F428243

General Info

Members Datasets Scaffolds Average Seq Length
379 199 758 100

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10058938|Ga0070658_100589382
Length 111
Sequence MSEVMPNAGADQHTIHVALPFHLRTLAGVGSEVSLEVAAPVTIARVLDALEAAYPMLRGTIREFETGKRRAFLRFFACQEDLSNEGMDVALPSAVVEGREPLLIIGAIAGG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
183 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.85
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10058938 3300005327 Bacteria 3126
2 MRS2a_Contig_15077 2124908027 Unclassified 530
3 Ga0065714_10125665 3300005288 Bacteria 1281
4 Ga0070683_100243931 3300005329 Bacteria 1709
5 Ga0070683_100721279 3300005329 Bacteria 955
6 Ga0070683_100863414 3300005329 Bacteria 868
7 Ga0070683_102006357 3300005329 Bacteria 556
8 Ga0070690_100450171 3300005330 Bacteria 955
9 Ga0070680_100000021 3300005336 Bacteria 81631
10 Ga0068868_100007159 3300005338 Bacteria 7928
11 Ga0070660_100047711 3300005339 Bacteria 3287
12 Ga0070692_10138718 3300005345 Bacteria 1374
13 Ga0070692_10909616 3300005345 Bacteria 609
14 Ga0070674_101529368 3300005356 Bacteria 600
15 Ga0070673_100240451 3300005364 Bacteria 1574
16 Ga0070673_102215375 3300005364 Bacteria 522
17 Ga0070659_100000509 3300005366 Bacteria 28530
18 Ga0070659_100190094 3300005366 Bacteria 1687
19 Ga0070659_100300188 3300005366 Bacteria 1339
20 Ga0070709_10608136 3300005434 Bacteria 842
21 Ga0070714_100267949 3300005435 Bacteria 1583
22 Ga0070714_100460063 3300005435 Bacteria 1209
23 Ga0070714_101361934 3300005435 Bacteria 693
24 Ga0070714_102428592 3300005435 Bacteria 509
25 Ga0070705_100119254 3300005440 Bacteria 1700
26 Ga0070705_100493855 3300005440 Bacteria 928
27 Ga0070694_100464735 3300005444 Bacteria 1001
28 Ga0070708_100001673 3300005445 Bacteria 17014
29 Ga0070708_100021166 3300005445 Bacteria 5494
30 Ga0070708_100046351 3300005445 Bacteria 3836
31 Ga0070708_100067437 3300005445 Bacteria 3213
32 Ga0070708_100152820 3300005445 Bacteria 2147
33 Ga0070708_100184787 3300005445 Bacteria 1949
34 Ga0070708_100284818 3300005445 Bacteria 1555
35 Ga0070708_100471764 3300005445 Bacteria 1184
36 Ga0070708_101121780 3300005445 Bacteria 736
37 Ga0070708_101232267 3300005445 Unclassified 699
38 Ga0070708_101245533 3300005445 Bacteria 695
39 Ga0070708_101698281 3300005445 Bacteria 587
40 Ga0070708_102170901 3300005445 Bacteria 513
41 Ga0070681_10087331 3300005458 Bacteria 3072
42 Ga0070681_10104405 3300005458 Bacteria 2776
43 Ga0070681_10388365 3300005458 Bacteria 1307
44 Ga0068867_101629772 3300005459 Bacteria 604
45 Ga0070706_100004311 3300005467 Bacteria 13777
46 Ga0070706_100005806 3300005467 Bacteria 11729
47 Ga0070706_100033608 3300005467 Bacteria 4734
48 Ga0070706_100126089 3300005467 Bacteria 2387
49 Ga0070706_100274108 3300005467 Bacteria 1574
50 Ga0070706_100473947 3300005467 Bacteria 1165
51 Ga0070706_100619168 3300005467 Bacteria 1005
52 Ga0070706_100647904 3300005467 Bacteria 981
53 Ga0070706_101472270 3300005467 Unclassified 622
54 Ga0070706_101705356 3300005467 Bacteria 574
55 Ga0070707_100002788 3300005468 Bacteria 16630
56 Ga0070707_100004339 3300005468 Bacteria 13286
57 Ga0070707_100016158 3300005468 Bacteria 7003
58 Ga0070707_100016485 3300005468 Bacteria 6933
59 Ga0070707_100026868 3300005468 Bacteria 5469
60 Ga0070707_100042080 3300005468 Bacteria 4373
61 Ga0070707_100127260 3300005468 Bacteria 2475
62 Ga0070707_100131408 3300005468 Bacteria 2435
63 Ga0070707_100383061 3300005468 Bacteria 1366
64 Ga0070707_100473738 3300005468 Bacteria 1213
65 Ga0070707_100510709 3300005468 Bacteria 1164
66 Ga0070707_100570854 3300005468 Bacteria 1093
