F428197

General Info

Members Datasets Scaffolds Average Seq Length
378 240 361 212

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2767802112|2768642697
Length 250
Sequence QRTTGLLACRDVAGDSGFQRARRPEQVRARREAIVRTARDMLADRPLADISLNELSARVGLAKSNVLRYFDSREAVFLEVLDRSWGAWLDELETAAAPAAGRDGRFAAETRTAGRVAASLVARPELCELISGMAGVLERNISVDFARHFKQRAAAHTERLARLVRREVPVLDDAGAAHFAGAVFVVVAGLWPYARPTEAIARVSAEMGAPPAWDAFVAGLAEGLVNQLVGLTARAAPPPGGQGSRGAFSP

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
9 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
10 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
11 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
12 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
13 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
14 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
15 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
16 2922554459 Rhodococcus sp. 66b Isolate Unclassified
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.32
Nodule 0
Rhizoplane 8.47
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004357 3300001977 Bacteria 2229
2 JGI24743J22301_10002382 3300001991 Bacteria 2822
3 JGI24750J21931_1015289 3300002070 Bacteria 1037
4 JGI24749J21850_1006914 3300002076 Bacteria 1577
5 JGI24744J21845_10000971 3300002077 Bacteria 5472
6 JGI24034J26672_10012800 3300002239 Bacteria 1268
7 JGI24751J29686_10007993 3300002459 Bacteria 2161
8 rootH2_10049868 3300003320 Bacteria 7573
9 rootH2_10075222 3300003320 Bacteria 7953
10 Ga0070690_100012235 3300005330 Bacteria 5046
11 Ga0068869_100064090 3300005334 Bacteria 2702
12 Ga0068869_100124248 3300005334 Bacteria 1977
13 Ga0070680_100254915 3300005336 Bacteria 1484
14 Ga0070680_100861521 3300005336 Bacteria 781
15 Ga0068868_100018647 3300005338 Bacteria 5192
16 Ga0070660_100361411 3300005339 Bacteria 1197
17 Ga0070660_100727541 3300005339 Bacteria 833
18 Ga0070689_100015362 3300005340 Bacteria 5582
19 Ga0070668_100000348 3300005347 Bacteria 30448
20 Ga0070668_100232330 3300005347 Bacteria 1525
21 Ga0070669_100054120 3300005353 Bacteria 2939
22 Ga0070675_100277572 3300005354 Bacteria 1472
23 Ga0070671_100005606 3300005355 Bacteria 9996
24 Ga0070671_100283228 3300005355 Bacteria 1410
25 Ga0070674_100009527 3300005356 Bacteria 5817
26 Ga0070674_100246067 3300005356 Bacteria 1402
27 Ga0070688_100753961 3300005365 Bacteria 758
28 Ga0070659_100016226 3300005366 Bacteria 5590
29 Ga0070667_100020791 3300005367 Bacteria 5452
30 Ga0070667_100021964 3300005367 Bacteria 5296
31 Ga0070667_100038125 3300005367 Bacteria 4029
32 Ga0070667_100140197 3300005367 Bacteria 2117
33 Ga0070667_100713365 3300005367 Bacteria 928
34 Ga0070709_10225737 3300005434 Bacteria 1338
35 Ga0070714_100073385 3300005435 Bacteria 2965
36 Ga0070714_100585016 3300005435 Bacteria 1071
37 Ga0070714_100617589 3300005435 Bacteria 1042
38 Ga0070710_10001789 3300005437 Bacteria 10167
39 Ga0070710_10125196 3300005437 Bacteria 1561
40 Ga0070701_10001136 3300005438 Bacteria 9723
41 Ga0070701_10351698 3300005438 Bacteria 921
42 Ga0070711_100004076 3300005439 Bacteria 8592
43 Ga0070711_100040460 3300005439 Bacteria 3144
44 Ga0070705_100009241 3300005440 Bacteria 4897
45 Ga0070700_100001216 3300005441 Bacteria 12767
46 Ga0070663_100008562 3300005455 Bacteria 6301
47 Ga0070663_100075598 3300005455 Bacteria 2462
48 Ga0070678_100012149 3300005456 Bacteria 5340
49 Ga0070662_100018703 3300005457 Bacteria 4691
50 Ga0070662_100020903 3300005457 Bacteria 4464
51 Ga0068867_100044557 3300005459 Bacteria 3250
52 Ga0068867_100803593 3300005459 Bacteria 839
53 Ga0070685_10077976 3300005466 Bacteria 1980
54 Ga0068853_100000449 3300005539 Bacteria 28008
55 Ga0070672_100261562 3300005543 Bacteria 1459
56 Ga0070695_100192332 3300005545 Bacteria 1453
57 Ga0070695_100195289 3300005545 Bacteria 1443
58 Ga0070696_100001384 3300005546 Bacteria 15855
59 Ga0070696_100073193 3300005546 Bacteria 2414
60 Ga0070693_100040978 3300005547 Bacteria 2603
61 Ga0070665_100126512 3300005548 Bacteria 2558
62 Ga0070665_100334447 3300005548 Bacteria 1519
63 Ga0070704_100002689 3300005549 Bacteria 10047
64 Ga0070704_100164609 3300005549 Bacteria 1757
65 Ga0068855_100316621 3300005563 Bacteria 1726
66 Ga0068854_100012014 3300005578 Bacteria 5659
67 Ga0068854_100211028 3300005578 Bacteria 1531
68 Ga0068856_100413916 3300005614 Bacteria 1368
69 Ga0070702_100003255 3300005615 Bacteria 7232
70 Ga0070702_100041451 3300005615 Bacteria 2582
71 Ga0070702_100651487 3300005615 Bacteria 796
72 Ga0068852_100293735 3300005616 Bacteria 1571
73 Ga0068859_100001264 3300005617 Bacteria 25832
74 Ga0068859_100382926 3300005617 Bacteria 1502
75 Ga0068859_101210755 3300005617 Bacteria 832
76 Ga0068864_100212747 3300005618 Bacteria 1781
77 Ga0068866_10000072 3300005718 Bacteria 40253
78 Ga0068866_10090449 3300005718 Bacteria 1665
79 Ga0068861_100001409 3300005719 Bacteria 15131
80 Ga0068861_100124458 3300005719 Bacteria 2084
81 Ga0068861_100359762 3300005719 Bacteria 1279
82 Ga0068851_10186168 3300005834 Bacteria 1152
83 Ga0068870_10136440 3300005840 Bacteria 1431
84 Ga0068863_100004901 3300005841 Bacteria 13187
85 Ga0068863_100146301 3300005841 Bacteria 2260
86 Ga0068858_100004935 3300005842 Bacteria 13073
87 Ga0068858_100473350 3300005842 Bacteria 1208
88 Ga0068860_100004949 3300005843 Bacteria 13579
89 Ga0068860_100370963 3300005843 Bacteria 1411
90 Ga0068862_100014447 3300005844 Bacteria 6551
91 Ga0068862_100041457 3300005844 Bacteria 3917
92 Ga0068862_100612741 3300005844 Bacteria 1046
93 Ga0068862_101011295 3300005844 Bacteria 823
94 Ga0081455_10122027 3300005937 Bacteria 2052
95 Ga0075365_10000659 3300006038 Bacteria 13789
96 Ga0075365_10039787 3300006038 Bacteria 3063
97 Ga0075365_10147478 3300006038 Bacteria 1636
98 Ga0075363_100001702 3300006048 Bacteria 8542
99 Ga0075363_100153541 3300006048 Bacteria 1300
100 Ga0075363_100221840 3300006048 Bacteria 1084
101 Ga0075364_10001283 3300006051 Bacteria 13531
