260954 3300005344 Bacteria 1340
20 Ga0070692_10018457 3300005345 Bacteria 3356
21 Ga0070692_10065830 3300005345 Bacteria 1919
22 Ga0070668_100081693 3300005347 Bacteria 2534
23 Ga0070675_100023658 3300005354 Bacteria 4914
24 Ga0070671_100000653 3300005355 Bacteria 24925
25 Ga0070671_100023777 3300005355 Bacteria 5016
26 Ga0070671_100105858 3300005355 Bacteria 2361
27 Ga0070674_100034735 3300005356 Bacteria 3370
28 Ga0070673_100040140 3300005364 Bacteria 3588
29 Ga0070673_100138955 3300005364 Bacteria 2048
30 Ga0070688_100037973 3300005365 Bacteria 2938
31 Ga0070659_100170498 3300005366 Bacteria 1782
32 Ga0070659_100247606 3300005366 Bacteria 1476
33 Ga0070667_100120359 3300005367 Bacteria 2283
34 Ga0070709_10002259 3300005434 Bacteria 10439
35 Ga0070714_100180637 3300005435 Bacteria 1920
36 Ga0070713_100047171 3300005436 Bacteria 3539
37 Ga0070701_10038335 3300005438 Bacteria 2425
38 Ga0070711_100012329 3300005439 Bacteria 5335
39 Ga0070700_100028895 3300005441 Bacteria 3303
40 Ga0070708_100187972 3300005445 Unclassified 1932
41 Ga0070663_100009512 3300005455 Bacteria 6021
42 Ga0070663_100009904 3300005455 Bacteria 5921
43 Ga0070678_100006902 3300005456 Bacteria 6696
44 Ga0070681_10550789 3300005458 Bacteria 1067
45 Ga0070706_100004322 3300005467 Bacteria 13759
46 Ga0070706_100005129 3300005467 Bacteria 12497
47 Ga0070706_100108292 3300005467 Bacteria 2585
48 Ga0070707_100001857 3300005468 Bacteria 20297
49 Ga0070707_100002075 3300005468 Bacteria 19209
50 Ga0070698_100038597 3300005471 Unclassified 4920
51 Ga0070699_100002589 3300005518 Bacteria 16211
52 Ga0070699_100006445 3300005518 Bacteria 10221
53 Ga0070679_100123494 3300005530 Bacteria 2572
54 Ga0070679_100392342 3300005530 Bacteria 1334
55 Ga0068853_100010640 3300005539 Bacteria 7444
56 Ga0070672_100024457 3300005543 Bacteria 4465
57 Ga0070686_100301506 3300005544 Bacteria 1188
58 Ga0070693_100000312 3300005547 Bacteria 22443
59 Ga0070665_100005239 3300005548 Bacteria 13412
60 Ga0070665_100070007 3300005548 Bacteria 3515
61 Ga0070665_100270369 3300005548 Bacteria 1701
62 Ga0070665_100312541 3300005548 Bacteria 1575
63 Ga0070665_100504203 3300005548 Bacteria 1221
64 Ga0070664_100075300 3300005564 Bacteria 2898
65 Ga0068857_100957745 3300005577 Bacteria 822
66 Ga0068856_100091388 3300005614 Bacteria 3028
67 Ga0068856_100177977 3300005614 Bacteria 2139
68 Ga0070702_100000170 3300005615 Bacteria 20754
69 Ga0068852_100048342 3300005616 Bacteria 3634
70 Ga0068852_100055005 3300005616 Bacteria 3433
71 Ga0068852_100097788 3300005616 Bacteria 2641
72 Ga0068852_100408395 3300005616 Bacteria 1337
73 Ga0068859_100112490 3300005617 Bacteria 2786
74 Ga0068859_100205896 3300005617 Bacteria 2052
75 Ga0068864_100011562 3300005618 Bacteria 7289
76 Ga0068864_100027848 3300005618 Bacteria 4776
77 Ga0068866_10061719 3300005718 Bacteria 1948
78 Ga0068851_10080558 3300005834 Bacteria 1699
79 Ga0068870_10005838 3300005840 Bacteria 5402
80 Ga0068870_10344781 3300005840 Bacteria 954
81 Ga0068863_100011678 3300005841 Bacteria 8495
82 Ga0068863_100029504 3300005841 Bacteria 5236
83 Ga0068863_100784958 3300005841 Bacteria 949
84 Ga0068858_100007683 3300005842 Bacteria 10413
85 Ga0068860_100033812 3300005843 Bacteria 4906
86 Ga0068860_100402354 3300005843 Bacteria 1355
87 Ga0070717_10000785 3300006028 Bacteria 20810
88 Ga0070717_10001147 3300006028 Bacteria 17902
89 Ga0070717_10034766 3300006028 Bacteria 4076