67 Ga0070707_100595788 3300005468 Bacteria 1068
68 Ga0070707_101416192 3300005468 Bacteria 662
69 Ga0070698_100014362 3300005471 Bacteria 8367
70 Ga0070698_100025477 3300005471 Bacteria 6166
71 Ga0070698_100471527 3300005471 Bacteria 1192
72 Ga0070699_100014176 3300005518 Bacteria 6858
73 Ga0070699_100017341 3300005518 Bacteria 6183
74 Ga0070699_100060769 3300005518 Bacteria 3275
75 Ga0070699_100068318 3300005518 Bacteria 3086
76 Ga0070699_100206144 3300005518 Bacteria 1749
77 Ga0070699_100278697 3300005518 Bacteria 1497
78 Ga0070699_100774988 3300005518 Bacteria 877
79 Ga0070699_101152609 3300005518 Bacteria 711
80 Ga0070699_101994275 3300005518 Bacteria 530
81 Ga0070679_100034588 3300005530 Bacteria 5008
82 Ga0070684_100476339 3300005535 Bacteria 1155
83 Ga0070684_100975197 3300005535 Unclassified 795
84 Ga0070684_101019669 3300005535 Bacteria 777
85 Ga0070697_100147384 3300005536 Bacteria 1982
86 Ga0070697_100353521 3300005536 Bacteria 1269
87 Ga0070697_100600271 3300005536 Bacteria 967
88 Ga0070697_100709444 3300005536 Bacteria 888
89 Ga0070697_101677037 3300005536 Bacteria 568
90 Ga0070695_100859861 3300005545 Bacteria 730
91 Ga0070693_100000296 3300005547 Bacteria 23271
92 Ga0070665_100396807 3300005548 Bacteria 1387
93 Ga0070704_100006743 3300005549 Bacteria 6796
94 Ga0068855_100014525 3300005563 Bacteria 9484
95 Ga0070664_101983967 3300005564 Unclassified 552
96 Ga0068857_101752842 3300005577 Bacteria 607
97 Ga0068857_102001484 3300005577 Bacteria 568
98 Ga0068854_100778290 3300005578 Bacteria 832
99 Ga0068856_100001093 3300005614 Bacteria 28597
100 Ga0068856_100005943 3300005614 Bacteria 12014
101 Ga0068856_100025967 3300005614 Bacteria 5712
102 Ga0068852_100011445 3300005616 Bacteria 6680
103 Ga0068863_100247369 3300005841 Bacteria 1722
104 Ga0068863_102416411 3300005841 Bacteria 535
105 Ga0070717_10010237 3300006028 Bacteria 7066
106 Ga0070717_10818748 3300006028 Unclassified 847
107 Ga0070717_11584848 3300006028 Bacteria 594
108 Ga0075364_11146057 3300006051 Bacteria 527
109 Ga0075432_10592919 3300006058 Bacteria 506
110 Ga0070715_10091472 3300006163 Bacteria 1401
111 Ga0070712_100901561 3300006175 Unclassified 762
112 Ga0097621_101498246 3300006237 Bacteria 640
113 Ga0068871_100321760 3300006358 Bacteria 1362
114 Ga0075428_100009279 3300006844 Bacteria 10910
115 Ga0075428_100096325 3300006844 Bacteria 3225
116 Ga0075430_100001921 3300006846 Bacteria 17043
117 Ga0075431_100003150 3300006847 Bacteria 15947
118 Ga0075431_100150029 3300006847 Bacteria 2401
119 Ga0075431_102235253 3300006847 Bacteria 501
120 Ga0075433_10039244 3300006852 Bacteria 4093
121 Ga0075433_10052046 3300006852 Bacteria 3567
122 Ga0075433_10112308 3300006852 Bacteria 2417
123 Ga0075434_100012440 3300006871 Bacteria 8069
124 Ga0075434_100061066 3300006871 Bacteria 3749
125 Ga0075434_100172748 3300006871 Bacteria 2181
126 Ga0075434_101880984 3300006871 Bacteria 605
127 Ga0075429_100000784 3300006880 Bacteria 25013
128 Ga0075429_100021653 3300006880 Bacteria 5573
129 Ga0075429_100025483 3300006880 Bacteria 5132
130 Ga0075436_100015407 3300006914 Bacteria 5236
131 Ga0075436_100494095 3300006914 Bacteria 894
132 Ga0097620_102060303 3300006931 Bacteria 630
133 Ga0075435_100016549 3300007076 Bacteria 5561
134 Ga0075435_100017784 3300007076 Bacteria 5388
135 Ga0075435_100031014 3300007076 Bacteria 4208
136 Ga0099794_10001037 3300007265 Bacteria 9447
137 Ga0099794_10777858 3300007265 Bacteria 512
138 Ga0105240_10135666 3300009093 Bacteria 2948
139 Ga0105240_10619570 3300009093 Bacteria 1189
140 Ga0111539_10024126 3300009094 Bacteria 7469
