F428123

General Info

Members Datasets Scaffolds Average Seq Length
378 245 377 150

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000842|Ga0495606_0000842_13705_14265
Length 170
Sequence VEGPPSQTAVAHGEDLRRSHAQARSRRDPPRNATTYPAPFDEPVAGRWQRRLGATAGLTELGANHVTLKPGAWSSQRHWHHGEDELVVMLAGEAVLIEDNGETILRPGDVATFPKGDPNGHHLVNRSDADCVFIAVSAGSLQGGEYSDIDMKWGDQGYVRKDGTPYPRKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
225 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
226 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
244 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
245 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.07
Nodule 0
Rhizoplane 3.7
Rhizosphere 64.29
Stem 0
Stem Tuber 0
Unclassified 7.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
2 ARcpr5oldR_c002297 3300000041 Bacteria 1781
3 ARcpr5yngRDRAFT_c004220 3300000043 Bacteria 1366
4 ARCol0yngRDRAFT_1006320 3300000652 Bacteria 850
5 JGI24741J21665_1004813 3300001915 Bacteria 2926
6 JGI24740J21852_10008796 3300001979 Bacteria 4004
7 JGI24739J22299_10012988 3300001989 Bacteria 3048
8 JGI24739J22299_10014314 3300001989 Bacteria 2887
9 JGI24739J22299_10058021 3300001989 Bacteria 1230
10 JGI24737J22298_10013475 3300001990 Bacteria 2660
11 JGI24737J22298_10016926 3300001990 Bacteria 2351
12 JGI24735J21928_10015638 3300002067 Bacteria 2363
13 JGI24738J21930_10005044 3300002075 Bacteria 3191
14 JGI24738J21930_10023496 3300002075 Bacteria 1270
15 JGI25150J39212_1000082 3300002774 Bacteria 56551
16 JGI25151J46595_10057252 3300003187 Bacteria 1272
17 JGI25165J46597_1000007 3300003214 Bacteria 518996
18 JGI25153J46596_10000016 3300003215 Bacteria 285917
19 JGI25153J46596_10000029 3300003215 Bacteria 201658
20 JGI25153J46596_10017950 3300003215 Bacteria 2767
21 rootH1_10088922 3300003316 Bacteria 2140
22 rootH2_10187369 3300003320 Bacteria 1308
23 Ga0055525_1000035 3300003759 Bacteria 300887
24 Ga0055542_1000060 3300003762 Bacteria 162275
25 Ga0055529_1000043 3300003763 Bacteria 221704
26 Ga0055526_1000928 3300003771 Bacteria 21765
27 Ga0055537_1002601 3300003773 Bacteria 5913
28 Ga0055524_1000410 3300003775 Bacteria 36259
29 Ga0055536_1045368 3300003781 Bacteria 1006
30 Ga0055528_1029850 3300003790 Bacteria 1462
31 Ga0055530_10000409 3300003791 Bacteria 38215
32 Ga0055530_10009351 3300003791 Bacteria 3779
33 Ga0055530_10014843 3300003791 Bacteria 2573
34 Ga0055530_10025769 3300003791 Bacteria 1636
35 Ga0055540_1001389 3300003792 Bacteria 14446
36 Ga0055531_10000009 3300003794 Bacteria 210399
37 Ga0055531_10009180 3300003794 Bacteria 5093
38 Ga0055531_10020832 3300003794 Bacteria 2573
39 Ga0055531_10020834 3300003794 Bacteria 2573
40 Ga0055543_1015977 3300004625 Bacteria 1435
41 Ga0065165_1010402 3300005262 Bacteria 4027
42 Ga0065714_10073504 3300005288 Bacteria 3175
43 Ga0065704_10070205 3300005289 Bacteria 83747
44 Ga0070658_10000907 3300005327 Bacteria 25371
45 Ga0070658_10213360 3300005327 Bacteria 1631
46 Ga0070676_10018009 3300005328 Bacteria 3912
47 Ga0070683_101442903 3300005329 Bacteria 661
48 Ga0068869_100464046 3300005334 Bacteria 1052
49 Ga0070666_10621366 3300005335 Bacteria 789
50 Ga0070660_100003826 3300005339 Bacteria 10392
51 Ga0070661_100056569 3300005344 Bacteria 2874
52 Ga0070661_100205937 3300005344 Bacteria 1504
53 Ga0070661_100460335 3300005344 Unclassified 1013
54 Ga0070668_100143255 3300005347 Bacteria 1927
55 Ga0070674_100050788 3300005356 Bacteria 2855
56 Ga0070659_100005817 3300005366 Bacteria 8881
57 Ga0070659_100295947 3300005366 Bacteria 1348
58 Ga0070663_100212188 3300005455 Bacteria 1516
59 Ga0070678_100818549 3300005456 Bacteria 847
60 Ga0070662_100094789 3300005457 Unclassified 2248
61 Ga0070662_101739468 3300005457 Bacteria 538
62 Ga0068853_100052029 3300005539 Bacteria 3527
63 Ga0068853_100099827 3300005539 Bacteria 2565
64 Ga0068853_100217798 3300005539 Bacteria 1742
65 Ga0068853_100887831 3300005539 Bacteria 856
66 Ga0068855_100007634 3300005563 Bacteria 13081
67 Ga0068855_100493007 3300005563 Bacteria 1332
68 Ga0068855_100987916 3300005563 Bacteria 885
69 Ga0068857_100074852 3300005577 Bacteria 3018
70 Ga0068859_100007204 3300005617 Bacteria 11288
71 Ga0068864_100000114 3300005618 Bacteria 79636
72 Ga0068861_100000002 3300005719 Bacteria 111914
73 Ga0068861_100753266 3300005719 Bacteria 910
74 Ga0068858_100001075 3300005842 Bacteria 28274
75 Ga0068858_100005210 3300005842 Bacteria 12740
76 Ga0075369_10028590 3300006186 Bacteria 2337
77 Ga0075366_10074928 3300006195 Bacteria 2018
78 Ga0097621_101299016 3300006237 Bacteria 687
79 Ga0097620_100007204 3300006931 Bacteria 11288
80 Ga0105245_10008872 3300009098 Bacteria 8773
81 Ga0105243_10033182 3300009148 Bacteria 3991
82 Ga0105241_10002313 3300009174 Bacteria 14316
83 Ga0105241_10160144 3300009174 Bacteria 1849
84 Ga0105242_11158497 3300009176 Bacteria 790
85 Ga0105242_11697780 3300009176 Bacteria 668
86 Ga0105248_10001984 3300009177 Bacteria 22750
87 Ga0105248_10008563 3300009177 Bacteria 11231
88 Ga0105237_10121789 3300009545 Bacteria 2603
89 Ga0105237_11208629 3300009545 Bacteria 762
90 Ga0105238_10119246 3300009551 Bacteria 2619