102 Ga0075364_10009790 3300006051 Bacteria 5764
103 Ga0075364_10034739 3300006051 Bacteria 3255
104 Ga0070715_10002990 3300006163 Bacteria 5289
105 Ga0070716_100003899 3300006173 Bacteria 7082
106 Ga0070716_100026597 3300006173 Bacteria 3099
107 Ga0070716_100227537 3300006173 Bacteria 1257
108 Ga0070712_100000635 3300006175 Bacteria 20664
109 Ga0075362_10054827 3300006177 Bacteria 1793
110 Ga0075367_10034968 3300006178 Bacteria 2905
111 Ga0075367_10096731 3300006178 Bacteria 1801
112 Ga0075369_10044843 3300006186 Bacteria 1900
113 Ga0075369_10058645 3300006186 Bacteria 1676
114 Ga0075369_10067147 3300006186 Bacteria 1574
115 Ga0075370_10031293 3300006353 Bacteria 2970
116 Ga0068871_100152188 3300006358 Bacteria 1973
117 Ga0075428_100006613 3300006844 Bacteria 12895
118 Ga0075430_100094790 3300006846 Bacteria 2495
119 Ga0075430_100173839 3300006846 Bacteria 1792
120 Ga0075431_100092874 3300006847 Bacteria 3115
121 Ga0068865_100000590 3300006881 Bacteria 20356
122 Ga0068865_100047844 3300006881 Bacteria 2941
123 Ga0068865_100926860 3300006881 Bacteria 759
124 Ga0097620_100001264 3300006931 Bacteria 25832
125 Ga0097620_100382934 3300006931 Bacteria 1502
126 Ga0097620_101210786 3300006931 Bacteria 832
127 Ga0099795_10012694 3300007788 Bacteria 2562
128 Ga0105250_10156411 3300009092 Bacteria 950
129 Ga0111539_10551350 3300009094 Bacteria 1343
130 Ga0111539_10595486 3300009094 Bacteria 1287
131 Ga0111539_10990300 3300009094 Bacteria 977
132 Ga0105245_10000751 3300009098 Bacteria 29290
133 Ga0105245_10474836 3300009098 Bacteria 1263
134 Ga0105245_10540823 3300009098 Bacteria 1186
135 Ga0114129_10037990 3300009147 Bacteria 6792
136 Ga0105243_10003628 3300009148 Bacteria 12433
137 Ga0105243_10199094 3300009148 Bacteria 1755
138 Ga0105243_10443464 3300009148 Bacteria 1216
139 Ga0105241_10036574 3300009174 Bacteria 3695
140 Ga0105241_11001118 3300009174 Bacteria 782
141 Ga0105242_10005790 3300009176 Bacteria 9517
142 Ga0105242_10167784 3300009176 Bacteria 1927
143 Ga0105248_10041613 3300009177 Bacteria 5152
144 Ga0105237_10036467 3300009545 Bacteria 4976
145 Ga0105249_10000326 3300009553 Bacteria 48114
146 Ga0105249_10028071 3300009553 Bacteria 5080
147 Ga0105249_10205853 3300009553 Bacteria 1928
148 Ga0099796_10039125 3300010159 Bacteria 1595
149 Ga0105239_10006749 3300010375 Bacteria 13255
150 Ga0105246_10050839 3300011119 Bacteria 2844
151 Ga0157370_10340722 3300013104 Bacteria 1382
152 Ga0157374_10015891 3300013296 Bacteria 6612
153 Ga0157378_10033577 3300013297 Bacteria 4537
154 Ga0157378_10095073 3300013297 Bacteria 2714
155 Ga0163162_10692658 3300013306 Bacteria 1141
156 Ga0157372_10011182 3300013307 Bacteria 9545
157 Ga0157375_10000173 3300013308 Bacteria 59878
158 Ga0157375_10498010 3300013308 Bacteria 1383
159 Ga0163163_10145498 3300014325 Bacteria 2413
160 Ga0157380_10002314 3300014326 Bacteria 12797
161 Ga0157380_10121174 3300014326 Bacteria 2216
162 Ga0157379_10039176 3300014968 Bacteria 4228
163 Ga0157379_10681060 3300014968 Bacteria 964
164 Ga0157376_10094794 3300014969 Bacteria 2594
165 Ga0157376_10719542 3300014969 Bacteria 1005
166 Ga0163161_10008806 3300017792 Bacteria 6976
167 Ga0163161_10122963 3300017792 Bacteria 1951
168 Ga0209051_1033931 3300025303 Bacteria 1920
169 Ga0207692_10001670 3300025898 Bacteria 8384
170 Ga0207642_10015217 3300025899 Bacteria 2860
171 Ga0207688_10006334 3300025901 Bacteria 6440
172 Ga0207647_10018939 3300025904 Bacteria 4638
173 Ga0207685_10110782 3300025905 Bacteria 1189
174 Ga0207699_10212359 3300025906 Bacteria 1317
175 Ga0207643_10128181 3300025908 Bacteria 1508
176 Ga0207671_10187943 3300025914 Bacteria 1610
177 Ga0207693_10003031 3300025915 Bacteria 14519
178 Ga0207693_10043281 3300025915 Bacteria 3543
179 Ga0207693_10072674 3300025915 Bacteria 2693
180 Ga0207663_10005082 3300025916 Bacteria 6606
181 Ga0207660_10208569 3300025917 Bacteria 1529
182 Ga0207662_10097691 3300025918 Bacteria 1816
183 Ga0207657_10045924 3300025919 Bacteria 3829
184 Ga0207652_10677721 3300025921 Bacteria 921
185 Ga0207687_10001174 3300025927 Bacteria 17886
186 Ga0207700_10581420 3300025928 Bacteria 996
187 Ga0207664_10641434 3300025929 Bacteria 954
188 Ga0207644_10002286 3300025931 Bacteria 12435
189 Ga0207644_10688050 3300025931 Bacteria 852
190 Ga0207690_10008749 3300025932 Bacteria 6009
191 Ga0207706_10010288 3300025933 Bacteria 8554
192 Ga0207706_10099891 3300025933 Bacteria 2553
193 Ga0207686_10000642 3300025934 Bacteria 21566
194 Ga0207670_10009013 3300025936 Bacteria 5664
195 Ga0207669_10012212 3300025937 Bacteria 4216
196 Ga0207669_10153949 3300025937 Bacteria 1614
197 Ga0207704_10000222 3300025938 Bacteria 28514
198 Ga0207704_10283068 3300025938 Bacteria 1261
199 Ga0207665_10015175 3300025939 Bacteria 5059
200 Ga0207665_10023542 3300025939 Bacteria 4056
201 Ga0207665_10247789 3300025939 Bacteria 1315
202 Ga0207691_10266389 3300025940 Bacteria 1476
203 Ga0207691_10560554 3300025940 Bacteria 968
204 Ga0207711_10005435 3300025941 Bacteria 10772
205 Ga0207689_10020479 3300025942 Bacteria 5567
206 Ga0207689_10068261 3300025942 Bacteria 2922
207 Ga0207712_10003531 3300025961 Bacteria 9862
208 Ga0207712_10165782 3300025961 Bacteria 1722
209 Ga0207712_10224515 3300025961 Bacteria 1504
210 Ga0207668_10011485 3300025972 Bacteria 5383
211 Ga0207668_10213758 3300025972 Bacteria 1544
212 Ga0207668_10213924 3300025972 Bacteria 1543
213 Ga0207640_10002473 3300025981 Bacteria 9891
214 Ga0207640_10140934 3300025981 Bacteria 1757
215 Ga0207658_10003883 3300025986 Bacteria 10520
216 Ga0207658_10031637 3300025986 Bacteria 3759
217 Ga0207658_10038543 3300025986 Bacteria 3444
218 Ga0207658_10307789 3300025986 Bacteria 1367
219 Ga0207677_10002879 3300026023 Bacteria 9084
220 Ga0207677_10280119 3300026023 Bacteria 1368
221 Ga0207703_10002648 3300026035 Bacteria 15422
222 Ga0207703_10045486 3300026035 Bacteria 3531
223 Ga0207639_10021094 3300026041 Bacteria 4674