141 Ga0111539_12054913 3300009094 Bacteria 663
142 Ga0105245_10040053 3300009098 Bacteria 4172
143 Ga0114129_10005243 3300009147 Bacteria 18268
144 Ga0114129_10012543 3300009147 Bacteria 12069
145 Ga0114129_10014289 3300009147 Bacteria 11313
146 Ga0114129_10064979 3300009147 Bacteria 5092
147 Ga0114129_10136392 3300009147 Bacteria 3367
148 Ga0114129_10276667 3300009147 Bacteria 2244
149 Ga0114129_10308775 3300009147 Unclassified 2106
150 Ga0114129_10380681 3300009147 Bacteria 1864
151 Ga0114129_10419933 3300009147 Bacteria 1759
152 Ga0114129_10463788 3300009147 Bacteria 1660
153 Ga0114129_10639630 3300009147 Bacteria 1374
154 Ga0114129_11212831 3300009147 Bacteria 939
155 Ga0114129_11861438 3300009147 Bacteria 730
156 Ga0105243_11211805 3300009148 Bacteria 768
157 Ga0105241_12510792 3300009174 Bacteria 516
158 Ga0105242_10447931 3300009176 Bacteria 1216
159 Ga0105248_11090219 3300009177 Bacteria 902
160 Ga0105237_10047673 3300009545 Bacteria 4307
161 Ga0105238_10050341 3300009551 Bacteria 4193
162 Ga0105249_10191150 3300009553 Bacteria 1998
163 Ga0105249_13428114 3300009553 Bacteria 510
164 Ga0105239_10465999 3300010375 Bacteria 1434
165 Ga0105239_13643979 3300010375 Unclassified 500
166 Ga0105246_10049546 3300011119 Bacteria 2877
167 Ga0157373_10000631 3300013100 Bacteria 27594
168 Ga0157371_10020283 3300013102 Bacteria 4892
169 Ga0157370_10039216 3300013104 Bacteria 4578
170 Ga0157369_10001727 3300013105 Bacteria 26551
171 Ga0157369_10115348 3300013105 Bacteria 2852
172 Ga0157374_10023724 3300013296 Bacteria 5492
173 Ga0157374_10490051 3300013296 Bacteria 1233
174 Ga0157378_10236529 3300013297 Bacteria 1743
175 Ga0157372_10066951 3300013307 Bacteria 4035
176 Ga0157372_11617293 3300013307 Bacteria 746
177 Ga0157375_11729061 3300013308 Bacteria 741
178 Ga0163163_10147949 3300014325 Bacteria 2393
179 Ga0157380_10740987 3300014326 Bacteria 993
180 Ga0157377_11051390 3300014745 Bacteria 620
181 Ga0157379_10242110 3300014968 Bacteria 1636
182 Ga0157379_11779519 3300014968 Bacteria 605
183 Ga0157379_12019592 3300014968 Bacteria 570
184 Ga0197907_11017334 3300020069 Bacteria 1912
185 Ga0206350_10794262 3300020080 Bacteria 657
186 Ga0207653_10165762 3300025885 Unclassified 820
187 Ga0207688_10620047 3300025901 Bacteria 682
188 Ga0207699_10201968 3300025906 Bacteria 1347
189 Ga0207705_10307152 3300025909 Bacteria 1217
190 Ga0207684_10013377 3300025910 Bacteria 7098
191 Ga0207684_10021939 3300025910 Bacteria 5453
192 Ga0207684_10031277 3300025910 Bacteria 4528
193 Ga0207684_10066628 3300025910 Bacteria 3058
194 Ga0207684_10095915 3300025910 Bacteria 2531
195 Ga0207684_10459917 3300025910 Bacteria 1092
196 Ga0207684_10672435 3300025910 Bacteria 881
197 Ga0207707_10073349 3300025912 Bacteria 2985
198 Ga0207707_10267628 3300025912 Bacteria 1482
199 Ga0207707_10630052 3300025912 Bacteria 905
200 Ga0207695_10024140 3300025913 Bacteria 6849
201 Ga0207671_10026881 3300025914 Bacteria 4304
202 Ga0207693_10450200 3300025915 Bacteria 1006
203 Ga0207660_10000239 3300025917 Bacteria 35581
204 Ga0207660_10231848 3300025917 Bacteria 1452
205 Ga0207660_10578991 3300025917 Bacteria 914
206 Ga0207660_10732647 3300025917 Bacteria 807
207 Ga0207662_10387338 3300025918 Bacteria 945
208 Ga0207657_10104676 3300025919 Bacteria 2344
209 Ga0207652_10009201 3300025921 Bacteria 7952
210 Ga0207652_10023142 3300025921 Bacteria 5145
211 Ga0207652_10711951 3300025921 Bacteria 895
212 Ga0207646_10000014 3300025922 Bacteria 345047
213 Ga0207646_10000043 3300025922 Bacteria 184713
214 Ga0207646_10000954 3300025922 Bacteria 37245