91 Ga0105239_10584497 3300010375 Bacteria 1273
92 Ga0105239_10967415 3300010375 Bacteria 978
93 Ga0105239_11541610 3300010375 Bacteria 768
94 Ga0157326_1002620 3300012513 Bacteria 1916
95 Ga0157373_10059548 3300013100 Bacteria 2706
96 Ga0157373_10770417 3300013100 Bacteria 708
97 Ga0157373_10887521 3300013100 Bacteria 661
98 Ga0157371_10000030 3300013102 Bacteria 241585
99 Ga0157371_10269202 3300013102 Bacteria 1229
100 Ga0157370_10187163 3300013104 Bacteria 1922
101 Ga0157370_10863584 3300013104 Bacteria 822
102 Ga0157369_10057290 3300013105 Bacteria 4204
103 Ga0157369_10382158 3300013105 Bacteria 1461
104 Ga0157369_11495179 3300013105 Bacteria 687
105 Ga0157374_10296629 3300013296 Bacteria 1599
106 Ga0157378_10183168 3300013297 Bacteria 1971
107 Ga0157378_10192996 3300013297 Bacteria 1922
108 Ga0163162_10084113 3300013306 Bacteria 3257
109 Ga0157372_10050955 3300013307 Bacteria 4605
110 Ga0157372_10263543 3300013307 Bacteria 2001
111 Ga0157375_10302187 3300013308 Bacteria 1764
112 Ga0163163_10237802 3300014325 Bacteria 1871
113 Ga0157379_10030325 3300014968 Bacteria 4813
114 Ga0213876_10119132 3300021384 Bacteria 1401
115 Ga0209436_121415 3300025208 Bacteria 852
116 Ga0209563_100047 3300025230 Bacteria 366620
117 Ga0209437_104362 3300025233 Bacteria 2499
118 Ga0207425_1000020 3300025245 Bacteria 372623
119 Ga0207425_1003186 3300025245 Bacteria 5361
120 Ga0209026_1010492 3300025250 Bacteria 1725
121 Ga0209148_1000017 3300025254 Bacteria 787064
122 Ga0209129_1004746 3300025258 Bacteria 5152
123 Ga0209233_1000026 3300025261 Bacteria 678466
124 Ga0209233_1019983 3300025261 Bacteria 1766
125 Ga0209565_1000008 3300025263 Bacteria 774179
126 Ga0209565_1000054 3300025263 Bacteria 206016
127 Ga0209455_1000005 3300025272 Bacteria 1416756
128 Ga0209673_1003183 3300025273 Bacteria 9987
129 Ga0209673_1009422 3300025273 Bacteria 4232
130 Ga0209675_1008916 3300025291 Bacteria 3606
131 Ga0209676_1005389 3300025292 Bacteria 6708
132 Ga0209025_1000383 3300025294 Bacteria 91739
133 Ga0209564_1000565 3300025295 Bacteria 58712
134 Ga0209564_1005001 3300025295 Bacteria 7788
135 Ga0209758_1000004 3300025297 Bacteria 1375322
136 Ga0209758_1000035 3300025297 Bacteria 448190
137 Ga0209758_1009937 3300025297 Bacteria 5797
138 Ga0209050_1000001 3300025298 Bacteria 3563507
139 Ga0209050_1000014 3300025298 Bacteria 774327
140 Ga0209050_1003988 3300025298 Bacteria 10410
141 Ga0209050_1013286 3300025298 Bacteria 3672
142 Ga0209050_1098291 3300025298 Bacteria 584
143 Ga0209256_1000009 3300025299 Bacteria 922071
144 Ga0209256_1000010 3300025299 Bacteria 912110
145 Ga0209051_1000951 3300025303 Bacteria 28407
146 Ga0209257_1000019 3300025304 Bacteria 774261
147 Ga0209257_1000857 3300025304 Bacteria 43371
148 Ga0209257_1003106 3300025304 Bacteria 14875
149 Ga0209257_1003122 3300025304 Bacteria 14804
150 Ga0207656_10016845 3300025321 Bacteria 2851
151 Ga0207647_10000756 3300025904 Bacteria 25295
152 Ga0207647_10004780 3300025904 Bacteria 10029
153 Ga0207647_10012219 3300025904 Bacteria 5985
154 Ga0207647_10021489 3300025904 Bacteria 4307
155 Ga0207645_10093177 3300025907 Bacteria 1938
156 Ga0207705_10000935 3300025909 Bacteria 23840
157 Ga0207654_10003076 3300025911 Bacteria 8455
158 Ga0207695_10010168 3300025913 Bacteria 11544
159 Ga0207671_10006483 3300025914 Bacteria 10418
160 Ga0207671_10126053 3300025914 Bacteria 1961
161 Ga0207657_10004792 3300025919 Bacteria 14277
162 Ga0207649_10002100 3300025920 Bacteria 11311
163 Ga0207649_10100904 3300025920 Bacteria 1910
164 Ga0207694_10060281 3300025924 Bacteria 2953
165 Ga0207694_10091737 3300025924 Bacteria 2397
166 Ga0207687_10003101 3300025927 Bacteria 11269
167 Ga0207690_10001091 3300025932 Bacteria 17308
168 Ga0207706_10010431 3300025933 Bacteria 8489
169 Ga0207706_10019650 3300025933 Bacteria 6077
170 Ga0207706_10029402 3300025933 Bacteria 4904
171 Ga0207709_10164388 3300025935 Bacteria 1551
172 Ga0207711_10002937 3300025941 Bacteria 14903
173 Ga0207689_10236012 3300025942 Bacteria 1511
174 Ga0207661_11307472 3300025944 Bacteria 666
175 Ga0207667_10000004 3300025949 Bacteria 737718
176 Ga0207667_10001173 3300025949 Bacteria 32921
177 Ga0207667_10103577 3300025949 Bacteria 2935
178 Ga0207651_11004156 3300025960 Bacteria 746
179 Ga0207668_10361684 3300025972 Bacteria 1216
180 Ga0207640_10004843 3300025981 Bacteria 7308
181 Ga0207703_10000483 3300026035 Bacteria 41615
182 Ga0207639_10001587 3300026041 Bacteria 15264
183 Ga0207639_10078953 3300026041 Bacteria 2600
184 Ga0207639_10311635 3300026041 Bacteria 1394
185 Ga0207678_10001729 3300026067 Bacteria 20004
186 Ga0207702_10006632 3300026078 Bacteria 9954
187 Ga0207641_10874294 3300026088 Bacteria 892
188 Ga0207676_10000497 3300026095 Bacteria 33127
189 Ga0207676_10912946 3300026095 Bacteria 862
190 Ga0207674_10007643 3300026116 Bacteria 12590
191 Ga0207674_10008995 3300026116 Bacteria 11476
192 Ga0207675_100000021 3300026118 Bacteria 116776
193 Ga0207675_100878196 3300026118 Bacteria 912
194 Ga0207683_10397961 3300026121 Bacteria 1267
195 Ga0207683_10821510 3300026121 Bacteria 863
196 Ga0207698_10038725 3300026142 Bacteria 3525