224 Ga0207678_10014512 3300026067 Bacteria 6928
225 Ga0207708_10002489 3300026075 Bacteria 13555
226 Ga0207708_10070061 3300026075 Bacteria 2685
227 Ga0207641_10003083 3300026088 Bacteria 15021
228 Ga0207648_10001712 3300026089 Bacteria 24009
229 Ga0207648_10022203 3300026089 Bacteria 5701
230 Ga0207676_10196078 3300026095 Bacteria 1781
231 Ga0207675_100000056 3300026118 Bacteria 82104
232 Ga0207675_100055506 3300026118 Bacteria 3695
233 Ga0207683_10000442 3300026121 Bacteria 38332
234 Ga0207683_10141980 3300026121 Bacteria 2164
235 Ga0207698_10134687 3300026142 Bacteria 2118
236 Ga0207698_10264928 3300026142 Bacteria 1581
237 Ga0209179_1020489 3300027512 Bacteria 1283
238 Ga0268266_10009992 3300028379 Bacteria 8332
239 Ga0268265_10010126 3300028380 Bacteria 6366
240 Ga0268265_10082510 3300028380 Bacteria 2542
241 Ga0268265_10616996 3300028380 Bacteria 1038
242 Ga0268264_10001736 3300028381 Bacteria 20028
243 Ga0307515_10017803 3300028794 Bacteria 12919
244 Ga0307513_10019544 3300031456 Bacteria 8064
245 Ga0307509_10082737 3300031507 Bacteria 3311
246 Ga0307508_10319360 3300031616 Bacteria 1145
247 Ga0316578_10067697 3300031728 Bacteria 2111
248 Ga0307518_10000526 3300031838 Bacteria 29189
249 Ga0307412_10167317 3300031911 Bacteria 1640
250 Ga0307409_100167034 3300031995 Bacteria 1932
251 Ga0307416_100080038 3300032002 Bacteria 2756
252 Ga0307414_10278338 3300032004 Bacteria 1405
253 Ga0373928_0011687 3300035084 Bacteria 1743
254 Ga0373956_0000258 3300035119 Bacteria 21190
255 Ga0373960_0026581 3300035121 Bacteria 1583
256 Ga0373931_0021335 3300035691 Bacteria 3249
257 Ga0373931_0091033 3300035691 Bacteria 1699
258 Ga0373947_0230768 3300035725 Bacteria 1219
259 Ga0395901_0225426 3300038443 Bacteria 1958
260 Ga0436363_1529203 3300039450 Bacteria 3445
261 Ga0439461_0010171 3300041410 Bacteria 1722
262 Ga0439461_0021824 3300041410 Bacteria 1278
263 Ga0439466_0017938 3300041411 Bacteria 2544
264 Ga0439466_0030202 3300041411 Bacteria 1860
265 Ga0439466_0038020 3300041411 Bacteria 1618
266 Ga0439465_0006014 3300041413 Bacteria 3857
267 Ga0439465_0034250 3300041413 Bacteria 1625
268 Ga0439465_0062031 3300041413 Bacteria 1240
269 Ga0439431_0004553 3300041997 Bacteria 3048
270 Ga0439431_0019190 3300041997 Bacteria 1623
271 Ga0439442_003878 3300042002 Bacteria 2964
272 Ga0439448_0108138 3300042005 Bacteria 949
273 Ga0439449_0023970 3300042007 Bacteria 2282
274 Ga0439463_082729 3300042016 Bacteria 826
275 Ga0439434_0006743 3300042435 Bacteria 3355
276 Ga0466960_0163128 3300044901 Bacteria 1198
277 Ga0495592_0552543 3300046454 Bacteria 708
278 Ga0495603_0048006 3300046455 Bacteria 2542
279 Ga0495629_0016878 3300046459 Bacteria 5240
280 Ga0495638_0045342 3300046460 Bacteria 2766
281 Ga0495580_0206632 3300046472 Bacteria 1352
282 Ga0495582_0009127 3300046473 Bacteria 5472
283 Ga0495639_0204675 3300046475 Bacteria 967
284 Ga0495662_0014988 3300046476 Bacteria 3766
285 Ga0495594_0055838 3300046499 Bacteria 2178
286 Ga0495630_0137497 3300046517 Bacteria 1857
287 Ga0495668_0019772 3300046616 Bacteria 3875
288 Ga0495658_0012483 3300046683 Bacteria 4306
289 Ga0495624_0053007 3300046690 Bacteria 2562
290 Ga0495581_0005482 3300047315 Bacteria 7346
291 Ga0495674_0025037 3300047319 Bacteria 5477
292 Ga0495672_0013294 3300047320 Bacteria 5687
293 Ga0495672_0072225 3300047320 Bacteria 1950
294 Ga0495672_0327783 3300047320 Bacteria 717
295 Ga0495593_0016158 3300047673 Bacteria 4213
296 Ga0496100_0272499 3300048903 Bacteria 1259
297 Ga0496100_0460128 3300048903 Bacteria 976
298 Ga0496101_0001249 3300048904 Bacteria 15209
299 Ga0496101_0348610 3300048904 Bacteria 1163
300 Ga0496101_0364643 3300048904 Bacteria 1136
301 Ga0496102_0000868 3300048905 Bacteria 28888
302 Ga0496102_0017509 3300048905 Bacteria 6275
303 Ga0496102_0078639 3300048905 Bacteria 3036
304 Ga0496102_0519248 3300048905 Bacteria 1113
305 Ga0496102_0967723 3300048905 Unclassified 772
306 Ga0496103_0001453 3300048906 Bacteria 15859
307 Ga0496103_0032534 3300048906 Bacteria 3183
308 Ga0496103_0275321 3300048906 Bacteria 1083
309 Ga0496104_0018629 3300048907 Bacteria 6337
310 Ga0496104_0451028 3300048907 Bacteria 1198
311 Ga0496105_0078941 3300048908 Bacteria 2718
312 Ga0496106_0000890 3300048909 Bacteria 21812
313 Ga0496106_0045303 3300048909 Bacteria 3303
314 Ga0496107_0000941 3300048910 Bacteria 17231
315 Ga0496108_0002139 3300048911 Bacteria 15829
316 Ga0496108_0277380 3300048911 Bacteria 1459
317 Ga0496108_0396061 3300048911 Bacteria 1206
318 Ga0496109_0010917 3300048912 Bacteria 7781
319 Ga0496110_0070642 3300048913 Bacteria 3094
320 Ga0496110_0159349 3300048913 Bacteria 2045
321 Ga0496111_0352101 3300048914 Bacteria 1090
322 Ga0496113_0216553 3300048916 Bacteria 1525
323 Ga0496113_0506571 3300048916 Bacteria 969
324 Ga0496114_0290087 3300048917 Bacteria 1443
325 Ga0496114_0422542 3300048917 Bacteria 1181
326 Ga0496115_0004845 3300048918 Bacteria 9768
327 Ga0496115_0328071 3300048918 Bacteria 1251
328 Ga0496125_0050296 3300048928 Bacteria 3452
329 Ga0496125_0202103 3300048928 Bacteria 1299
330 Ga0496125_0202114 3300048928 Bacteria 1299
331 Ga0496126_0027710 3300048929 Bacteria 5407
332 Ga0496126_0202666 3300048929 Bacteria 1675
333 Ga0501043_0188878 3300049579 Bacteria 1603
334 Ga0501069_0000021 3300049585 Bacteria 119210
335 Ga0501070_0000011 3300049586 Bacteria 191906
336 Ga0501074_0382235 3300049590 Unclassified 999
337 Ga0501080_0005618 3300049742 Bacteria 11208
338 Ga0501080_0463527 3300049742 Bacteria 1135
339 nmdc:mga03683_11607_c1 3300050489 Bacteria 3193
340 nmdc:mga03n38_132979_c1 3300050490 Bacteria 1235
341 nmdc:mga03n38_140307_c1 3300050490 Bacteria 1206
342 nmdc:mga03n38_25943_c1 3300050490 Bacteria 2414
343 nmdc:mga03n38_296343_c1 3300050490 Unclassified 867
344 nmdc:mga00v17_10579_c1 3300050491 Bacteria 5043
345 nmdc:mga00v17_1204_c1 3300050491 Bacteria 13566
346 nmdc:mga00v17_2428_c1 3300050491 Bacteria 9527