215 Ga0207646_10003799 3300025922 Bacteria 16802
216 Ga0207646_10004785 3300025922 Bacteria 14533
217 Ga0207646_10010635 3300025922 Bacteria 8961
218 Ga0207646_10026114 3300025922 Bacteria 5335
219 Ga0207646_10040605 3300025922 Bacteria 4183
220 Ga0207646_10079040 3300025922 Bacteria 2940
221 Ga0207646_10169065 3300025922 Bacteria 1974
222 Ga0207646_10236597 3300025922 Bacteria 1650
223 Ga0207646_10244581 3300025922 Bacteria 1621
224 Ga0207646_10280312 3300025922 Bacteria 1506
225 Ga0207646_10405389 3300025922 Bacteria 1231
226 Ga0207646_10438825 3300025922 Bacteria 1178
227 Ga0207681_10190096 3300025923 Bacteria 1570
228 Ga0207694_10010358 3300025924 Bacteria 7028
229 Ga0207687_10083882 3300025927 Bacteria 2308
230 Ga0207664_11227219 3300025929 Bacteria 668
231 Ga0207664_11689829 3300025929 Unclassified 555
232 Ga0207690_10003787 3300025932 Bacteria 8949
233 Ga0207686_10199151 3300025934 Bacteria 1433
234 Ga0207704_10340059 3300025938 Bacteria 1165
235 Ga0207711_11447210 3300025941 Bacteria 630
236 Ga0207689_10264451 3300025942 Bacteria 1423
237 Ga0207689_10383554 3300025942 Bacteria 1170
238 Ga0207661_10029530 3300025944 Bacteria 4213
239 Ga0207661_11063674 3300025944 Bacteria 745
240 Ga0207661_11377591 3300025944 Bacteria 647
241 Ga0207661_11477477 3300025944 Bacteria 623
242 Ga0207679_11642649 3300025945 Unclassified 588
243 Ga0207667_10003139 3300025949 Bacteria 20454
244 Ga0207651_10106243 3300025960 Bacteria 2096
245 Ga0207651_10440896 3300025960 Bacteria 1116
246 Ga0207677_10009942 3300026023 Bacteria 5366
247 Ga0207708_10067705 3300026075 Bacteria 2732
248 Ga0207702_10021015 3300026078 Bacteria 5402
249 Ga0207702_10068332 3300026078 Bacteria 3052
250 Ga0207641_10239095 3300026088 Bacteria 1691
251 Ga0207641_12195367 3300026088 Bacteria 552
252 Ga0207648_10000438 3300026089 Bacteria 46066
253 Ga0207648_10229042 3300026089 Bacteria 1653
254 Ga0207676_11434197 3300026095 Bacteria 687
255 Ga0207674_12222896 3300026116 Bacteria 511
256 Ga0207675_101271420 3300026118 Bacteria 756
257 Ga0207698_10002673 3300026142 Bacteria 10600
258 Ga0209984_1001938 3300027424 Bacteria 2283
259 Ga0209983_1043386 3300027665 Bacteria 976
260 Ga0209588_1048747 3300027671 Bacteria 1371
261 Ga0207428_10058150 3300027907 Bacteria 3069
262 Ga0207428_11098036 3300027907 Bacteria 556
263 Ga0268265_12626332 3300028380 Bacteria 509
264 Ga0268264_10640567 3300028381 Bacteria 1051
265 Ga0268264_11640066 3300028381 Bacteria 654
266 Ga0265334_10105331 3300028573 Bacteria 1017
267 Ga0265318_10098799 3300028577 Unclassified 1074
268 Ga0265336_10014006 3300028666 Bacteria 2664
269 Ga0265338_10012507 3300028800 Bacteria 9671
270 Ga0265338_10080732 3300028800 Bacteria 2731
271 Ga0265770_1046590 3300030878 Bacteria 773
272 Ga0265330_10000211 3300031235 Bacteria 45210
273 Ga0265330_10221931 3300031235 Bacteria 798
274 Ga0265332_10034873 3300031238 Bacteria 2187
275 Ga0265328_10001124 3300031239 Bacteria 12350
276 Ga0265320_10030709 3300031240 Bacteria 2767
277 Ga0265325_10000434 3300031241 Bacteria 30035
278 Ga0265325_10124906 3300031241 Bacteria 1237
279 Ga0265329_10021247 3300031242 Bacteria 2182
280 Ga0265340_10003970 3300031247 Bacteria 8320
281 Ga0265339_10000332 3300031249 Bacteria 38100
282 Ga0265339_10021602 3300031249 Bacteria 3741
283 Ga0265331_10024057 3300031250 Bacteria 3087
284 Ga0265316_10001755 3300031344 Bacteria 22947
285 Ga0265316_10538308 3300031344 Bacteria 832
286 Ga0265313_10002928 3300031595 Bacteria 14255
287 Ga0265314_10000033 3300031711 Bacteria 254594
288 Ga0265342_10000652 3300031712 Bacteria 36426
289 Ga0316576_10367472 3300031727 Bacteria 1069