197 Ga0307517_10031155 3300028786 Bacteria 6220
198 Ga0307513_10101842 3300031456 Bacteria 2893
199 Ga0307513_10156085 3300031456 Bacteria 2182
200 Ga0307408_100008447 3300031548 Bacteria 6798
201 Ga0307508_10003330 3300031616 Bacteria 16325
202 Ga0307405_10079155 3300031731 Bacteria 2141
203 Ga0307413_10308041 3300031824 Bacteria 1204
204 Ga0307410_10778401 3300031852 Bacteria 812
205 Ga0307406_10140557 3300031901 Bacteria 1708
206 Ga0307412_10061973 3300031911 Bacteria 2516
207 Ga0307416_100100541 3300032002 Bacteria 2515
208 Ga0307411_10826423 3300032005 Bacteria 818
209 Ga0307510_10010951 3300033180 Bacteria 10776
210 Ga0307510_10056702 3300033180 Bacteria 4075
211 Ga0373931_0235810 3300035691 Bacteria 1107
212 Ga0395900_0067686 3300037418 Bacteria 3669
213 Ga0395905_0049183 3300037471 Bacteria 3951
214 Ga0395905_0178313 3300037471 Bacteria 1995
215 Ga0395901_0015609 3300038443 Bacteria 7737
216 Ga0395901_0068444 3300038443 Bacteria 3698
217 Ga0436365_0233461 3300039437 Bacteria 2628
218 Ga0439466_0048255 3300041411 Bacteria 1401
219 Ga0439465_0000307 3300041413 Bacteria 13850
220 Ga0439465_0027312 3300041413 Bacteria 1807
221 Ga0451855_0583587 3300041511 Bacteria 608
222 Ga0439431_0000110 3300041997 Bacteria 14082
223 Ga0439442_000466 3300042002 Bacteria 9242
224 Ga0439445_0002873 3300042004 Bacteria 3845
225 Ga0439448_0000954 3300042005 Bacteria 7133
226 Ga0439448_0002340 3300042005 Bacteria 5139
227 Ga0439432_000148 3300042006 Bacteria 23778
228 Ga0439455_0000505 3300042012 Bacteria 5435
229 Ga0439455_0007049 3300042012 Bacteria 2363
230 Ga0439462_0001478 3300042015 Bacteria 5241
231 Ga0439458_0001013 3300042157 Bacteria 7188
232 Ga0439458_0002218 3300042157 Bacteria 4792
233 Ga0439434_0018953 3300042435 Bacteria 2062
234 Ga0466972_0007202 3300044658 Bacteria 5585
235 Ga0466966_0333585 3300044684 Bacteria 911
236 Ga0466964_0012046 3300044706 Bacteria 3271
237 Ga0466960_0015172 3300044901 Bacteria 3317
238 Ga0495627_112719 3300046453 Bacteria 771
239 Ga0495650_0000174 3300046471 Bacteria 142519
240 Ga0495650_0015304 3300046471 Bacteria 3940
241 Ga0495639_0177013 3300046475 Bacteria 1037
242 Ga0495584_0190221 3300046491 Bacteria 1043
243 Ga0495585_0005725 3300046492 Bacteria 7797
244 Ga0495585_0115100 3300046492 Bacteria 1427
245 Ga0495585_0142317 3300046492 Unclassified 1255
246 Ga0495596_0014780 3300046500 Bacteria 3284
247 Ga0495583_0000271 3300046506 Bacteria 85085
248 Ga0495583_0007539 3300046506 Bacteria 6809
249 Ga0495583_0044404 3300046506 Bacteria 2062
250 Ga0495583_0099672 3300046506 Bacteria 1241
251 Ga0495606_0000842 3300046507 Bacteria 46207
252 Ga0495606_0096046 3300046507 Bacteria 1813
253 Ga0495606_0101731 3300046507 Bacteria 1748
254 Ga0495606_0380191 3300046507 Bacteria 741
255 Ga0495616_0112340 3300046513 Bacteria 1265
256 Ga0495631_0055949 3300046518 Bacteria 1718
257 Ga0495631_0425731 3300046518 Bacteria 565
258 Ga0495637_0006072 3300046520 Bacteria 6101
259 Ga0495637_0278379 3300046520 Bacteria 597
260 Ga0495643_0005860 3300046522 Bacteria 8218
261 Ga0495643_0011003 3300046522 Bacteria 5535
262 Ga0495643_0012143 3300046522 Bacteria 5205
263 Ga0495643_0203386 3300046522 Bacteria 949
264 Ga0495648_0000115 3300046524 Bacteria 98656
265 Ga0495648_0022212 3300046524 Bacteria 4373
266 Ga0495648_0175690 3300046524 Bacteria 1093
267 Ga0495648_0427690 3300046524 Bacteria 585
268 Ga0495663_0012045 3300046525 Bacteria 2410
269 Ga0495642_0011572 3300046528 Bacteria 3393
270 Ga0495652_0758692 3300046529 Bacteria 649
271 Ga0495609_0132392 3300046538 Bacteria 1067
272 Ga0495597_0009706 3300046542 Bacteria 4742
273 Ga0495622_0020295 3300046557 Bacteria 3094
274 Ga0495633_0000735 3300046558 Bacteria 29673
275 Ga0495633_0072861 3300046558 Bacteria 1601
276 Ga0495668_0000007 3300046616 Bacteria 552902
277 Ga0495611_0015800 3300046648 Bacteria 3226
278 Ga0495611_0095712 3300046648 Bacteria 1374
279 Ga0495611_0283878 3300046648 Bacteria 764
280 Ga0495625_0000619 3300046660 Bacteria 51579
281 Ga0495625_0006713 3300046660 Bacteria 10202
282 Ga0495625_0012080 3300046660 Bacteria 7007
283 Ga0495625_0058006 3300046660 Bacteria 2751
284 Ga0495625_0197032 3300046660 Bacteria 1331
285 Ga0495625_0290605 3300046660 Bacteria 1049
286 Ga0495625_0304713 3300046660 Bacteria 1018
287 Ga0495661_0336757 3300046665 Bacteria 746
288 Ga0495669_0000027 3300046684 Bacteria 109260
289 Ga0495670_0005175 3300046691 Bacteria 6418
290 Ga0495670_0141983 3300046691 Bacteria 1256
291 Ga0495671_0105264 3300046692 Bacteria 1378
292 Ga0495649_0094659 3300046694 Bacteria 1590
293 Ga0495649_0294351 3300046694 Bacteria 827
294 Ga0495600_0005999 3300046809 Bacteria 7355
295 Ga0495660_0061274 3300046810 Bacteria 2019
296 Ga0495672_0115587 3300047320 Bacteria 1434
297 Ga0495683_0004584 3300047323 Bacteria 7805
298 Ga0495683_0019245 3300047323 Bacteria 3524
299 Ga0495687_000044 3300047443 Bacteria 215400
300 Ga0495687_000055 3300047443 Bacteria 194477
301 Ga0495677_0003026 3300047445 Bacteria 6539
302 Ga0495677_0019221 3300047445 Bacteria 2478
303 Ga0495679_103696 3300047446 Bacteria 788
304 Ga0495673_0035795 3300047469 Bacteria 2284