90 Ga0070712_100260976 3300006175 Bacteria 1388
91 Ga0075369_10013611 3300006186 Bacteria 3234
92 Ga0097621_100010867 3300006237 Bacteria 6680
93 Ga0097621_100171682 3300006237 Bacteria 1869
94 Ga0068871_100022015 3300006358 Bacteria 4910
95 Ga0075433_10055086 3300006852 Bacteria 3471
96 Ga0075434_100007627 3300006871 Bacteria 10012
97 Ga0097620_100112485 3300006931 Bacteria 2786
98 Ga0097620_100205894 3300006931 Bacteria 2052
99 Ga0075435_100089908 3300007076 Bacteria 2532
100 Ga0111539_10006354 3300009094 Bacteria 15238
101 Ga0111539_10066739 3300009094 Bacteria 4250
102 Ga0111539_10170870 3300009094 Bacteria 2540
103 Ga0105245_10064052 3300009098 Bacteria 3322
104 Ga0105245_10067391 3300009098 Bacteria 3242
105 Ga0105247_10006106 3300009101 Bacteria 7489
106 Ga0114129_10700260 3300009147 Bacteria 1302
107 Ga0105243_10058681 3300009148 Bacteria 3067
108 Ga0105241_10011644 3300009174 Bacteria 6453
109 Ga0105241_10374854 3300009174 Bacteria 1242
110 Ga0105242_10283007 3300009176 Bacteria 1507
111 Ga0105248_10028202 3300009177 Bacteria 6253
112 Ga0105248_10094491 3300009177 Bacteria 3367
113 Ga0105237_10119334 3300009545 Bacteria 2631
114 Ga0105238_10138620 3300009551 Bacteria 2410
115 Ga0105238_10188264 3300009551 Bacteria 2040
116 Ga0105249_10053218 3300009553 Bacteria 3700
117 Ga0105249_10495597 3300009553 Bacteria 1266
118 Ga0105032_101912 3300009979 Bacteria 1881
119 Ga0105033_104380 3300009986 Bacteria 1201
120 Ga0105035_100346 3300009988 Bacteria 2873
121 Ga0105239_10103531 3300010375 Bacteria 3151
122 Ga0105239_10867207 3300010375 Bacteria 1036
123 Ga0105246_10005677 3300011119 Bacteria 7615
124 Ga0157371_10018062 3300013102 Bacteria 5223
125 Ga0157371_10055131 3300013102 Bacteria 2821
126 Ga0157370_10109946 3300013104 Bacteria 2576
127 Ga0157369_10032884 3300013105 Bacteria 5700
128 Ga0157369_10403568 3300013105 Bacteria 1418
129 Ga0157374_10069671 3300013296 Bacteria 3312
130 Ga0157374_10324445 3300013296 Bacteria 1526
131 Ga0163162_10168114 3300013306 Bacteria 2317
132 Ga0163162_10924725 3300013306 Bacteria 984
133 Ga0157372_10534182 3300013307 Bacteria 1367
134 Ga0157372_11390916 3300013307 Bacteria 809
135 Ga0157375_10060671 3300013308 Bacteria 3752
136 Ga0157375_10246624 3300013308 Bacteria 1946
137 Ga0163163_10141348 3300014325 Bacteria 2450
138 Ga0163163_10369611 3300014325 Bacteria 1491
139 Ga0157379_10005020 3300014968 Bacteria 11354
140 Ga0157379_10071589 3300014968 Bacteria 3101
141 Ga0157379_10470732 3300014968 Bacteria 1162
142 Ga0206354_11111200 3300020081 Bacteria 2616
143 Ga0213876_10012966 3300021384 Bacteria 4431
144 Ga0213875_10000159 3300021388 Bacteria 71303
145 Ga0224712_10009849 3300022467 Bacteria 2898
146 Ga0207656_10004200 3300025321 Bacteria 5012
147 Ga0207653_10024423 3300025885 Unclassified 1929
148 Ga0207710_10030518 3300025900 Bacteria 2352
149 Ga0207710_10130387 3300025900 Bacteria 1207
150 Ga0207688_10002633 3300025901 Bacteria 9710
151 Ga0207688_10011948 3300025901 Bacteria 4726
152 Ga0207680_10086070 3300025903 Bacteria 1987
153 Ga0207680_10198379 3300025903 Bacteria 1366
154 Ga0207647_10171580 3300025904 Bacteria 1263
155 Ga0207699_10010451 3300025906 Bacteria 4659
156 Ga0207645_10044060 3300025907 Bacteria 2855
157 Ga0207643_10000062 3300025908 Bacteria 71074
158 Ga0207643_10125577 3300025908 Bacteria 1523
159 Ga0207705_10003936 3300025909 Bacteria 11289
160 Ga0207684_10005280 3300025910 Bacteria 11978