290 Ga0316578_10790788 3300031728 Unclassified 550
291 Ga0373948_0023068 3300034817 Bacteria 1205
292 Ga0373940_0003892 3300035088 Bacteria 3102
293 Ga0373940_0043568 3300035088 Bacteria 1241
294 Ga0373949_0145196 3300035090 Bacteria 682
295 Ga0373932_0015243 3300035112 Bacteria 1946
296 Ga0373939_0195301 3300035114 Bacteria 762
297 Ga0373931_0020654 3300035691 Bacteria 3297
298 Ga0373935_0340298 3300035692 Bacteria 1068
299 Ga0373937_0586957 3300036401 Unclassified 1058
300 Ga0395905_0057000 3300037471 Bacteria 3654
301 Ga0436364_0187998 3300037853 Bacteria 737
302 Ga0439441_021201 3300042001 Bacteria 1197
303 Ga0439450_014567 3300042008 Bacteria 1596
304 Ga0439460_0197660 3300042461 Bacteria 684
305 Ga0451577_0616386 3300042876 Bacteria 984
306 Ga0466964_0190226 3300044706 Bacteria 979
307 Ga0453684_0268624 3300044712 Bacteria 1950
308 Ga0453684_1185913 3300044712 Bacteria 802
309 Ga0466971_0069421 3300044719 Bacteria 1599
310 Ga0466960_0003141 3300044901 Bacteria 6334
311 Ga0466958_0785119 3300045836 Bacteria 621
312 Ga0495580_0172760 3300046472 Bacteria 1493
313 Ga0495580_0196714 3300046472 Bacteria 1390
314 Ga0495584_0313376 3300046491 Bacteria 797
315 Ga0495594_0015915 3300046499 Bacteria 3957
316 Ga0495618_0782172 3300046514 Bacteria 557
317 Ga0495630_0842825 3300046517 Bacteria 699
318 Ga0495659_0284478 3300046664 Bacteria 696
319 Ga0495669_0040963 3300046684 Bacteria 2056
320 Ga0495684_0326950 3300047471 Bacteria 1095
321 Ga0496102_0788292 3300048905 Bacteria 873
322 Ga0496105_1012080 3300048908 Bacteria 621
323 Ga0496109_0452483 3300048912 Bacteria 1213
324 Ga0496110_0182789 3300048913 Bacteria 1904
325 Ga0496110_0769399 3300048913 Bacteria 867
326 Ga0496111_0745538 3300048914 Bacteria 711
327 Ga0496115_0168076 3300048918 Bacteria 1814
328 Ga0501040_1201075 3300049576 Bacteria 550
329 Ga0501041_0535710 3300049577 Bacteria 746
330 Ga0501046_0195944 3300049580 Bacteria 1505
331 Ga0501048_0216025 3300049582 Bacteria 1360
332 Ga0501048_0295173 3300049582 Bacteria 1153
333 Ga0501048_0875648 3300049582 Bacteria 646
334 Ga0501076_1647492 3300049592 Bacteria 526
335 Ga0501206_097594 3300049653 Bacteria 529
336 Ga0501221_253067 3300049704 Bacteria 507
337 Ga0501079_1300127 3300049741 Bacteria 573
338 Ga0501081_0417792 3300049743 Bacteria 994
339 Ga0501081_1514482 3300049743 Unclassified 510
340 Ga0501083_1116844 3300049744 Bacteria 513
341 Ga0501044_0052201 3300049823 Bacteria 4214
342 Ga0501045_0142628 3300049824 Bacteria 1782
343 nmdc:mga05p37_110773_c1 3300050507 Bacteria 3377
344 nmdc:mga05p37_1269391_c1 3300050507 Bacteria 754
345 nmdc:mga05p37_1330547_c1 3300050507 Bacteria 730
346 nmdc:mga05p37_17008_c1 3300050507 Bacteria 8771
347 nmdc:mga05p37_231715_c1 3300050507 Bacteria 2225
348 nmdc:mga05p37_24287_c1 3300050507 Bacteria 7365
349 nmdc:mga05p37_578405_c1 3300050507 Bacteria 1272
350 nmdc:mga05p37_61686_c1 3300050507 Bacteria 4615
351 nmdc:mga05p37_618773_c1 3300050507 Bacteria 1219
352 nmdc:mga05p37_823119_c1 3300050507 Bacteria 1012
353 nmdc:mga05p37_83288_c1 3300050507 Bacteria 3940
354 nmdc:mga05p37_84246_c1 3300050507 Bacteria 3917
355 nmdc:mga05p37_9539_c1 3300050507 Bacteria 11493
356 nmdc:mga09592_177787_c1 3300050508 Bacteria 1841
357 nmdc:mga09592_23477_c1 3300050508 Bacteria 5095
358 nmdc:mga0qj67_62642_c1 3300050509 Bacteria 2956
359 nmdc:mga06r32_16367_c1 3300050510 Bacteria 6757
360 nmdc:mga06r32_1751677_c1 3300050510 Bacteria 557
361 nmdc:mga06r32_428441_c1 3300050510 Bacteria 1304
362 nmdc:mga06r32_535569_c1 3300050510 Bacteria 1146
363 nmdc:mga08y16_261882_c1 3300050511 Bacteria 1786