347 nmdc:mga0yw44_22548_c1 3300050492 Bacteria 3532
348 nmdc:mga0yw44_289046_c1 3300050492 Bacteria 1097
349 nmdc:mga0yw44_520973_c1 3300050492 Bacteria 807
350 nmdc:mga0yw44_52303_c1 3300050492 Bacteria 2475
351 nmdc:mga06z11_149767_c1 3300050494 Bacteria 1325
352 nmdc:mga06z11_59680_c1 3300050494 Bacteria 1983
353 nmdc:mga07m45_28370_c1 3300050496 Bacteria 3089
354 nmdc:mga07m45_41274_c1 3300050496 Bacteria 2583
355 nmdc:mga0qj67_159203_c1 3300050509 Bacteria 1833
356 nmdc:mga0sz30_31885_c1 3300050516 Bacteria 2183
357 nmdc:mga0sz30_52225_c1 3300050516 Bacteria 1735
358 nmdc:mga0sz30_85866_c1 3300050516 Bacteria 1365
359 Ga0500608_138593 3300053122 Bacteria 1082
360 Ga0500559_0122656 3300053136 Bacteria 1209
361 Ga0500645_000093 3300053730 Bacteria 69740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_100124458 Ga0068861_1001244582 189
2 3300026118 Ga0207675_100055506 Ga0207675_1000555062 189
3 3300049579 Ga0501043_0188878 Ga0501043_0188878_258_893 190
4 3300049585 Ga0501069_0000021 Ga0501069_0000021_103827_104558 191
5 3300049586 Ga0501070_0000011 Ga0501070_0000011_87230_87961 191
6 3300049590 Ga0501074_0382235 Ga0501074_0382235_68_799 191
7 3300049742 Ga0501080_0005618 Ga0501080_0005618_1723_2454 191
8 3300025303 Ga0209051_1033931 Ga0209051_10339312 194
9 3300005347 Ga0070668_100232330 Ga0070668_1002323301 196
10 3300005355 Ga0070671_100283228 Ga0070671_1002832282 197
11 3300005365 Ga0070688_100753961 Ga0070688_1007539611 197
12 3300005367 Ga0070667_100020791 Ga0070667_1000207915 197
13 3300005459 Ga0068867_100803593 Ga0068867_1008035931 197
14 3300005548 Ga0070665_100334447 Ga0070665_1003344472 197
15 3300005841 Ga0068863_100146301 Ga0068863_1001463012 197
16 3300005844 Ga0068862_101011295 Ga0068862_1010112951 197
17 3300006038 Ga0075365_10039787 Ga0075365_100397872 197
18 3300006048 Ga0075363_100221840 Ga0075363_1002218402 197
19 3300006051 Ga0075364_10009790 Ga0075364_100097905 197
20 3300006178 Ga0075367_10096731 Ga0075367_100967312 197
21 3300006186 Ga0075369_10058645 Ga0075369_100586452 197
22 3300006353 Ga0075370_10031293 Ga0075370_100312935 197
23 3300009092 Ga0105250_10156411 Ga0105250_101564111 197
24 3300009553 Ga0105249_10028071 Ga0105249_100280715 197
25 3300025931 Ga0207644_10688050 Ga0207644_106880502 197
26 3300025961 Ga0207712_10165782 Ga0207712_101657822 197
27 3300025972 Ga0207668_10213758 Ga0207668_102137582 197
28 3300025986 Ga0207658_10307789 Ga0207658_103077892 197
29 3300048907 Ga0496104_0451028 Ga0496104_0451028_258_851 197
30 3300048913 Ga0496110_0159349 Ga0496110_0159349_727_1320 197
31 3300048929 Ga0496126_0027710 Ga0496126_0027710_3589_4263 197
32 3300049742 Ga0501080_0463527 Ga0501080_0463527_53_646 197
33 3300050489 nmdc:mga03683_11607_c1 nmdc:mga03683_11607_c1_2233_2826 197
34 3300050490 nmdc:mga03n38_25943_c1 nmdc:mga03n38_25943_c1_1115_1708 197
35 3300050491 nmdc:mga00v17_10579_c1 nmdc:mga00v17_10579_c1_1835_2428 197
36 3300050492 nmdc:mga0yw44_22548_c1 nmdc:mga0yw44_22548_c1_331_1005 197
37 3300050494 nmdc:mga06z11_149767_c1 nmdc:mga06z11_149767_c1_91_684 197
38 3300050516 nmdc:mga0sz30_31885_c1 nmdc:mga0sz30_31885_c1_1170_1763 197
39 3300053122 Ga0500608_138593 Ga0500608_138593_170_844 197
40 3300053136 Ga0500559_0122656 Ga0500559_0122656_284_958 197
41 3300053730 Ga0500645_000093 Ga0500645_000093_40911_41585 197
42 3300046460 Ga0495638_0045342 Ga0495638_0045342_844_1518 198
43 3300003320 rootH2_10049868 rootH2_100498686 199
44 3300005367 Ga0070667_100021964 Ga0070667_1000219644 200
45 3300048928 Ga0496125_0050296 Ga0496125_0050296_1457_2131 202
46 3300050516 nmdc:mga0sz30_52225_c1 nmdc:mga0sz30_52225_c1_19_687 202
47 iso_pu_bacteria 2751185734 2753072856 202
48 iso_pu_bacteria 2870721527 2870727076 202
49 3300005578 Ga0068854_100211028 Ga0068854_1002110282 203
50 3300005615 Ga0070702_100041451 Ga0070702_1000414513 203
51 3300005834 Ga0068851_10186168 Ga0068851_101861682 203
52 3300006038 Ga0075365_10000659 Ga0075365_100006597 203
53 3300006048 Ga0075363_100001702 Ga0075363_1000017023 203
54 3300006051 Ga0075364_10001283 Ga0075364_100012838 203
55 3300006881 Ga0068865_100047844 Ga0068865_1000478444 203
56 3300025919 Ga0207657_10045924 Ga0207657_100459244 203
57 3300025933 Ga0207706_10099891 Ga0207706_100998913 203
58 3300025981 Ga0207640_10140934 Ga0207640_101409342 203
59 3300026075 Ga0207708_10070061 Ga0207708_100700615 203
60 3300041997 Ga0439431_0019190 Ga0439431_0019190_1002_1613 203
61 3300047320 Ga0495672_0072225 Ga0495672_0072225_1208_1819 203
62 3300050494 nmdc:mga06z11_59680_c1 nmdc:mga06z11_59680_c1_56_667 203
63 3300050496 nmdc:mga07m45_41274_c1 nmdc:mga07m45_41274_c1_1336_1947 203
64 3300005339 Ga0070660_100361411 Ga0070660_1003614112 204
65 iso_pu_bacteria 2791354901 2791915344 204
66 3300003320 rootH2_10075222 rootH2_100752225 205
67 3300031456 Ga0307513_10019544 Ga0307513_100195444 205
68 3300031838 Ga0307518_10000526 Ga0307518_1000052626 205
69 iso_pu_bacteria 2585427649 2586063903 205
70 iso_pu_bacteria 2767802112 2768642697 205
71 3300005435 Ga0070714_100073385 Ga0070714_1000733853 207
72 3300031507 Ga0307509_10082737 Ga0307509_100827373 207
73 3300031616 Ga0307508_10319360 Ga0307508_103193602 207
74 3300044901 Ga0466960_0163128 Ga0466960_0163128_84_746 207
75 3300048918 Ga0496115_0328071 Ga0496115_0328071_509_1135 207
76 iso_pu_bacteria 2643221572 2643875847 207
77 iso_pu_bacteria 2643221669 2644382902 207
78 iso_pu_bacteria 2895660088 2895663640 207
79 3300042007 Ga0439449_0023970 Ga0439449_0023970_484_1206 208
80 3300047320 Ga0495672_0013294 Ga0495672_0013294_4450_5205 209
81 3300006048 Ga0075363_100153541 Ga0075363_1001535412 210
82 3300009148 Ga0105243_10443464 Ga0105243_104434642 210
83 3300028794 Ga0307515_10017803 Ga0307515_100178035 210
84 3300031911 Ga0307412_10167317 Ga0307412_101673172 210
85 3300031995 Ga0307409_100167034 Ga0307409_1001670342 210
86 3300032002 Ga0307416_100080038 Ga0307416_1000800381 210