305 Ga0495681_0003121 3300047470 Bacteria 11626
306 Ga0495681_0201570 3300047470 Bacteria 807
307 Ga0495686_0001904 3300047472 Bacteria 20835
308 Ga0495686_0004412 3300047472 Bacteria 11590
309 Ga0495686_0037824 3300047472 Bacteria 3090
310 Ga0496100_0297562 3300048903 Bacteria 1207
311 Ga0496100_1190383 3300048903 Bacteria 601
312 Ga0496102_0000188 3300048905 Bacteria 83919
313 Ga0496102_0299642 3300048905 Bacteria 1515
314 Ga0496103_0000426 3300048906 Bacteria 36650
315 Ga0496105_0000605 3300048908 Bacteria 23957
316 Ga0496107_0037187 3300048910 Bacteria 3493
317 Ga0496110_0043527 3300048913 Bacteria 3920
318 Ga0496111_0007646 3300048914 Bacteria 7103
319 Ga0496111_0437498 3300048914 Bacteria 965
320 Ga0496112_0225175 3300048915 Bacteria 1831
321 Ga0496113_0236865 3300048916 Bacteria 1456
322 Ga0496114_0007402 3300048917 Bacteria 8676
323 Ga0496115_0000018 3300048918 Bacteria 182523
324 Ga0496116_0032322 3300048919 Bacteria 3731
325 Ga0496116_0415230 3300048919 Bacteria 590
326 Ga0496117_0000499 3300048920 Bacteria 64797
327 Ga0496118_0000399 3300048921 Bacteria 73329
328 Ga0496119_0007238 3300048922 Bacteria 10046
329 Ga0496120_0043335 3300048923 Bacteria 2622
330 Ga0496121_0000104 3300048924 Bacteria 192186
331 Ga0496121_0000263 3300048924 Bacteria 109553
332 Ga0496121_0315174 3300048924 Bacteria 1055
333 Ga0496122_0001352 3300048925 Bacteria 39977
334 Ga0496122_0009646 3300048925 Bacteria 10106
335 Ga0496123_0000465 3300048926 Bacteria 70986
336 Ga0496123_0024186 3300048926 Bacteria 4624
337 Ga0496124_0000099 3300048927 Bacteria 182007
338 Ga0496124_0008038 3300048927 Bacteria 11091
339 Ga0496124_0279507 3300048927 Bacteria 1218
340 Ga0496125_0000529 3300048928 Bacteria 65769
341 Ga0496126_0000707 3300048929 Bacteria 60949
342 Ga0501033_0315381 3300049570 Bacteria 1099
343 Ga0501225_0294074 3300049705 Bacteria 548
344 Ga0501080_0759770 3300049742 Bacteria 852
345 Ga0501241_015178 3300049758 Bacteria 1400
346 Ga0501241_047909 3300049758 Bacteria 839
347 Ga0501267_002168 3300049764 Bacteria 1744
348 Ga0500610_0000486 3300053079 Bacteria 12218
349 Ga0500643_000195 3300053087 Bacteria 57960
350 Ga0500643_001414 3300053087 Bacteria 13869
351 Ga0500643_003094 3300053087 Bacteria 8169
352 Ga0500643_010784 3300053087 Bacteria 3378
353 Ga0500643_042990 3300053087 Bacteria 1319
354 Ga0500583_0066583 3300053092 Bacteria 1714
355 Ga0500566_0000420 3300053094 Bacteria 23637
356 Ga0500641_0004830 3300053096 Bacteria 4772
357 Ga0500641_0023428 3300053096 Bacteria 2374
358 Ga0500556_0022780 3300053104 Bacteria 2038
359 Ga0500595_000183 3300053119 Bacteria 42685
360 Ga0500595_000375 3300053119 Bacteria 28868
361 Ga0500618_093618 3300053125 Bacteria 675
362 Ga0500642_0000195 3300053130 Bacteria 24912
363 Ga0500559_0050450 3300053136 Bacteria 1836
364 Ga0500568_0052701 3300053139 Bacteria 1596
365 Ga0500568_0092645 3300053139 Bacteria 1139
366 Ga0500577_0017456 3300053142 Bacteria 2286
367 Ga0500604_0002410 3300053151 Bacteria 5106
368 Ga0500604_0059482 3300053151 Bacteria 1197
369 Ga0500616_0008700 3300053153 Bacteria 6267
370 Ga0500616_0071306 3300053153 Bacteria 1770
371 Ga0500624_000057 3300053157 Bacteria 71174
372 Ga0500636_0011252 3300053177 Bacteria 5234
373 Ga0500636_0177661 3300053177 Bacteria 1146
374 Ga0500645_000009 3300053730 Bacteria 206177
375 Ga0500645_001583 3300053730 Bacteria 11316
376 Ga0500609_006300 3300053731 Bacteria 1616
377 Ga0500596_003120 3300053735 Bacteria 3187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10160144 Ga0105241_101601441 143
2 3300009551 Ga0105238_10119246 Ga0105238_101192464 143
3 3300010375 Ga0105239_10967415 Ga0105239_109674152 143
4 3300025924 Ga0207694_10091737 Ga0207694_100917374 143
5 iso_pu_bacteria 8057101203 8057104498 143
6 3300000041 ARcpr5oldR_c002297 ARcpr5oldR_0022974 147
7 3300000043 ARcpr5yngRDRAFT_c004220 ARcpr5yngRDRAFT_0042203 147
8 3300000652 ARCol0yngRDRAFT_1006320 ARCol0yngRDRAFT_10063202 147
9 3300001915 JGI24741J21665_1004813 JGI24741J21665_10048133 147
10 3300001979 JGI24740J21852_10008796 JGI24740J21852_100087965 147
11 3300001989 JGI24739J22299_10014314 JGI24739J22299_100143143 147
12 3300001990 JGI24737J22298_10013475 JGI24737J22298_100134753 147
13 3300001990 JGI24737J22298_10016926 JGI24737J22298_100169262 147
14 3300002774 JGI25150J39212_1000082 JGI25150J39212_100008230 147
15 3300003187 JGI25151J46595_10057252 JGI25151J46595_100572521 147
16 3300003215 JGI25153J46596_10000016 JGI25153J46596_10000016149 147
17 3300003215 JGI25153J46596_10000029 JGI25153J46596_1000002979 147
18 3300003215 JGI25153J46596_10017950 JGI25153J46596_100179505 147
19 3300003759 Ga0055525_1000035 Ga0055525_100003570 147
20 3300003762 Ga0055542_1000060 Ga0055542_100006073 147
21 3300003763 Ga0055529_1000043 Ga0055529_100004391 147
22 3300003771 Ga0055526_1000928 Ga0055526_100092822 147
23 3300003773 Ga0055537_1002601 Ga0055537_10026012 147
24 3300003775 Ga0055524_1000410 Ga0055524_100041023 147
25 3300003781 Ga0055536_1045368 Ga0055536_10453682 147
26 3300003790 Ga0055528_1029850 Ga0055528_10298503 147
27 3300003791 Ga0055530_10009351 Ga0055530_100093514 147