161 Ga0207684_10013501 3300025910 Bacteria 7064
162 Ga0207707_10035971 3300025912 Bacteria 4330
163 Ga0207707_10597435 3300025912 Bacteria 934
164 Ga0207671_10072365 3300025914 Bacteria 2573
165 Ga0207663_10124124 3300025916 Bacteria 1773
166 Ga0207660_10006215 3300025917 Bacteria 7755
167 Ga0207657_10031136 3300025919 Bacteria 4837
168 Ga0207657_10040906 3300025919 Bacteria 4103
169 Ga0207649_10006202 3300025920 Bacteria 6491
170 Ga0207646_10002076 3300025922 Bacteria 24034
171 Ga0207646_10002606 3300025922 Bacteria 21232
172 Ga0207646_10021549 3300025922 Bacteria 5954
173 Ga0207694_10024985 3300025924 Bacteria 4539
174 Ga0207694_10291342 3300025924 Bacteria 1342
175 Ga0207650_10012918 3300025925 Bacteria 5772
176 Ga0207650_10256708 3300025925 Bacteria 1417
177 Ga0207659_10013271 3300025926 Bacteria 5270
178 Ga0207687_10151021 3300025927 Bacteria 1773
179 Ga0207700_10004242 3300025928 Bacteria 8423
180 Ga0207664_10346221 3300025929 Bacteria 1315
181 Ga0207644_10001889 3300025931 Bacteria 13623
182 Ga0207644_10013202 3300025931 Bacteria 5503
183 Ga0207644_10159272 3300025931 Bacteria 1754
184 Ga0207690_10045875 3300025932 Bacteria 2891
185 Ga0207690_10270244 3300025932 Bacteria 1320
186 Ga0207706_10034859 3300025933 Bacteria 4477
187 Ga0207706_10224107 3300025933 Bacteria 1646
188 Ga0207709_10617983 3300025935 Bacteria 860
189 Ga0207670_10053664 3300025936 Bacteria 2717
190 Ga0207691_10178875 3300025940 Bacteria 1854
191 Ga0207689_10023950 3300025942 Bacteria 5121
192 Ga0207689_10043129 3300025942 Bacteria 3729
193 Ga0207661_10010688 3300025944 Bacteria 6614
194 Ga0207679_10000826 3300025945 Bacteria 19925
195 Ga0207679_10069483 3300025945 Bacteria 2650
196 Ga0207712_10084988 3300025961 Bacteria 2314
197 Ga0207668_10030580 3300025972 Bacteria 3540
198 Ga0207668_10053673 3300025972 Bacteria 2794
199 Ga0207668_10164211 3300025972 Bacteria 1734
200 Ga0207668_10445392 3300025972 Bacteria 1104
201 Ga0207640_10235415 3300025981 Bacteria 1412
202 Ga0207640_10395040 3300025981 Bacteria 1124
203 Ga0207658_10108945 3300025986 Bacteria 2186
204 Ga0207677_10037488 3300026023 Bacteria 3169
205 Ga0207703_10019903 3300026035 Bacteria 5246
206 Ga0207639_10111743 3300026041 Bacteria 2228
207 Ga0207639_10323133 3300026041 Bacteria 1371
208 Ga0207678_10000510 3300026067 Bacteria 35197
209 Ga0207678_10022386 3300026067 Bacteria 5535
210 Ga0207708_10045275 3300026075 Bacteria 3353
211 Ga0207702_10015594 3300026078 Bacteria 6290
212 Ga0207702_10017768 3300026078 Bacteria 5887
213 Ga0207641_10032819 3300026088 Bacteria 4312
214 Ga0207641_10080153 3300026088 Bacteria 2831
215 Ga0207641_10256870 3300026088 Bacteria 1634
216 Ga0207648_10028626 3300026089 Bacteria 4939
217 Ga0207676_10001151 3300026095 Bacteria 19909
218 Ga0207676_10041075 3300026095 Bacteria 3548
219 Ga0207676_10082022 3300026095 Bacteria 2621
220 Ga0207675_100308043 3300026118 Bacteria 1544
221 Ga0207683_10000092 3300026121 Bacteria 72389
222 Ga0207683_10164376 3300026121 Bacteria 2008
223 Ga0207698_10233805 3300026142 Bacteria 1670
224 Ga0268264_10012274 3300028381 Bacteria 7050
225 Ga0307511_10000531 3300030521 Bacteria 40742
226 Ga0307511_10011503 3300030521 Bacteria 8723
227 Ga0265327_10000004 3300031251 Bacteria 803973
228 Ga0307508_10339022 3300031616 Bacteria 1095
229 Ga0307416_100725483 3300032002 Bacteria 1085
230 Ga0373953_0048106 3300035117 Bacteria 1717
231 Ga0373956_0011940 3300035119 Bacteria 3590