87 3300032004 Ga0307414_10278338 Ga0307414_102783382 210
88 3300046616 Ga0495668_0019772 Ga0495668_0019772_1732_2418 210
89 3300048911 Ga0496108_0396061 Ga0496108_0396061_247_933 210
90 3300048928 Ga0496125_0202103 Ga0496125_0202103_249_935 210
91 3300048928 Ga0496125_0202114 Ga0496125_0202114_249_935 210
92 3300050496 nmdc:mga07m45_28370_c1 nmdc:mga07m45_28370_c1_94_780 210
93 iso_pu_bacteria 2565956761 2566994324 210
94 iso_pu_bacteria 2738541308 2738888880 210
95 iso_pu_bacteria 2808606522 2809586850 210
96 iso_pu_bacteria 2904535858 2904537450 210
97 iso_pu_bacteria 2915768154 2915775587 210
98 iso_pu_bacteria 2922554459 2922558926 210
99 iso_pu_bacteria 8047710418 8047714339 210
100 3300001977 JGI24746J21847_1004357 JGI24746J21847_10043573 211
101 3300001991 JGI24743J22301_10002382 JGI24743J22301_100023822 211
102 3300002070 JGI24750J21931_1015289 JGI24750J21931_10152892 211
103 3300002076 JGI24749J21850_1006914 JGI24749J21850_10069142 211
104 3300002077 JGI24744J21845_10000971 JGI24744J21845_100009712 211
105 3300002239 JGI24034J26672_10012800 JGI24034J26672_100128002 211
106 3300002459 JGI24751J29686_10007993 JGI24751J29686_100079932 211
107 3300005330 Ga0070690_100012235 Ga0070690_1000122356 211
108 3300005334 Ga0068869_100064090 Ga0068869_1000640903 211
109 3300005334 Ga0068869_100124248 Ga0068869_1001242483 211
110 3300005336 Ga0070680_100254915 Ga0070680_1002549152 211
111 3300005336 Ga0070680_100861521 Ga0070680_1008615211 211
112 3300005338 Ga0068868_100018647 Ga0068868_1000186474 211
113 3300005339 Ga0070660_100727541 Ga0070660_1007275411 211
114 3300005340 Ga0070689_100015362 Ga0070689_1000153626 211
115 3300005347 Ga0070668_100000348 Ga0070668_10000034828 211
116 3300005353 Ga0070669_100054120 Ga0070669_1000541203 211
117 3300005354 Ga0070675_100277572 Ga0070675_1002775722 211
118 3300005355 Ga0070671_100005606 Ga0070671_1000056066 211
119 3300005356 Ga0070674_100009527 Ga0070674_1000095271 211
120 3300005356 Ga0070674_100246067 Ga0070674_1002460672 211
121 3300005366 Ga0070659_100016226 Ga0070659_1000162265 211
122 3300005367 Ga0070667_100038125 Ga0070667_1000381254 211
123 3300005367 Ga0070667_100140197 Ga0070667_1001401974 211
124 3300005367 Ga0070667_100713365 Ga0070667_1007133652 211
125 3300005434 Ga0070709_10225737 Ga0070709_102257372 211
126 3300005435 Ga0070714_100585016 Ga0070714_1005850161 211
127 3300005435 Ga0070714_100617589 Ga0070714_1006175892 211
128 3300005437 Ga0070710_10001789 Ga0070710_100017895 211
129 3300005437 Ga0070710_10125196 Ga0070710_101251961 211
130 3300005438 Ga0070701_10001136 Ga0070701_100011366 211
131 3300005438 Ga0070701_10351698 Ga0070701_103516981 211
132 3300005439 Ga0070711_100004076 Ga0070711_1000040764 211
133 3300005439 Ga0070711_100040460 Ga0070711_1000404602 211
134 3300005440 Ga0070705_100009241 Ga0070705_1000092413 211
135 3300005441 Ga0070700_100001216 Ga0070700_1000012163 211
136 3300005455 Ga0070663_100008562 Ga0070663_1000085626 211
137 3300005455 Ga0070663_100075598 Ga0070663_1000755983 211
138 3300005456 Ga0070678_100012149 Ga0070678_1000121495 211
139 3300005457 Ga0070662_100018703 Ga0070662_1000187034 211
140 3300005457 Ga0070662_100020903 Ga0070662_1000209033 211
141 3300005459 Ga0068867_100044557 Ga0068867_1000445573 211
142 3300005466 Ga0070685_10077976 Ga0070685_100779762 211
143 3300005539 Ga0068853_100000449 Ga0068853_1000004494 211
144 3300005543 Ga0070672_100261562 Ga0070672_1002615622 211
145 3300005545 Ga0070695_100192332 Ga0070695_1001923321 211
146 3300005545 Ga0070695_100195289 Ga0070695_1001952892 211
147 3300005546 Ga0070696_100001384 Ga0070696_10000138412 211
148 3300005546 Ga0070696_100073193 Ga0070696_1000731933 211
149 3300005547 Ga0070693_100040978 Ga0070693_1000409783 211
150 3300005548 Ga0070665_100126512 Ga0070665_1001265124 211
151 3300005549 Ga0070704_100002689 Ga0070704_1000026896 211
152 3300005549 Ga0070704_100164609 Ga0070704_1001646092 211
153 3300005563 Ga0068855_100316621 Ga0068855_1003166211 211
154 3300005578 Ga0068854_100012014 Ga0068854_1000120145 211
155 3300005614 Ga0068856_100413916 Ga0068856_1004139162 211
156 3300005615 Ga0070702_100003255 Ga0070702_1000032554 211
157 3300005615 Ga0070702_100651487 Ga0070702_1006514871 211
158 3300005616 Ga0068852_100293735 Ga0068852_1002937352 211
159 3300005617 Ga0068859_100001264 Ga0068859_10000126422 211
160 3300005617 Ga0068859_100382926 Ga0068859_1003829262 211
161 3300005617 Ga0068859_101210755 Ga0068859_1012107551 211
162 3300005618 Ga0068864_100212747 Ga0068864_1002127472 211
163 3300005718 Ga0068866_10000072 Ga0068866_1000007219 211
164 3300005718 Ga0068866_10090449 Ga0068866_100904492 211
165 3300005719 Ga0068861_100001409 Ga0068861_10000140916 211
166 3300005719 Ga0068861_100359762 Ga0068861_1003597622 211
167 3300005840 Ga0068870_10136440 Ga0068870_101364402 211
168 3300005841 Ga0068863_100004901 Ga0068863_1000049013 211
169 3300005842 Ga0068858_100004935 Ga0068858_10000493513 211
170 3300005842 Ga0068858_100473350 Ga0068858_1004733502 211
171 3300005843 Ga0068860_100004949 Ga0068860_1000049494 211
172 3300005843 Ga0068860_100370963 Ga0068860_1003709632 211
173 3300005844 Ga0068862_100014447 Ga0068862_1000144473 211
174 3300005844 Ga0068862_100041457 Ga0068862_1000414574 211
175 3300005844 Ga0068862_100612741 Ga0068862_1006127412 211
176 3300005937 Ga0081455_10122027 Ga0081455_101220272 211
177 3300006038 Ga0075365_10147478 Ga0075365_101474782 211
178 3300006051 Ga0075364_10034739 Ga0075364_100347394 211
179 3300006163 Ga0070715_10002990 Ga0070715_100029901 211
180 3300006173 Ga0070716_100003899 Ga0070716_1000038996 211
181 3300006173 Ga0070716_100026597 Ga0070716_1000265974 211
182 3300006173 Ga0070716_100227537 Ga0070716_1002275372 211
183 3300006175 Ga0070712_100000635 Ga0070712_10000063519 211
184 3300006177 Ga0075362_10054827 Ga0075362_100548272 211
185 3300006178 Ga0075367_10034968 Ga0075367_100349684 211