364 nmdc:mga0n895_10800_c1 3300050512 Bacteria 8103
365 nmdc:mga0n895_1445160_c1 3300050512 Bacteria 655
366 nmdc:mga0n895_33927_c1 3300050512 Bacteria 4909
367 nmdc:mga0n895_7298_c1 3300050512 Bacteria 9473
368 nmdc:mga0rr50_1403104_c1 3300050513 Bacteria 591
369 nmdc:mga0rr50_7820_c1 3300050513 Bacteria 6628
370 nmdc:mga0rr50_95467_c1 3300050513 Bacteria 2324
371 nmdc:mga08x19_14531_c1 3300050514 Bacteria 4776
372 nmdc:mga08x19_38651_c1 3300050514 Bacteria 3031
373 nmdc:mga08x19_58681_c1 3300050514 Bacteria 2490
374 nmdc:mga0a205_225579_c1 3300050515 Bacteria 1758
375 nmdc:mga0a205_274647_c1 3300050515 Bacteria 1562
376 nmdc:mga0a205_572702_c1 3300050515 Bacteria 984
377 nmdc:mga0a205_61335_c1 3300050515 Bacteria 3632
378 Ga0466962_0244026 3300061719 Bacteria 882
379 Ga0530510_0213644 3300061734 Bacteria 1433
380 Ga0070658_10058938
381 MRS2a_Contig_15077
382 Ga0065714_10125665
383 Ga0070683_100243931
384 Ga0070683_100721279
385 Ga0070683_100863414
386 Ga0070683_102006357
387 Ga0070690_100450171
388 Ga0070680_100000021
389 Ga0068868_100007159
390 Ga0070660_100047711
391 Ga0070692_10138718
392 Ga0070692_10909616
393 Ga0070674_101529368
394 Ga0070673_100240451
395 Ga0070673_102215375
396 Ga0070659_100000509
397 Ga0070659_100190094
398 Ga0070659_100300188
399 Ga0070709_10608136
400 Ga0070714_100267949
401 Ga0070714_100460063
402 Ga0070714_101361934
403 Ga0070714_102428592
404 Ga0070705_100119254
405 Ga0070705_100493855
406 Ga0070694_100464735
407 Ga0070708_100001673
408 Ga0070708_100021166
409 Ga0070708_100046351
410 Ga0070708_100067437
411 Ga0070708_100152820
412 Ga0070708_100184787
413 Ga0070708_100284818
414 Ga0070708_100471764
415 Ga0070708_101121780
416 Ga0070708_101232267
417 Ga0070708_101245533
418 Ga0070708_101698281
419 Ga0070708_102170901
420 Ga0070681_10087331
421 Ga0070681_10104405
422 Ga0070681_10388365
423 Ga0068867_101629772
424 Ga0070706_100004311
425 Ga0070706_100005806
426 Ga0070706_100033608
427 Ga0070706_100126089
428 Ga0070706_100274108
429 Ga0070706_100473947
430 Ga0070706_100619168
431 Ga0070706_100647904
432 Ga0070706_101472270
433 Ga0070706_101705356
434 Ga0070707_100002788
435 Ga0070707_100004339
436 Ga0070707_100016158
437 Ga0070707_100016485
438 Ga0070707_100026868
439 Ga0070707_100042080
440 Ga0070707_100127260
441 Ga0070707_100131408
442 Ga0070707_100383061
443 Ga0070707_100473738
444 Ga0070707_100510709
445 Ga0070707_100570854
446 Ga0070707_100595788
447 Ga0070707_101416192
448 Ga0070698_100014362
449 Ga0070698_100025477
450 Ga0070698_100471527
451 Ga0070699_100014176
452 Ga0070699_100017341
453 Ga0070699_100060769
454 Ga0070699_100068318
455 Ga0070699_100206144
456 Ga0070699_100278697
457 Ga0070699_100774988
458 Ga0070699_101152609
459 Ga0070699_101994275
460 Ga0070679_100034588
461 Ga0070684_100476339
462 Ga0070684_100975197
463 Ga0070684_101019669
464 Ga0070697_100147384
465 Ga0070697_100353521
466 Ga0070697_100600271
467 Ga0070697_100709444
468 Ga0070697_101677037
469 Ga0070695_100859861
470 Ga0070693_100000296
471 Ga0070665_100396807
472 Ga0070704_100006743
473 Ga0068855_100014525
474 Ga0070664_101983967
475 Ga0068857_101752842
476 Ga0068857_102001484
477 Ga0068854_100778290
478 Ga0068856_100001093
479 Ga0068856_100005943
480 Ga0068856_100025967
481 Ga0068852_100011445
482 Ga0068863_100247369
483 Ga0068863_102416411
484 Ga0070717_10010237
485 Ga0070717_10818748
486 Ga0070717_11584848
487 Ga0075364_11146057
488 Ga0075432_10592919
489 Ga0070715_10091472
490 Ga0070712_100901561
491 Ga0097621_101498246
492 Ga0068871_100321760
493 Ga0075428_100009279
494 Ga0075428_100096325