232 Ga0373955_0137097 3300035172 Bacteria 1432
233 Ga0373931_0072207 3300035691 Bacteria 1887
234 Ga0373937_0035164 3300036401 Bacteria 4559
235 Ga0373925_0120094 3300037068 Bacteria 2040
236 Ga0373925_0354773 3300037068 Bacteria 1191
237 Ga0395900_0021325 3300037418 Bacteria 6623
238 Ga0436364_1296475 3300037853 Bacteria 45742
239 Ga0395901_0368628 3300038443 Bacteria 1480
240 Ga0436365_1125572 3300039437 Bacteria 6682
241 Ga0439448_0041611 3300042005 Bacteria 1487
242 Ga0439463_003413 3300042016 Bacteria 4023
243 Ga0439458_0041556 3300042157 Bacteria 1117
244 Ga0439459_0009953 3300042438 Bacteria 1649
245 Ga0439459_0021076 3300042438 Bacteria 1248
246 Ga0466969_0007772 3300044656 Bacteria 5699
247 Ga0466969_0020156 3300044656 Bacteria 3456
248 Ga0466969_0120407 3300044656 Bacteria 1222
249 Ga0466972_0011552 3300044658 Bacteria 4433
250 Ga0466965_0001294 3300044683 Bacteria 9965
251 Ga0466965_0001996 3300044683 Bacteria 8535
252 Ga0466965_0017945 3300044683 Bacteria 3386
253 Ga0466966_0001859 3300044684 Bacteria 13697
254 Ga0466966_0012322 3300044684 Bacteria 5664
255 Ga0466966_0111640 3300044684 Bacteria 1685
256 Ga0466961_0013719 3300044693 Bacteria 5192
257 Ga0466961_0021823 3300044693 Bacteria 4119
258 Ga0466963_0001299 3300044694 Bacteria 13271
259 Ga0466963_0259397 3300044694 Bacteria 1220
260 Ga0466971_0001862 3300044719 Bacteria 8980
261 Ga0466971_0137382 3300044719 Bacteria 1137
262 Ga0466968_0091715 3300044735 Bacteria 1347
263 Ga0466970_0019878 3300044765 Bacteria 3485
264 Ga0466970_0022164 3300044765 Bacteria 3315
265 Ga0466970_0047869 3300044765 Bacteria 2279
266 Ga0466957_0007701 3300044842 Bacteria 6090
267 Ga0466960_0007376 3300044901 Bacteria 4466
268 Ga0466959_0016811 3300045049 Bacteria 5353
269 Ga0466958_0000116 3300045836 Bacteria 25851
270 Ga0466958_0032072 3300045836 Bacteria 3124
271 Ga0466967_0002704 3300045976 Bacteria 11204
272 Ga0466967_0007673 3300045976 Bacteria 7812
273 Ga0466967_0052946 3300045976 Bacteria 3566
274 Ga0466967_0152696 3300045976 Bacteria 2160
275 Ga0466967_0529219 3300045976 Bacteria 1159
276 Ga0495641_0017177 3300046461 Bacteria 3780
277 Ga0495650_0040968 3300046471 Bacteria 1984
278 Ga0495600_0155028 3300046809 Bacteria 1482
279 Ga0495676_0264253 3300047321 Bacteria 1170
280 Ga0495680_0125723 3300047322 Bacteria 1889
281 Ga0496100_0005970 3300048903 Bacteria 6607
282 Ga0496100_0294809 3300048903 Bacteria 1212
283 Ga0496100_0869842 3300048903 Bacteria 707
284 Ga0496101_0006116 3300048904 Bacteria 7727
285 Ga0496101_0061132 3300048904 Bacteria 2735
286 Ga0496102_0000479 3300048905 Bacteria 44350
287 Ga0496102_0346568 3300048905 Bacteria 1399
288 Ga0496103_0000669 3300048906 Bacteria 25760
289 Ga0496104_0007123 3300048907 Bacteria 9858
290 Ga0496104_0069584 3300048907 Bacteria 3345
291 Ga0496104_0362951 3300048907 Bacteria 1361
292 Ga0496105_0002885 3300048908 Bacteria 12603
293 Ga0496105_0020884 3300048908 Bacteria 5295
294 Ga0496105_0060134 3300048908 Bacteria 3135
295 Ga0496106_0001774 3300048909 Bacteria 16106
296 Ga0496107_0066595 3300048910 Bacteria 2612
297 Ga0496108_0014214 3300048911 Bacteria 6495
298 Ga0496108_0068285 3300048911 Bacteria 2999
299 Ga0496108_0108363 3300048911 Bacteria 2373
300 Ga0496108_0406953 3300048911 Bacteria 1188
301 Ga0496109_0238956 3300048912 Bacteria 1709
302 Ga0496110_0016996 3300048913 Bacteria 6082
303 Ga0496110_0035075 3300048913 Bacteria 4350