186 3300006186 Ga0075369_10044843 Ga0075369_100448433 211
187 3300006186 Ga0075369_10067147 Ga0075369_100671471 211
188 3300006358 Ga0068871_100152188 Ga0068871_1001521882 211
189 3300006844 Ga0075428_100006613 Ga0075428_1000066139 211
190 3300006846 Ga0075430_100094790 Ga0075430_1000947902 211
191 3300006846 Ga0075430_100173839 Ga0075430_1001738393 211
192 3300006847 Ga0075431_100092874 Ga0075431_1000928744 211
193 3300006881 Ga0068865_100000590 Ga0068865_1000005905 211
194 3300006881 Ga0068865_100926860 Ga0068865_1009268601 211
195 3300006931 Ga0097620_100001264 Ga0097620_10000126422 211
196 3300006931 Ga0097620_100382934 Ga0097620_1003829342 211
197 3300006931 Ga0097620_101210786 Ga0097620_1012107861 211
198 3300007788 Ga0099795_10012694 Ga0099795_100126942 211
199 3300009094 Ga0111539_10551350 Ga0111539_105513502 211
200 3300009094 Ga0111539_10595486 Ga0111539_105954862 211
201 3300009094 Ga0111539_10990300 Ga0111539_109903001 211
202 3300009098 Ga0105245_10000751 Ga0105245_100007513 211
203 3300009098 Ga0105245_10474836 Ga0105245_104748362 211
204 3300009098 Ga0105245_10540823 Ga0105245_105408231 211
205 3300009147 Ga0114129_10037990 Ga0114129_100379907 211
206 3300009148 Ga0105243_10003628 Ga0105243_1000362815 211
207 3300009148 Ga0105243_10199094 Ga0105243_101990941 211
208 3300009174 Ga0105241_10036574 Ga0105241_100365743 211
209 3300009174 Ga0105241_11001118 Ga0105241_110011181 211
210 3300009176 Ga0105242_10005790 Ga0105242_100057902 211
211 3300009176 Ga0105242_10167784 Ga0105242_101677843 211
212 3300009177 Ga0105248_10041613 Ga0105248_100416135 211
213 3300009545 Ga0105237_10036467 Ga0105237_100364673 211
214 3300009553 Ga0105249_10000326 Ga0105249_1000032622 211
215 3300009553 Ga0105249_10205853 Ga0105249_102058532 211
216 3300010159 Ga0099796_10039125 Ga0099796_100391252 211
217 3300010375 Ga0105239_10006749 Ga0105239_100067492 211
218 3300011119 Ga0105246_10050839 Ga0105246_100508393 211
219 3300013104 Ga0157370_10340722 Ga0157370_103407222 211
220 3300013296 Ga0157374_10015891 Ga0157374_100158915 211
221 3300013297 Ga0157378_10033577 Ga0157378_100335771 211
222 3300013297 Ga0157378_10095073 Ga0157378_100950734 211
223 3300013306 Ga0163162_10692658 Ga0163162_106926581 211
224 3300013307 Ga0157372_10011182 Ga0157372_100111827 211
225 3300013308 Ga0157375_10000173 Ga0157375_1000017330 211
226 3300013308 Ga0157375_10498010 Ga0157375_104980102 211
227 3300014325 Ga0163163_10145498 Ga0163163_101454982 211
228 3300014326 Ga0157380_10002314 Ga0157380_100023142 211
229 3300014326 Ga0157380_10121174 Ga0157380_101211742 211
230 3300014968 Ga0157379_10039176 Ga0157379_100391765 211
231 3300014968 Ga0157379_10681060 Ga0157379_106810602 211
232 3300014969 Ga0157376_10094794 Ga0157376_100947942 211
233 3300014969 Ga0157376_10719542 Ga0157376_107195422 211
234 3300017792 Ga0163161_10008806 Ga0163161_100088068 211
235 3300017792 Ga0163161_10122963 Ga0163161_101229633 211
236 3300025898 Ga0207692_10001670 Ga0207692_100016706 211
237 3300025899 Ga0207642_10015217 Ga0207642_100152173 211
238 3300025901 Ga0207688_10006334 Ga0207688_100063345 211
239 3300025904 Ga0207647_10018939 Ga0207647_100189394 211
240 3300025905 Ga0207685_10110782 Ga0207685_101107822 211
241 3300025906 Ga0207699_10212359 Ga0207699_102123591 211
242 3300025908 Ga0207643_10128181 Ga0207643_101281812 211
243 3300025914 Ga0207671_10187943 Ga0207671_101879432 211
244 3300025915 Ga0207693_10003031 Ga0207693_100030311 211
245 3300025915 Ga0207693_10043281 Ga0207693_100432814 211
246 3300025915 Ga0207693_10072674 Ga0207693_100726741 211
247 3300025916 Ga0207663_10005082 Ga0207663_100050824 211
248 3300025917 Ga0207660_10208569 Ga0207660_102085692 211
249 3300025918 Ga0207662_10097691 Ga0207662_100976912 211
250 3300025921 Ga0207652_10677721 Ga0207652_106777211 211
251 3300025927 Ga0207687_10001174 Ga0207687_1000117418 211
252 3300025928 Ga0207700_10581420 Ga0207700_105814201 211
253 3300025929 Ga0207664_10641434 Ga0207664_106414342 211
254 3300025931 Ga0207644_10002286 Ga0207644_1000228610 211
255 3300025932 Ga0207690_10008749 Ga0207690_100087493 211
256 3300025933 Ga0207706_10010288 Ga0207706_100102887 211
257 3300025934 Ga0207686_10000642 Ga0207686_1000064212 211
258 3300025936 Ga0207670_10009013 Ga0207670_100090134 211
259 3300025937 Ga0207669_10012212 Ga0207669_100122125 211
260 3300025937 Ga0207669_10153949 Ga0207669_101539492 211
261 3300025938 Ga0207704_10000222 Ga0207704_1000022230 211
262 3300025938 Ga0207704_10283068 Ga0207704_102830682 211
263 3300025939 Ga0207665_10015175 Ga0207665_100151752 211
264 3300025939 Ga0207665_10023542 Ga0207665_100235424 211
265 3300025939 Ga0207665_10247789 Ga0207665_102477892 211
266 3300025940 Ga0207691_10266389 Ga0207691_102663892 211
267 3300025940 Ga0207691_10560554 Ga0207691_105605542 211
268 3300025941 Ga0207711_10005435 Ga0207711_100054355 211
269 3300025942 Ga0207689_10020479 Ga0207689_100204794 211
270 3300025942 Ga0207689_10068261 Ga0207689_100682612 211
271 3300025961 Ga0207712_10003531 Ga0207712_100035315 211
272 3300025961 Ga0207712_10224515 Ga0207712_102245152 211
273 3300025972 Ga0207668_10011485 Ga0207668_100114854 211
274 3300025972 Ga0207668_10213924 Ga0207668_102139241 211
275 3300025981 Ga0207640_10002473 Ga0207640_1000247312 211
276 3300025986 Ga0207658_10003883 Ga0207658_1000388313 211
277 3300025986 Ga0207658_10031637 Ga0207658_100316374 211
278 3300025986 Ga0207658_10038543 Ga0207658_100385434 211
279 3300026023 Ga0207677_10002879 Ga0207677_100028796 211
280 3300026023 Ga0207677_10280119 Ga0207677_102801192 211
281 3300026035 Ga0207703_10002648 Ga0207703_1000264814 211
282 3300026035 Ga0207703_10045486 Ga0207703_100454864 211
283 3300026041 Ga0207639_10021094 Ga0207639_100210943 211
284 3300026067 Ga0207678_10014512 Ga0207678_100145126 211
285 3300026075 Ga0207708_10002489 Ga0207708_100024893 211
286 3300026088 Ga0207641_10003083 Ga0207641_100030835 211