28 3300003791 Ga0055530_10014843 Ga0055530_100148434 147
29 3300003791 Ga0055530_10025769 Ga0055530_100257692 147
30 3300003792 Ga0055540_1001389 Ga0055540_100138911 147
31 3300003794 Ga0055531_10009180 Ga0055531_100091806 147
32 3300003794 Ga0055531_10020832 Ga0055531_100208324 147
33 3300003794 Ga0055531_10020834 Ga0055531_100208344 147
34 3300004625 Ga0055543_1015977 Ga0055543_10159772 147
35 3300005262 Ga0065165_1010402 Ga0065165_10104023 147
36 3300005327 Ga0070658_10000907 Ga0070658_100009076 147
37 3300005328 Ga0070676_10018009 Ga0070676_100180093 147
38 3300005329 Ga0070683_101442903 Ga0070683_1014429032 147
39 3300005334 Ga0068869_100464046 Ga0068869_1004640462 147
40 3300005335 Ga0070666_10621366 Ga0070666_106213662 147
41 3300005339 Ga0070660_100003826 Ga0070660_1000038265 147
42 3300005344 Ga0070661_100056569 Ga0070661_1000565691 147
43 3300005344 Ga0070661_100205937 Ga0070661_1002059371 147
44 3300005347 Ga0070668_100143255 Ga0070668_1001432552 147
45 3300005356 Ga0070674_100050788 Ga0070674_1000507881 147
46 3300005366 Ga0070659_100005817 Ga0070659_1000058172 147
47 3300005455 Ga0070663_100212188 Ga0070663_1002121882 147
48 3300005456 Ga0070678_100818549 Ga0070678_1008185492 147
49 3300005457 Ga0070662_101739468 Ga0070662_1017394681 147
50 3300005539 Ga0068853_100052029 Ga0068853_1000520292 147
51 3300005539 Ga0068853_100099827 Ga0068853_1000998272 147
52 3300005539 Ga0068853_100217798 Ga0068853_1002177983 147
53 3300005539 Ga0068853_100887831 Ga0068853_1008878312 147
54 3300005563 Ga0068855_100007634 Ga0068855_1000076349 147
55 3300005563 Ga0068855_100493007 Ga0068855_1004930072 147
56 3300005563 Ga0068855_100987916 Ga0068855_1009879162 147
57 3300005577 Ga0068857_100074852 Ga0068857_1000748522 147
58 3300005618 Ga0068864_100000114 Ga0068864_10000011437 147
59 3300005719 Ga0068861_100753266 Ga0068861_1007532662 147
60 3300005842 Ga0068858_100001075 Ga0068858_10000107514 147
61 3300005842 Ga0068858_100005210 Ga0068858_10000521014 147
62 3300006186 Ga0075369_10028590 Ga0075369_100285903 147
63 3300006195 Ga0075366_10074928 Ga0075366_100749282 147
64 3300006237 Ga0097621_101299016 Ga0097621_1012990162 147
65 3300009098 Ga0105245_10008872 Ga0105245_1000887211 147
66 3300009148 Ga0105243_10033182 Ga0105243_100331825 147
67 3300009174 Ga0105241_10002313 Ga0105241_100023135 147
68 3300009176 Ga0105242_11158497 Ga0105242_111584971 147
69 3300009176 Ga0105242_11697780 Ga0105242_116977801 147
70 3300009177 Ga0105248_10008563 Ga0105248_100085635 147
71 3300009545 Ga0105237_11208629 Ga0105237_112086291 147
72 3300010375 Ga0105239_10584497 Ga0105239_105844973 147
73 3300010375 Ga0105239_11541610 Ga0105239_115416102 147
74 3300012513 Ga0157326_1002620 Ga0157326_10026202 147
75 3300013100 Ga0157373_10059548 Ga0157373_100595483 147
76 3300013100 Ga0157373_10770417 Ga0157373_107704171 147
77 3300013102 Ga0157371_10000030 Ga0157371_1000003070 147
78 3300013104 Ga0157370_10187163 Ga0157370_101871633 147
79 3300013104 Ga0157370_10863584 Ga0157370_108635841 147
80 3300013105 Ga0157369_10057290 Ga0157369_100572904 147
81 3300013105 Ga0157369_10382158 Ga0157369_103821582 147
82 3300013105 Ga0157369_11495179 Ga0157369_114951792 147
83 3300013296 Ga0157374_10296629 Ga0157374_102966292 147
84 3300013297 Ga0157378_10192996 Ga0157378_101929962 147
85 3300013306 Ga0163162_10084113 Ga0163162_100841132 147
86 3300013307 Ga0157372_10050955 Ga0157372_100509556 147
87 3300013308 Ga0157375_10302187 Ga0157375_103021872 147
88 3300014325 Ga0163163_10237802 Ga0163163_102378022 147
89 3300021384 Ga0213876_10119132 Ga0213876_101191322 147
90 3300025208 Ga0209436_121415 Ga0209436_1214152 147
91 3300025230 Ga0209563_100047 Ga0209563_100047282 147
92 3300025245 Ga0207425_1000020 Ga0207425_10000208 147
93 3300025245 Ga0207425_1003186 Ga0207425_10031866 147
94 3300025250 Ga0209026_1010492 Ga0209026_10104922 147
95 3300025254 Ga0209148_1000017 Ga0209148_1000017228 147
96 3300025258 Ga0209129_1004746 Ga0209129_10047463 147
97 3300025261 Ga0209233_1019983 Ga0209233_10199832 147
98 3300025263 Ga0209565_1000008 Ga0209565_1000008473 147
99 3300025272 Ga0209455_1000005 Ga0209455_1000005228 147
100 3300025273 Ga0209673_1003183 Ga0209673_10031837 147
101 3300025291 Ga0209675_1008916 Ga0209675_10089162 147
102 3300025292 Ga0209676_1005389 Ga0209676_10053895 147
103 3300025294 Ga0209025_1000383 Ga0209025_100038361 147
104 3300025295 Ga0209564_1000565 Ga0209564_100056533 147
105 3300025297 Ga0209758_1000004 Ga0209758_1000004271 147
106 3300025297 Ga0209758_1000035 Ga0209758_1000035220 147
107 3300025297 Ga0209758_1009937 Ga0209758_10099372 147
108 3300025298 Ga0209050_1000001 Ga0209050_10000012224 147
109 3300025298 Ga0209050_1003988 Ga0209050_100398810 147
110 3300025298 Ga0209050_1013286 Ga0209050_10132863 147
111 3300025298 Ga0209050_1098291 Ga0209050_10982911 147
112 3300025299 Ga0209256_1000009 Ga0209256_1000009397 147
113 3300025299 Ga0209256_1000010 Ga0209256_1000010321 147
114 3300025303 Ga0209051_1000951 Ga0209051_100095111 147
115 3300025304 Ga0209257_1000857 Ga0209257_10008576 147
116 3300025304 Ga0209257_1003106 Ga0209257_10031063 147