304 Ga0496111_0008626 3300048914 Bacteria 6757
305 Ga0496111_0428219 3300048914 Bacteria 977
306 Ga0496112_0073225 3300048915 Bacteria 3386
307 Ga0496112_0295284 3300048915 Bacteria 1566
308 Ga0496113_0018611 3300048916 Bacteria 4841
309 Ga0496113_0383728 3300048916 Bacteria 1128
310 Ga0496114_0363870 3300048917 Bacteria 1280
311 Ga0496116_0003840 3300048919 Bacteria 14667
312 Ga0496117_0000572 3300048920 Bacteria 60381
313 Ga0496118_0004828 3300048921 Bacteria 15719
314 Ga0496118_0131085 3300048921 Bacteria 1610
315 Ga0496119_0006091 3300048922 Bacteria 11299
316 Ga0496120_0008461 3300048923 Bacteria 7468
317 Ga0496121_0095965 3300048924 Bacteria 2302
318 Ga0496125_0134687 3300048928 Bacteria 1730
319 Ga0496126_0008143 3300048929 Bacteria 11348
320 Ga0496126_0047276 3300048929 Bacteria 3940
321 Ga0496126_0107205 3300048929 Bacteria 2437
322 Ga0496126_0126684 3300048929 Bacteria 2210
323 Ga0501031_0138469 3300049568 Bacteria 1590
324 Ga0501031_0155075 3300049568 Bacteria 1497
325 Ga0501032_0020469 3300049569 Bacteria 4607
326 Ga0501032_0071232 3300049569 Bacteria 2317
327 Ga0501033_0033901 3300049570 Bacteria 3832
328 Ga0501033_0055307 3300049570 Bacteria 2934
329 Ga0501034_0006370 3300049571 Bacteria 12710
330 Ga0501034_0089873 3300049571 Bacteria 3069
331 Ga0501034_0106384 3300049571 Bacteria 2798
332 Ga0501034_0301941 3300049571 Bacteria 1537
333 Ga0501038_0018615 3300049574 Bacteria 6272
334 Ga0501038_0074913 3300049574 Bacteria 2862
335 Ga0501038_0167036 3300049574 Bacteria 1784
336 Ga0501043_0244176 3300049579 Bacteria 1384
337 Ga0501043_0255836 3300049579 Bacteria 1348
338 Ga0501047_0243081 3300049581 Bacteria 1650
339 Ga0501073_0232413 3300049589 Bacteria 1274
340 Ga0501073_0496304 3300049589 Bacteria 844
341 Ga0501081_0097980 3300049743 Bacteria 2070
342 Ga0501044_0683024 3300049823 Bacteria 913
343 nmdc:mga05p37_150202_c1 3300050507 Bacteria 2850
344 nmdc:mga09592_260015_c1 3300050508 Bacteria 1505
345 nmdc:mga0n895_77077_c1 3300050512 Bacteria 3316
346 nmdc:mga0rr50_76146_c1 3300050513 Bacteria 2575
347 nmdc:mga08x19_4476_c1 3300050514 Bacteria 8282
348 nmdc:mga0a205_65522_c1 3300050515 Bacteria 3510
349 nmdc:mga0sz30_39117_c1 3300050516 Bacteria 1989
350 nmdc:mga0sz30_4595_c1 3300050516 Bacteria 4999
351 Ga0495619_0081270 3300053085 Bacteria 2182
352 Ga0500556_0000188 3300053104 Bacteria 50480
353 Ga0500562_000491 3300053108 Bacteria 9595
354 Ga0500655_001089 3300053133 Bacteria 5207
355 Ga0500559_0000162 3300053136 Bacteria 52858
356 Ga0500568_0000087 3300053139 Bacteria 90384
357 Ga0500568_0000663 3300053139 Bacteria 24875
358 Ga0500568_0008088 3300053139 Bacteria 5103
359 Ga0500616_0003824 3300053153 Bacteria 11150
360 Ga0500616_0032143 3300053153 Bacteria 2870
361 Ga0466962_0000566 3300061719 Bacteria 16241
362 2559428614 2558860280 Bacteria 11429938
363 2753069804 2751185734 Bacteria 8863695
364 2776371601 2775506925 Bacteria 7237746
365 2776371884 2775506925 Bacteria 7237746
366 2784473181 2784132109 Bacteria 3141763
367 2816505736 2816332139 Bacteria 9138787
368 2852643639 2852643534 Bacteria 3013378
369 2857736276 2857733635 Bacteria 3532004
370 2863070185 2863067949 Bacteria 8541735
371 2863071701 2863067949 Bacteria 8541735
372 2866555710 2866552031 Bacteria 5824618
373 2870727684 2870721527 Bacteria 9689237
374 2904434077 2904430863 Bacteria 3486923
375 2984578746 2984576629 Bacteria 4248407