495 Ga0075430_100001921
496 Ga0075431_100003150
497 Ga0075431_100150029
498 Ga0075431_102235253
499 Ga0075433_10039244
500 Ga0075433_10052046
501 Ga0075433_10112308
502 Ga0075434_100012440
503 Ga0075434_100061066
504 Ga0075434_100172748
505 Ga0075434_101880984
506 Ga0075429_100000784
507 Ga0075429_100021653
508 Ga0075429_100025483
509 Ga0075436_100015407
510 Ga0075436_100494095
511 Ga0097620_102060303
512 Ga0075435_100016549
513 Ga0075435_100017784
514 Ga0075435_100031014
515 Ga0099794_10001037
516 Ga0099794_10777858
517 Ga0105240_10135666
518 Ga0105240_10619570
519 Ga0111539_10024126
520 Ga0111539_12054913
521 Ga0105245_10040053
522 Ga0114129_10005243
523 Ga0114129_10012543
524 Ga0114129_10014289
525 Ga0114129_10064979
526 Ga0114129_10136392
527 Ga0114129_10276667
528 Ga0114129_10308775
529 Ga0114129_10380681
530 Ga0114129_10419933
531 Ga0114129_10463788
532 Ga0114129_10639630
533 Ga0114129_11212831
534 Ga0114129_11861438
535 Ga0105243_11211805
536 Ga0105241_12510792
537 Ga0105242_10447931
538 Ga0105248_11090219
539 Ga0105237_10047673
540 Ga0105238_10050341
541 Ga0105249_10191150
542 Ga0105249_13428114
543 Ga0105239_10465999
544 Ga0105239_13643979
545 Ga0105246_10049546
546 Ga0157373_10000631
547 Ga0157371_10020283
548 Ga0157370_10039216
549 Ga0157369_10001727
550 Ga0157369_10115348
551 Ga0157374_10023724
552 Ga0157374_10490051
553 Ga0157378_10236529
554 Ga0157372_10066951
555 Ga0157372_11617293
556 Ga0157375_11729061
557 Ga0163163_10147949
558 Ga0157380_10740987
559 Ga0157377_11051390
560 Ga0157379_10242110
561 Ga0157379_11779519
562 Ga0157379_12019592
563 Ga0197907_11017334
564 Ga0206350_10794262
565 Ga0207653_10165762
566 Ga0207688_10620047
567 Ga0207699_10201968
568 Ga0207705_10307152
569 Ga0207684_10013377
570 Ga0207684_10021939
571 Ga0207684_10031277
572 Ga0207684_10066628
573 Ga0207684_10095915
574 Ga0207684_10459917
575 Ga0207684_10672435
576 Ga0207707_10073349
577 Ga0207707_10267628
578 Ga0207707_10630052
579 Ga0207695_10024140
580 Ga0207671_10026881
581 Ga0207693_10450200
582 Ga0207660_10000239
583 Ga0207660_10231848
584 Ga0207660_10578991
585 Ga0207660_10732647
586 Ga0207662_10387338
587 Ga0207657_10104676
588 Ga0207652_10009201
589 Ga0207652_10023142
590 Ga0207652_10711951
591 Ga0207646_10000014
592 Ga0207646_10000043
593 Ga0207646_10000954
594 Ga0207646_10003799
595 Ga0207646_10004785
596 Ga0207646_10010635
597 Ga0207646_10026114
598 Ga0207646_10040605
599 Ga0207646_10079040
600 Ga0207646_10169065
601 Ga0207646_10236597
602 Ga0207646_10244581
603 Ga0207646_10280312
604 Ga0207646_10405389
605 Ga0207646_10438825
606 Ga0207681_10190096
607 Ga0207694_10010358
608 Ga0207687_10083882
609 Ga0207664_11227219
610 Ga0207664_11689829
611 Ga0207690_10003787
612 Ga0207686_10199151
613 Ga0207704_10340059
614 Ga0207711_11447210
615 Ga0207689_10264451
616 Ga0207689_10383554
617 Ga0207661_10029530
618 Ga0207661_11063674
619 Ga0207661_11377591
620 Ga0207661_11477477
621 Ga0207679_11642649
622 Ga0207667_10003139
623 Ga0207651_10106243
624 Ga0207651_10440896
625 Ga0207677_10009942
626 Ga0207708_10067705
627 Ga0207702_10021015
628 Ga0207702_10068332
629 Ga0207641_10239095
630 Ga0207641_12195367
631 Ga0207648_10000438
632 Ga0207648_10229042
633 Ga0207676_11434197
634 Ga0207674_12222896
635 Ga0207675_101271420
636 Ga0207698_10002673
637 Ga0209984_1001938
638 Ga0209983_1043386
639 Ga0209588_1048747
640 Ga0207428_10058150
641 Ga0207428_11098036
642 Ga0268265_12626332
643 Ga0268264_10640567
644 Ga0268264_11640066
645 Ga0265334_10105331
646 Ga0265318_10098799
647 Ga0265336_10014006
648 Ga0265338_10012507
649 Ga0265338_10080732