117 3300025304 Ga0209257_1003122 Ga0209257_100312211 147
118 3300025321 Ga0207656_10016845 Ga0207656_100168453 147
119 3300025904 Ga0207647_10004780 Ga0207647_100047801 147
120 3300025904 Ga0207647_10021489 Ga0207647_100214895 147
121 3300025907 Ga0207645_10093177 Ga0207645_100931771 147
122 3300025909 Ga0207705_10000935 Ga0207705_1000093512 147
123 3300025911 Ga0207654_10003076 Ga0207654_100030764 147
124 3300025913 Ga0207695_10010168 Ga0207695_100101688 147
125 3300025914 Ga0207671_10006483 Ga0207671_1000648311 147
126 3300025919 Ga0207657_10004792 Ga0207657_100047929 147
127 3300025920 Ga0207649_10002100 Ga0207649_100021008 147
128 3300025920 Ga0207649_10100904 Ga0207649_101009041 147
129 3300025924 Ga0207694_10060281 Ga0207694_100602812 147
130 3300025927 Ga0207687_10003101 Ga0207687_100031012 147
131 3300025932 Ga0207690_10001091 Ga0207690_1000109111 147
132 3300025933 Ga0207706_10019650 Ga0207706_100196504 147
133 3300025935 Ga0207709_10164388 Ga0207709_101643882 147
134 3300025942 Ga0207689_10236012 Ga0207689_102360121 147
135 3300025944 Ga0207661_11307472 Ga0207661_113074722 147
136 3300025949 Ga0207667_10000004 Ga0207667_10000004214 147
137 3300025949 Ga0207667_10001173 Ga0207667_1000117320 147
138 3300025949 Ga0207667_10103577 Ga0207667_101035773 147
139 3300025960 Ga0207651_11004156 Ga0207651_110041561 147
140 3300025972 Ga0207668_10361684 Ga0207668_103616843 147
141 3300025981 Ga0207640_10004843 Ga0207640_100048436 147
142 3300026035 Ga0207703_10000483 Ga0207703_1000048335 147
143 3300026041 Ga0207639_10001587 Ga0207639_1000158711 147
144 3300026041 Ga0207639_10078953 Ga0207639_100789533 147
145 3300026041 Ga0207639_10311635 Ga0207639_103116352 147
146 3300026067 Ga0207678_10001729 Ga0207678_1000172917 147
147 3300026078 Ga0207702_10006632 Ga0207702_100066329 147
148 3300026095 Ga0207676_10000497 Ga0207676_1000049712 147
149 3300026095 Ga0207676_10912946 Ga0207676_109129462 147
150 3300026116 Ga0207674_10007643 Ga0207674_100076439 147
151 3300026116 Ga0207674_10008995 Ga0207674_100089954 147
152 3300026118 Ga0207675_100878196 Ga0207675_1008781962 147
153 3300026121 Ga0207683_10397961 Ga0207683_103979613 147
154 3300026121 Ga0207683_10821510 Ga0207683_108215101 147
155 3300026142 Ga0207698_10038725 Ga0207698_100387253 147
156 3300028786 Ga0307517_10031155 Ga0307517_100311553 147
157 3300031456 Ga0307513_10101842 Ga0307513_101018422 147
158 3300031456 Ga0307513_10156085 Ga0307513_101560852 147
159 3300031548 Ga0307408_100008447 Ga0307408_1000084475 147
160 3300031616 Ga0307508_10003330 Ga0307508_100033301 147
161 3300031731 Ga0307405_10079155 Ga0307405_100791552 147
162 3300031824 Ga0307413_10308041 Ga0307413_103080412 147
163 3300031852 Ga0307410_10778401 Ga0307410_107784012 147
164 3300031901 Ga0307406_10140557 Ga0307406_101405572 147
165 3300031911 Ga0307412_10061973 Ga0307412_100619732 147
166 3300032002 Ga0307416_100100541 Ga0307416_1001005412 147
167 3300032005 Ga0307411_10826423 Ga0307411_108264232 147
168 3300033180 Ga0307510_10010951 Ga0307510_100109512 147
169 3300033180 Ga0307510_10056702 Ga0307510_100567023 147
170 3300037471 Ga0395905_0178313 Ga0395905_0178313_1134_1583 147
171 3300039437 Ga0436365_0233461 Ga0436365_0233461_1428_1889 147
172 3300041411 Ga0439466_0048255 Ga0439466_0048255_45_506 147
173 3300041413 Ga0439465_0000307 Ga0439465_0000307_3922_4383 147
174 3300041413 Ga0439465_0027312 Ga0439465_0027312_311_763 147
175 3300041511 Ga0451855_0583587 Ga0451855_0583587_43_489 147
176 3300041997 Ga0439431_0000110 Ga0439431_0000110_10005_10466 147
177 3300042002 Ga0439442_000466 Ga0439442_000466_6999_7460 147
178 3300042004 Ga0439445_0002873 Ga0439445_0002873_614_1075 147
179 3300042006 Ga0439432_000148 Ga0439432_000148_22749_23210 147
180 3300042015 Ga0439462_0001478 Ga0439462_0001478_1150_1611 147
181 3300042435 Ga0439434_0018953 Ga0439434_0018953_1441_1902 147
182 3300046453 Ga0495627_112719 Ga0495627_112719_222_680 147
183 3300046471 Ga0495650_0000174 Ga0495650_0000174_115318_115767 147
184 3300046471 Ga0495650_0015304 Ga0495650_0015304_1378_1839 147
185 3300046475 Ga0495639_0177013 Ga0495639_0177013_30_479 147
186 3300046491 Ga0495584_0190221 Ga0495584_0190221_127_576 147
187 3300046492 Ga0495585_0005725 Ga0495585_0005725_529_978 147
188 3300046492 Ga0495585_0115100 Ga0495585_0115100_28_477 147
189 3300046492 Ga0495585_0142317 Ga0495585_0142317_435_884 147
190 3300046500 Ga0495596_0014780 Ga0495596_0014780_2059_2508 147
191 3300046506 Ga0495583_0000271 Ga0495583_0000271_18653_19102 147
192 3300046506 Ga0495583_0007539 Ga0495583_0007539_451_900 147
193 3300046506 Ga0495583_0044404 Ga0495583_0044404_142_591 147
194 3300046506 Ga0495583_0099672 Ga0495583_0099672_318_803 147
195 3300046507 Ga0495606_0000842 Ga0495606_0000842_13705_14265 147
196 3300046507 Ga0495606_0096046 Ga0495606_0096046_1166_1615 147
197 3300046507 Ga0495606_0101731 Ga0495606_0101731_199_648 147
198 3300046507 Ga0495606_0380191 Ga0495606_0380191_149_595 147
199 3300046513 Ga0495616_0112340 Ga0495616_0112340_135_584 147
200 3300046518 Ga0495631_0055949 Ga0495631_0055949_27_476 147