376 2990258002 2990256926 Bacteria 4252839
377 8002392962 8002392321 Bacteria 4159911
378 8054474502 8054472261 Bacteria 7464355
379 8056210973 8056207758 Bacteria 8639239
380 Ga0068868_100210144
381 JGI24741J21665_1005689
382 rootL2_10314730
383 rootH1_10168119
384 Ga0070658_10017588
385 Ga0070658_10050106
386 Ga0070683_100092267
387 Ga0070670_100028851
388 Ga0068869_100011725
389 Ga0068869_100301707
390 Ga0070666_10066481
391 Ga0070666_10203019
392 Ga0070682_100042830
393 Ga0068868_100048231
394 Ga0070689_100132504
395 Ga0070691_10006947
396 Ga0070691_10038761
397 Ga0070661_100076936
398 Ga0070661_100260954
399 Ga0070692_10018457
400 Ga0070692_10065830
401 Ga0070668_100081693
402 Ga0070675_100023658
403 Ga0070671_100000653
404 Ga0070671_100023777
405 Ga0070671_100105858
406 Ga0070674_100034735
407 Ga0070673_100040140
408 Ga0070673_100138955
409 Ga0070688_100037973
410 Ga0070659_100170498
411 Ga0070659_100247606
412 Ga0070667_100120359
413 Ga0070709_10002259
414 Ga0070714_100180637
415 Ga0070713_100047171
416 Ga0070701_10038335
417 Ga0070711_100012329
418 Ga0070700_100028895
419 Ga0070708_100187972
420 Ga0070663_100009512
421 Ga0070663_100009904
422 Ga0070678_100006902
423 Ga0070681_10550789
424 Ga0070706_100004322
425 Ga0070706_100005129
426 Ga0070706_100108292
427 Ga0070707_100001857
428 Ga0070707_100002075
429 Ga0070698_100038597
430 Ga0070699_100002589
431 Ga0070699_100006445
432 Ga0070679_100123494
433 Ga0070679_100392342
434 Ga0068853_100010640
435 Ga0070672_100024457
436 Ga0070686_100301506
437 Ga0070693_100000312
438 Ga0070665_100005239
439 Ga0070665_100070007
440 Ga0070665_100270369
441 Ga0070665_100312541
442 Ga0070665_100504203
443 Ga0070664_100075300
444 Ga0068857_100957745
445 Ga0068856_100091388
446 Ga0068856_100177977
447 Ga0070702_100000170
448 Ga0068852_100048342
449 Ga0068852_100055005
450 Ga0068852_100097788
451 Ga0068852_100408395
452 Ga0068859_100112490
453 Ga0068859_100205896
454 Ga0068864_100011562
455 Ga0068864_100027848
456 Ga0068866_10061719
457 Ga0068851_10080558
458 Ga0068870_10005838
459 Ga0068870_10344781
460 Ga0068863_100011678
461 Ga0068863_100029504
462 Ga0068863_100784958
463 Ga0068858_100007683
464 Ga0068860_100033812
465 Ga0068860_100402354
466 Ga0070717_10000785
467 Ga0070717_10001147
468 Ga0070717_10034766
469 Ga0070712_100260976
470 Ga0075369_10013611
471 Ga0097621_100010867
472 Ga0097621_100171682
473 Ga0068871_100022015
474 Ga0075433_10055086
475 Ga0075434_100007627
476 Ga0097620_100112485
477 Ga0097620_100205894
478 Ga0075435_100089908
479 Ga0111539_10006354
480 Ga0111539_10066739
481 Ga0111539_10170870
482 Ga0105245_10064052
483 Ga0105245_10067391
484 Ga0105247_10006106
485 Ga0114129_10700260
486 Ga0105243_10058681
487 Ga0105241_10011644
488 Ga0105241_10374854
489 Ga0105242_10283007
490 Ga0105248_10028202
491 Ga0105248_10094491
492 Ga0105237_10119334
493 Ga0105238_10138620
494 Ga0105238_10188264
495 Ga0105249_10053218
496 Ga0105249_10495597
497 Ga0105032_101912
498 Ga0105033_104380
499 Ga0105035_100346
500 Ga0105239_10103531
501 Ga0105239_10867207
502 Ga0105246_10005677
503 Ga0157371_10018062
504 Ga0157371_10055131
505 Ga0157370_10109946
506 Ga0157369_10032884
507 Ga0157369_10403568
508 Ga0157374_10069671
509 Ga0157374_10324445
510 Ga0163162_10168114
511 Ga0163162_10924725
512 Ga0157372_10534182
513 Ga0157372_11390916
514 Ga0157375_10060671
515 Ga0157375_10246624
516 Ga0163163_10141348
517 Ga0163163_10369611