650 Ga0265770_1046590
651 Ga0265330_10000211
652 Ga0265330_10221931
653 Ga0265332_10034873
654 Ga0265328_10001124
655 Ga0265320_10030709
656 Ga0265325_10000434
657 Ga0265325_10124906
658 Ga0265329_10021247
659 Ga0265340_10003970
660 Ga0265339_10000332
661 Ga0265339_10021602
662 Ga0265331_10024057
663 Ga0265316_10001755
664 Ga0265316_10538308
665 Ga0265313_10002928
666 Ga0265314_10000033
667 Ga0265342_10000652
668 Ga0316576_10367472
669 Ga0316578_10790788
670 Ga0373948_0023068
671 Ga0373940_0003892
672 Ga0373940_0043568
673 Ga0373949_0145196
674 Ga0373932_0015243
675 Ga0373939_0195301
676 Ga0373931_0020654
677 Ga0373935_0340298
678 Ga0373937_0586957
679 Ga0395905_0057000
680 Ga0436364_0187998
681 Ga0439441_021201
682 Ga0439450_014567
683 Ga0439460_0197660
684 Ga0451577_0616386
685 Ga0466964_0190226
686 Ga0453684_0268624
687 Ga0453684_1185913
688 Ga0466971_0069421
689 Ga0466960_0003141
690 Ga0466958_0785119
691 Ga0495580_0172760
692 Ga0495580_0196714
693 Ga0495584_0313376
694 Ga0495594_0015915
695 Ga0495618_0782172
696 Ga0495630_0842825
697 Ga0495659_0284478
698 Ga0495669_0040963
699 Ga0495684_0326950
700 Ga0496102_0788292
701 Ga0496105_1012080
702 Ga0496109_0452483
703 Ga0496110_0182789
704 Ga0496110_0769399
705 Ga0496111_0745538
706 Ga0496115_0168076
707 Ga0501040_1201075
708 Ga0501041_0535710
709 Ga0501046_0195944
710 Ga0501048_0216025
711 Ga0501048_0295173
712 Ga0501048_0875648
713 Ga0501076_1647492
714 Ga0501206_097594
715 Ga0501221_253067
716 Ga0501079_1300127
717 Ga0501081_0417792
718 Ga0501081_1514482
719 Ga0501083_1116844
720 Ga0501044_0052201
721 Ga0501045_0142628
722 nmdc:mga05p37_110773_c1
723 nmdc:mga05p37_1269391_c1
724 nmdc:mga05p37_1330547_c1
725 nmdc:mga05p37_17008_c1
726 nmdc:mga05p37_231715_c1
727 nmdc:mga05p37_24287_c1
728 nmdc:mga05p37_578405_c1
729 nmdc:mga05p37_61686_c1
730 nmdc:mga05p37_618773_c1
731 nmdc:mga05p37_823119_c1
732 nmdc:mga05p37_83288_c1
733 nmdc:mga05p37_84246_c1
734 nmdc:mga05p37_9539_c1
735 nmdc:mga09592_177787_c1
736 nmdc:mga09592_23477_c1
737 nmdc:mga0qj67_62642_c1
738 nmdc:mga06r32_16367_c1
739 nmdc:mga06r32_1751677_c1
740 nmdc:mga06r32_428441_c1
741 nmdc:mga06r32_535569_c1
742 nmdc:mga08y16_261882_c1
743 nmdc:mga0n895_10800_c1
744 nmdc:mga0n895_1445160_c1
745 nmdc:mga0n895_33927_c1
746 nmdc:mga0n895_7298_c1
747 nmdc:mga0rr50_1403104_c1
748 nmdc:mga0rr50_7820_c1
749 nmdc:mga0rr50_95467_c1
750 nmdc:mga08x19_14531_c1
751 nmdc:mga08x19_38651_c1
752 nmdc:mga08x19_58681_c1
753 nmdc:mga0a205_225579_c1
754 nmdc:mga0a205_274647_c1
755 nmdc:mga0a205_572702_c1
756 nmdc:mga0a205_61335_c1
757 Ga0466962_0244026
758 Ga0530510_0213644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8362 1 99
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8279 1 99
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8224 4 96
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8023 2 92
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.7885 4 92
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8023 2 92 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7885 4 92 3.10.20.30
2m19A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7679 1 99 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7641 1 99 3.10.20.30
2qieD00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7617 3 99 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9985 3 48
AF-A0A536BAC8-F1-model_v4 MoaD/ThiS family protein 0.9962 3 51
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9812 3 86
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9792 2 95
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9777 3 68

Map