201 3300046518 Ga0495631_0425731 Ga0495631_0425731_33_518 147
202 3300046520 Ga0495637_0006072 Ga0495637_0006072_4433_4882 147
203 3300046520 Ga0495637_0278379 Ga0495637_0278379_125_574 147
204 3300046522 Ga0495643_0005860 Ga0495643_0005860_4907_5356 147
205 3300046522 Ga0495643_0011003 Ga0495643_0011003_4906_5355 147
206 3300046522 Ga0495643_0012143 Ga0495643_0012143_169_618 147
207 3300046522 Ga0495643_0203386 Ga0495643_0203386_165_614 147
208 3300046524 Ga0495648_0000115 Ga0495648_0000115_81936_82421 147
209 3300046524 Ga0495648_0022212 Ga0495648_0022212_1224_1667 147
210 3300046524 Ga0495648_0175690 Ga0495648_0175690_450_899 147
211 3300046524 Ga0495648_0427690 Ga0495648_0427690_125_571 147
212 3300046525 Ga0495663_0012045 Ga0495663_0012045_1437_1886 147
213 3300046528 Ga0495642_0011572 Ga0495642_0011572_788_1237 147
214 3300046529 Ga0495652_0758692 Ga0495652_0758692_143_592 147
215 3300046538 Ga0495609_0132392 Ga0495609_0132392_370_819 147
216 3300046542 Ga0495597_0009706 Ga0495597_0009706_629_1078 147
217 3300046557 Ga0495622_0020295 Ga0495622_0020295_935_1384 147
218 3300046558 Ga0495633_0000735 Ga0495633_0000735_11423_11872 147
219 3300046558 Ga0495633_0072861 Ga0495633_0072861_604_1053 147
220 3300046616 Ga0495668_0000007 Ga0495668_0000007_457787_458236 147
221 3300046648 Ga0495611_0015800 Ga0495611_0015800_1548_1997 147
222 3300046648 Ga0495611_0095712 Ga0495611_0095712_355_804 147
223 3300046648 Ga0495611_0283878 Ga0495611_0283878_33_482 147
224 3300046660 Ga0495625_0000619 Ga0495625_0000619_4272_4721 147
225 3300046660 Ga0495625_0006713 Ga0495625_0006713_7724_8173 147
226 3300046660 Ga0495625_0012080 Ga0495625_0012080_766_1215 147
227 3300046660 Ga0495625_0058006 Ga0495625_0058006_171_620 147
228 3300046660 Ga0495625_0197032 Ga0495625_0197032_405_863 147
229 3300046660 Ga0495625_0290605 Ga0495625_0290605_51_500 147
230 3300046660 Ga0495625_0304713 Ga0495625_0304713_123_572 147
231 3300046665 Ga0495661_0336757 Ga0495661_0336757_173_631 147
232 3300046684 Ga0495669_0000027 Ga0495669_0000027_44976_45425 147
233 3300046691 Ga0495670_0005175 Ga0495670_0005175_4600_5058 147
234 3300046692 Ga0495671_0105264 Ga0495671_0105264_561_1010 147
235 3300046694 Ga0495649_0094659 Ga0495649_0094659_14_472 147
236 3300046694 Ga0495649_0294351 Ga0495649_0294351_188_637 147
237 3300046809 Ga0495600_0005999 Ga0495600_0005999_2966_3415 147
238 3300046810 Ga0495660_0061274 Ga0495660_0061274_850_1299 147
239 3300047320 Ga0495672_0115587 Ga0495672_0115587_246_689 147
240 3300047323 Ga0495683_0004584 Ga0495683_0004584_271_720 147
241 3300047323 Ga0495683_0019245 Ga0495683_0019245_1273_1722 147
242 3300047443 Ga0495687_000044 Ga0495687_000044_158964_159413 147
243 3300047443 Ga0495687_000055 Ga0495687_000055_105004_105453 147
244 3300047445 Ga0495677_0003026 Ga0495677_0003026_2771_3220 147
245 3300047445 Ga0495677_0019221 Ga0495677_0019221_1601_2065 147
246 3300047446 Ga0495679_103696 Ga0495679_103696_25_474 147
247 3300047469 Ga0495673_0035795 Ga0495673_0035795_31_480 147
248 3300047470 Ga0495681_0003121 Ga0495681_0003121_663_1112 147
249 3300047470 Ga0495681_0201570 Ga0495681_0201570_247_696 147
250 3300047472 Ga0495686_0004412 Ga0495686_0004412_5102_5623 147
251 3300047472 Ga0495686_0037824 Ga0495686_0037824_145_588 147
252 3300048903 Ga0496100_0297562 Ga0496100_0297562_641_1126 147
253 3300048903 Ga0496100_1190383 Ga0496100_1190383_73_519 147
254 3300048905 Ga0496102_0000188 Ga0496102_0000188_34809_35258 147
255 3300048905 Ga0496102_0299642 Ga0496102_0299642_209_655 147
256 3300048906 Ga0496103_0000426 Ga0496103_0000426_9017_9502 147
257 3300048908 Ga0496105_0000605 Ga0496105_0000605_21729_22214 147
258 3300048910 Ga0496107_0037187 Ga0496107_0037187_2702_3151 147
259 3300048913 Ga0496110_0043527 Ga0496110_0043527_892_1377 147
260 3300048914 Ga0496111_0007646 Ga0496111_0007646_4101_4586 147
261 3300048915 Ga0496112_0225175 Ga0496112_0225175_576_1025 147
262 3300048916 Ga0496113_0236865 Ga0496113_0236865_122_571 147
263 3300048917 Ga0496114_0007402 Ga0496114_0007402_4629_5078 147
264 3300048918 Ga0496115_0000018 Ga0496115_0000018_87082_87531 147
265 3300048919 Ga0496116_0032322 Ga0496116_0032322_1203_1688 147
266 3300048919 Ga0496116_0415230 Ga0496116_0415230_26_472 147
267 3300048920 Ga0496117_0000499 Ga0496117_0000499_42376_42825 147
268 3300048921 Ga0496118_0000399 Ga0496118_0000399_21932_22417 147
269 3300048922 Ga0496119_0007238 Ga0496119_0007238_8620_9069 147
270 3300048923 Ga0496120_0043335 Ga0496120_0043335_1174_1659 147
271 3300048924 Ga0496121_0000104 Ga0496121_0000104_26530_26994 147
272 3300048924 Ga0496121_0000263 Ga0496121_0000263_21888_22373 147
273 3300048924 Ga0496121_0315174 Ga0496121_0315174_569_1015 147
274 3300048925 Ga0496122_0009646 Ga0496122_0009646_7332_7817 147
275 3300048926 Ga0496123_0024186 Ga0496123_0024186_3863_4348 147
276 3300048927 Ga0496124_0000099 Ga0496124_0000099_94368_94853 147
277 3300048928 Ga0496125_0000529 Ga0496125_0000529_42421_42870 147
278 3300048929 Ga0496126_0000707 Ga0496126_0000707_42252_42701 147
279 3300049570 Ga0501033_0315381 Ga0501033_0315381_622_1080 147