518 Ga0157379_10005020
519 Ga0157379_10071589
520 Ga0157379_10470732
521 Ga0206354_11111200
522 Ga0213876_10012966
523 Ga0213875_10000159
524 Ga0224712_10009849
525 Ga0207656_10004200
526 Ga0207653_10024423
527 Ga0207710_10030518
528 Ga0207710_10130387
529 Ga0207688_10002633
530 Ga0207688_10011948
531 Ga0207680_10086070
532 Ga0207680_10198379
533 Ga0207647_10171580
534 Ga0207699_10010451
535 Ga0207645_10044060
536 Ga0207643_10000062
537 Ga0207643_10125577
538 Ga0207705_10003936
539 Ga0207684_10005280
540 Ga0207684_10013501
541 Ga0207707_10035971
542 Ga0207707_10597435
543 Ga0207671_10072365
544 Ga0207663_10124124
545 Ga0207660_10006215
546 Ga0207657_10031136
547 Ga0207657_10040906
548 Ga0207649_10006202
549 Ga0207646_10002076
550 Ga0207646_10002606
551 Ga0207646_10021549
552 Ga0207694_10024985
553 Ga0207694_10291342
554 Ga0207650_10012918
555 Ga0207650_10256708
556 Ga0207659_10013271
557 Ga0207687_10151021
558 Ga0207700_10004242
559 Ga0207664_10346221
560 Ga0207644_10001889
561 Ga0207644_10013202
562 Ga0207644_10159272
563 Ga0207690_10045875
564 Ga0207690_10270244
565 Ga0207706_10034859
566 Ga0207706_10224107
567 Ga0207709_10617983
568 Ga0207670_10053664
569 Ga0207691_10178875
570 Ga0207689_10023950
571 Ga0207689_10043129
572 Ga0207661_10010688
573 Ga0207679_10000826
574 Ga0207679_10069483
575 Ga0207712_10084988
576 Ga0207668_10030580
577 Ga0207668_10053673
578 Ga0207668_10164211
579 Ga0207668_10445392
580 Ga0207640_10235415
581 Ga0207640_10395040
582 Ga0207658_10108945
583 Ga0207677_10037488
584 Ga0207703_10019903
585 Ga0207639_10111743
586 Ga0207639_10323133
587 Ga0207678_10000510
588 Ga0207678_10022386
589 Ga0207708_10045275
590 Ga0207702_10015594
591 Ga0207702_10017768
592 Ga0207641_10032819
593 Ga0207641_10080153
594 Ga0207641_10256870
595 Ga0207648_10028626
596 Ga0207676_10001151
597 Ga0207676_10041075
598 Ga0207676_10082022
599 Ga0207675_100308043
600 Ga0207683_10000092
601 Ga0207683_10164376
602 Ga0207698_10233805
603 Ga0268264_10012274
604 Ga0307511_10000531
605 Ga0307511_10011503
606 Ga0265327_10000004
607 Ga0307508_10339022
608 Ga0307416_100725483
609 Ga0373953_0048106
610 Ga0373956_0011940
611 Ga0373955_0137097
612 Ga0373931_0072207
613 Ga0373937_0035164
614 Ga0373925_0120094
615 Ga0373925_0354773
616 Ga0395900_0021325
617 Ga0436364_1296475
618 Ga0395901_0368628
619 Ga0436365_1125572
620 Ga0439448_0041611
621 Ga0439463_003413
622 Ga0439458_0041556
623 Ga0439459_0009953
624 Ga0439459_0021076
625 Ga0466969_0007772
626 Ga0466969_0020156
627 Ga0466969_0120407
628 Ga0466972_0011552
629 Ga0466965_0001294
630 Ga0466965_0001996
631 Ga0466965_0017945
632 Ga0466966_0001859
633 Ga0466966_0012322
634 Ga0466966_0111640
635 Ga0466961_0013719
636 Ga0466961_0021823
637 Ga0466963_0001299
638 Ga0466963_0259397
639 Ga0466971_0001862
640 Ga0466971_0137382
641 Ga0466968_0091715
642 Ga0466970_0019878
643 Ga0466970_0022164
644 Ga0466970_0047869
645 Ga0466957_0007701
646 Ga0466960_0007376
647 Ga0466959_0016811
648 Ga0466958_0000116
649 Ga0466958_0032072
650 Ga0466967_0002704
651 Ga0466967_0007673
652 Ga0466967_0052946
653 Ga0466967_0152696
654 Ga0466967_0529219
655 Ga0495641_0017177
656 Ga0495650_0040968
657 Ga0495600_0155028
658 Ga0495676_0264253
659 Ga0495680_0125723
660 Ga0496100_0005970
661 Ga0496100_0294809
662 Ga0496100_0869842
663 Ga0496101_0006116
664 Ga0496101_0061132
665 Ga0496102_0000479
666 Ga0496102_0346568
667 Ga0496103_0000669
668 Ga0496104_0007123