287 3300026089 Ga0207648_10001712 Ga0207648_1000171221 211
288 3300026089 Ga0207648_10022203 Ga0207648_100222035 211
289 3300026095 Ga0207676_10196078 Ga0207676_101960782 211
290 3300026118 Ga0207675_100000056 Ga0207675_10000005629 211
291 3300026121 Ga0207683_10000442 Ga0207683_1000044229 211
292 3300026121 Ga0207683_10141980 Ga0207683_101419802 211
293 3300026142 Ga0207698_10134687 Ga0207698_101346872 211
294 3300026142 Ga0207698_10264928 Ga0207698_102649282 211
295 3300027512 Ga0209179_1020489 Ga0209179_10204892 211
296 3300028379 Ga0268266_10009992 Ga0268266_1000999210 211
297 3300028380 Ga0268265_10010126 Ga0268265_100101262 211
298 3300028380 Ga0268265_10082510 Ga0268265_100825103 211
299 3300028380 Ga0268265_10616996 Ga0268265_106169961 211
300 3300028381 Ga0268264_10001736 Ga0268264_1000173623 211
301 3300031728 Ga0316578_10067697 Ga0316578_100676972 211
302 3300035084 Ga0373928_0011687 Ga0373928_0011687_792_1460 211
303 3300035119 Ga0373956_0000258 Ga0373956_0000258_1754_2524 211
304 3300035121 Ga0373960_0026581 Ga0373960_0026581_184_822 211
305 3300035691 Ga0373931_0021335 Ga0373931_0021335_1291_1959 211
306 3300035691 Ga0373931_0091033 Ga0373931_0091033_481_1119 211
307 3300035725 Ga0373947_0230768 Ga0373947_0230768_268_906 211
308 3300038443 Ga0395901_0225426 Ga0395901_0225426_392_1027 211
309 3300039450 Ga0436363_1529203 Ga0436363_1529203_35_718 211
310 3300041410 Ga0439461_0010171 Ga0439461_0010171_32_667 211
311 3300041410 Ga0439461_0021824 Ga0439461_0021824_270_905 211
312 3300041411 Ga0439466_0017938 Ga0439466_0017938_246_914 211
313 3300041411 Ga0439466_0030202 Ga0439466_0030202_574_1209 211
314 3300041411 Ga0439466_0038020 Ga0439466_0038020_103_738 211
315 3300041413 Ga0439465_0006014 Ga0439465_0006014_2928_3596 211
316 3300041413 Ga0439465_0034250 Ga0439465_0034250_323_958 211
317 3300041413 Ga0439465_0062031 Ga0439465_0062031_75_710 211
318 3300041997 Ga0439431_0004553 Ga0439431_0004553_1714_2349 211
319 3300042002 Ga0439442_003878 Ga0439442_003878_1504_2139 211
320 3300042005 Ga0439448_0108138 Ga0439448_0108138_184_819 211
321 3300042016 Ga0439463_082729 Ga0439463_082729_41_715 211
322 3300042435 Ga0439434_0006743 Ga0439434_0006743_2025_2660 211
323 3300046454 Ga0495592_0552543 Ga0495592_0552543_59_697 211
324 3300046455 Ga0495603_0048006 Ga0495603_0048006_1543_2181 211
325 3300046459 Ga0495629_0016878 Ga0495629_0016878_2177_2815 211
326 3300046472 Ga0495580_0206632 Ga0495580_0206632_109_747 211
327 3300046473 Ga0495582_0009127 Ga0495582_0009127_2865_3503 211
328 3300046475 Ga0495639_0204675 Ga0495639_0204675_104_742 211
329 3300046476 Ga0495662_0014988 Ga0495662_0014988_2651_3289 211
330 3300046499 Ga0495594_0055838 Ga0495594_0055838_412_1050 211
331 3300046517 Ga0495630_0137497 Ga0495630_0137497_818_1456 211
332 3300046683 Ga0495658_0012483 Ga0495658_0012483_2508_3146 211
333 3300046690 Ga0495624_0053007 Ga0495624_0053007_1029_1667 211
334 3300047315 Ga0495581_0005482 Ga0495581_0005482_4191_4829 211
335 3300047319 Ga0495674_0025037 Ga0495674_0025037_1739_2377 211
336 3300047320 Ga0495672_0327783 Ga0495672_0327783_13_648 211
337 3300047673 Ga0495593_0016158 Ga0495593_0016158_1838_2476 211
338 3300048903 Ga0496100_0272499 Ga0496100_0272499_537_1172 211
339 3300048903 Ga0496100_0460128 Ga0496100_0460128_263_901 211
340 3300048904 Ga0496101_0001249 Ga0496101_0001249_7947_8615 211
341 3300048904 Ga0496101_0348610 Ga0496101_0348610_201_836 211
342 3300048904 Ga0496101_0364643 Ga0496101_0364643_64_702 211
343 3300048905 Ga0496102_0000868 Ga0496102_0000868_22788_23456 211
344 3300048905 Ga0496102_0017509 Ga0496102_0017509_1640_2275 211
345 3300048905 Ga0496102_0078639 Ga0496102_0078639_1064_1702 211
346 3300048905 Ga0496102_0519248 Ga0496102_0519248_200_868 211
347 3300048905 Ga0496102_0967723 Ga0496102_0967723_85_720 211
348 3300048906 Ga0496103_0001453 Ga0496103_0001453_4394_5062 211
349 3300048906 Ga0496103_0032534 Ga0496103_0032534_1928_2563 211
350 3300048906 Ga0496103_0275321 Ga0496103_0275321_33_668 211
351 3300048907 Ga0496104_0018629 Ga0496104_0018629_2938_3573 211
352 3300048908 Ga0496105_0078941 Ga0496105_0078941_1897_2565 211
353 3300048909 Ga0496106_0000890 Ga0496106_0000890_5435_6103 211
354 3300048909 Ga0496106_0045303 Ga0496106_0045303_674_1312 211
355 3300048910 Ga0496107_0000941 Ga0496107_0000941_1102_1770 211
356 3300048911 Ga0496108_0002139 Ga0496108_0002139_7295_7963 211
357 3300048911 Ga0496108_0277380 Ga0496108_0277380_677_1345 211
358 3300048912 Ga0496109_0010917 Ga0496109_0010917_604_1272 211
359 3300048913 Ga0496110_0070642 Ga0496110_0070642_2298_2933 211
360 3300048914 Ga0496111_0352101 Ga0496111_0352101_24_692 211
361 3300048916 Ga0496113_0216553 Ga0496113_0216553_546_1214 211
362 3300048916 Ga0496113_0506571 Ga0496113_0506571_31_666 211
363 3300048917 Ga0496114_0290087 Ga0496114_0290087_636_1304 211
364 3300048917 Ga0496114_0422542 Ga0496114_0422542_414_1049 211
365 3300048918 Ga0496115_0004845 Ga0496115_0004845_5450_6118 211
366 3300048929 Ga0496126_0202666 Ga0496126_0202666_52_744 211
367 3300050490 nmdc:mga03n38_132979_c1 nmdc:mga03n38_132979_c1_559_1194 211
368 3300050490 nmdc:mga03n38_140307_c1 nmdc:mga03n38_140307_c1_326_961 211
369 3300050490 nmdc:mga03n38_296343_c1 nmdc:mga03n38_296343_c1_45_680 211
370 3300050491 nmdc:mga00v17_1204_c1 nmdc:mga00v17_1204_c1_12870_13505 211
371 3300050491 nmdc:mga00v17_2428_c1 nmdc:mga00v17_2428_c1_3184_3819 211
372 3300050492 nmdc:mga0yw44_289046_c1 nmdc:mga0yw44_289046_c1_223_858 211
373 3300050492 nmdc:mga0yw44_520973_c1 nmdc:mga0yw44_520973_c1_143_778 211
374 3300050492 nmdc:mga0yw44_52303_c1 nmdc:mga0yw44_52303_c1_1766_2401 211
375 3300050509 nmdc:mga0qj67_159203_c1 nmdc:mga0qj67_159203_c1_224_859 211
376 3300050516 nmdc:mga0sz30_85866_c1 nmdc:mga0sz30_85866_c1_278_913 211
377 iso_pu_bacteria 2738541274 2738703764 211
378 iso_pu_bacteria 2738543028 2739330653 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

34

80

0.97

PF17929

TetR_C_34

Tetracyclin repressor-like, C-terminal domain

111

233

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zcx-assembly1.cif.gz_A-2 crystal structure of tetr family transcriptional regulator sco7815 0.8776 2 207
2zcx-assembly1.cif.gz_A-2 crystal structure of tetr family transcriptional regulator sco7815 0.8573 2 207
3bti-assembly1.cif.gz_B crystal structure of qacr(e58q) bound to berberine 0.7364 5 205
2g0e-assembly1.cif.gz_A structure of qacr multidrug transcriptional regulator bound to trivalent and bivalent diamidine drugs 0.7318 5 205
1qvu-assembly2.cif.gz_D crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine 0.7279 5 205
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9523 5 50 1.10.10.60
3qplA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9195 4 46 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9156 3 54 1.10.10.60
3o8gA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9147 4 46 1.10.10.60
1jtyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9142 5 50 1.10.10.60
ID Description Score Start End GO Terms
AF-G8RLU0-F1-model_v4 Transcriptional regulator 0.9987 1 211 GO:0003677
GO:0006355
AF-A0A419HEQ5-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9695 8 205 GO:0000976
GO:0003700
AF-A0A4Y6IV13-F1-model_v4 deleted 0.9647 16 210
AF-A0A1C4QPA5-F1-model_v4 Transcriptional regulator, TetR family 0.9562 2 175 GO:0003677
GO:0006355
AF-A0A163L947-F1-model_v4 HTH tetR-type domain-containing protein 0.9557 16 208 GO:0003677

Feature Viewer

pLDDT pTM Quality
96.13 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map