669 Ga0496104_0069584
670 Ga0496104_0362951
671 Ga0496105_0002885
672 Ga0496105_0020884
673 Ga0496105_0060134
674 Ga0496106_0001774
675 Ga0496107_0066595
676 Ga0496108_0014214
677 Ga0496108_0068285
678 Ga0496108_0108363
679 Ga0496108_0406953
680 Ga0496109_0238956
681 Ga0496110_0016996
682 Ga0496110_0035075
683 Ga0496111_0008626
684 Ga0496111_0428219
685 Ga0496112_0073225
686 Ga0496112_0295284
687 Ga0496113_0018611
688 Ga0496113_0383728
689 Ga0496114_0363870
690 Ga0496116_0003840
691 Ga0496117_0000572
692 Ga0496118_0004828
693 Ga0496118_0131085
694 Ga0496119_0006091
695 Ga0496120_0008461
696 Ga0496121_0095965
697 Ga0496125_0134687
698 Ga0496126_0008143
699 Ga0496126_0047276
700 Ga0496126_0107205
701 Ga0496126_0126684
702 Ga0501031_0138469
703 Ga0501031_0155075
704 Ga0501032_0020469
705 Ga0501032_0071232
706 Ga0501033_0033901
707 Ga0501033_0055307
708 Ga0501034_0006370
709 Ga0501034_0089873
710 Ga0501034_0106384
711 Ga0501034_0301941
712 Ga0501038_0018615
713 Ga0501038_0074913
714 Ga0501038_0167036
715 Ga0501043_0244176
716 Ga0501043_0255836
717 Ga0501047_0243081
718 Ga0501073_0232413
719 Ga0501073_0496304
720 Ga0501081_0097980
721 Ga0501044_0683024
722 nmdc:mga05p37_150202_c1
723 nmdc:mga09592_260015_c1
724 nmdc:mga0n895_77077_c1
725 nmdc:mga0rr50_76146_c1
726 nmdc:mga08x19_4476_c1
727 nmdc:mga0a205_65522_c1
728 nmdc:mga0sz30_39117_c1
729 nmdc:mga0sz30_4595_c1
730 Ga0495619_0081270
731 Ga0500556_0000188
732 Ga0500562_000491
733 Ga0500655_001089
734 Ga0500559_0000162
735 Ga0500568_0000087
736 Ga0500568_0000663
737 Ga0500568_0008088
738 Ga0500616_0003824
739 Ga0500616_0032143
740 Ga0466962_0000566
741 2559428614
742 2753069804
743 2776371601
744 2776371884
745 2784473181
746 2816505736
747 2852643639
748 2857736276
749 2863070185
750 2863071701
751 2866555710
752 2870727684
753 2904434077
754 2984578746
755 2990258002
756 8002392962
757 8054474502
758 8056210973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

77

258

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.6615 21 246
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.595 21 246
8f6h-assembly1.cif.gz_B cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.3202 75 244
8f6k-assembly1.cif.gz_C cryo-em structure of a zinc-loaded h263a/d287a mutant of the yiip-fab complex 0.2992 69 245
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.26 75 245
ID Description Score Start End Superfamily
af_Q8IIV4_2_207_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4832 80 245 1.20.1250.20
af_P08194_240_451_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4264 81 258 1.20.1250.20
af_D3Z5L6_227_437_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4002 85 254 1.20.1250.20
af_Q54TT3_40_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3993 21 251 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3976 23 246 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q4CYZ2-F1-model_v4 Cytochrome c biogenesis protein CcdA 0.8281 10 240 GO:0016020
GO:0017004
AF-A0A3M6KD07-F1-model_v4 Thioredoxin domain-containing protein 0.8152 3 259 GO:0005886
GO:0016209
GO:0016491
GO:0017004
AF-A0A7W1KM16-F1-model_v4 Cytochrome c biogenesis protein CcdA 0.8102 14 251 GO:0016020
GO:0017004
AF-B5YLA7-F1-model_v4 C-type cytochrome biogenesis protein 0.8088 19 246 GO:0016020
GO:0017004
AF-A0A4Q4CYZ2-F1-model_v4 Cytochrome c biogenesis protein CcdA 0.8014 10 240 GO:0016020
GO:0017004

Map