280 3300049705 Ga0501225_0294074 Ga0501225_0294074_11_457 147
281 3300049742 Ga0501080_0759770 Ga0501080_0759770_232_678 147
282 3300049758 Ga0501241_015178 Ga0501241_015178_200_658 147
283 3300049758 Ga0501241_047909 Ga0501241_047909_54_512 147
284 3300049764 Ga0501267_002168 Ga0501267_002168_486_935 147
285 3300053079 Ga0500610_0000486 Ga0500610_0000486_1437_1886 147
286 3300053087 Ga0500643_000195 Ga0500643_000195_36763_37209 147
287 3300053087 Ga0500643_001414 Ga0500643_001414_1908_2357 147
288 3300053087 Ga0500643_003094 Ga0500643_003094_652_1128 147
289 3300053087 Ga0500643_010784 Ga0500643_010784_480_929 147
290 3300053087 Ga0500643_042990 Ga0500643_042990_286_735 147
291 3300053092 Ga0500583_0066583 Ga0500583_0066583_658_1107 147
292 3300053094 Ga0500566_0000420 Ga0500566_0000420_13534_13992 147
293 3300053096 Ga0500641_0004830 Ga0500641_0004830_1874_2320 147
294 3300053104 Ga0500556_0022780 Ga0500556_0022780_548_994 147
295 3300053119 Ga0500595_000183 Ga0500595_000183_17748_18194 147
296 3300053119 Ga0500595_000375 Ga0500595_000375_11965_12414 147
297 3300053130 Ga0500642_0000195 Ga0500642_0000195_6537_6986 147
298 3300053136 Ga0500559_0050450 Ga0500559_0050450_338_814 147
299 3300053151 Ga0500604_0002410 Ga0500604_0002410_2493_2951 147
300 3300053157 Ga0500624_000057 Ga0500624_000057_31143_31616 147
301 3300053177 Ga0500636_0011252 Ga0500636_0011252_1208_1657 147
302 3300053177 Ga0500636_0177661 Ga0500636_0177661_126_584 147
303 3300053730 Ga0500645_000009 Ga0500645_000009_74327_74776 147
304 3300053730 Ga0500645_001583 Ga0500645_001583_3337_3783 147
305 3300053731 Ga0500609_006300 Ga0500609_006300_322_771 147
306 3300053735 Ga0500596_003120 Ga0500596_003120_718_1167 147
307 3300003214 JGI25165J46597_1000007 JGI25165J46597_100000716 148
308 3300003791 Ga0055530_10000409 Ga0055530_1000040912 148
309 3300003794 Ga0055531_10000009 Ga0055531_1000000926 148
310 3300005288 Ga0065714_10073504 Ga0065714_100735042 148
311 3300025233 Ga0209437_104362 Ga0209437_1043622 148
312 3300025261 Ga0209233_1000026 Ga0209233_100002617 148
313 3300025263 Ga0209565_1000054 Ga0209565_100005413 148
314 3300025273 Ga0209673_1009422 Ga0209673_10094224 148
315 3300025295 Ga0209564_1005001 Ga0209564_10050014 148
316 3300025298 Ga0209050_1000014 Ga0209050_1000014188 148
317 3300025304 Ga0209257_1000019 Ga0209257_1000019504 148
318 3300046691 Ga0495670_0141983 Ga0495670_0141983_453_914 148
319 3300053096 Ga0500641_0023428 Ga0500641_0023428_1577_2038 148
320 3300053139 Ga0500568_0052701 Ga0500568_0052701_416_877 148
321 3300053139 Ga0500568_0092645 Ga0500568_0092645_339_794 148
322 3300053151 Ga0500604_0059482 Ga0500604_0059482_352_813 148
323 3300053153 Ga0500616_0008700 Ga0500616_0008700_5657_6118 148
324 3300013297 Ga0157378_10183168 Ga0157378_101831683 149
325 3300038443 Ga0395901_0015609 Ga0395901_0015609_6141_6602 151
326 3300047472 Ga0495686_0001904 Ga0495686_0001904_6912_7367 151
327 3300053125 Ga0500618_093618 Ga0500618_093618_101_556 151
328 3300053142 Ga0500577_0017456 Ga0500577_0017456_273_728 151
329 3300053153 Ga0500616_0071306 Ga0500616_0071306_62_517 151
330 3300001989 JGI24739J22299_10012988 JGI24739J22299_100129885 152
331 3300001989 JGI24739J22299_10058021 JGI24739J22299_100580211 152
332 3300002067 JGI24735J21928_10015638 JGI24735J21928_100156386 152
333 3300002075 JGI24738J21930_10005044 JGI24738J21930_100050446 152
334 3300002075 JGI24738J21930_10023496 JGI24738J21930_100234962 152
335 3300003316 rootH1_10088922 rootH1_100889223 152
336 3300003320 rootH2_10187369 rootH2_101873692 152
337 3300005327 Ga0070658_10213360 Ga0070658_102133602 152
338 3300005344 Ga0070661_100460335 Ga0070661_1004603352 152
339 3300005366 Ga0070659_100295947 Ga0070659_1002959472 152
340 3300005457 Ga0070662_100094789 Ga0070662_1000947894 152
341 3300009545 Ga0105237_10121789 Ga0105237_101217894 152
342 3300013100 Ga0157373_10887521 Ga0157373_108875211 152
343 3300013102 Ga0157371_10269202 Ga0157371_102692023 152
344 3300013307 Ga0157372_10263543 Ga0157372_102635434 152
345 3300025904 Ga0207647_10000756 Ga0207647_100007562 152
346 3300025904 Ga0207647_10012219 Ga0207647_100122193 152
347 3300025914 Ga0207671_10126053 Ga0207671_101260534 152
348 3300025933 Ga0207706_10010431 Ga0207706_100104317 152
349 3300025933 Ga0207706_10029402 Ga0207706_100294027 152
350 3300026088 Ga0207641_10874294 Ga0207641_108742942 152
351 3300035691 Ga0373931_0235810 Ga0373931_0235810_541_1002 152
352 3300037418 Ga0395900_0067686 Ga0395900_0067686_732_1193 152
353 3300037471 Ga0395905_0049183 Ga0395905_0049183_448_909 152
354 3300038443 Ga0395901_0068444 Ga0395901_0068444_688_1149 152
355 3300042005 Ga0439448_0000954 Ga0439448_0000954_5804_6265 152
356 3300042005 Ga0439448_0002340 Ga0439448_0002340_2660_3121 152
357 3300042012 Ga0439455_0000505 Ga0439455_0000505_750_1211 152
358 3300042012 Ga0439455_0007049 Ga0439455_0007049_1330_1791 152
359 3300042157 Ga0439458_0001013 Ga0439458_0001013_3353_3814 152
360 3300042157 Ga0439458_0002218 Ga0439458_0002218_241_702 152
361 3300044658 Ga0466972_0007202 Ga0466972_0007202_2914_3375 152
362 3300044684 Ga0466966_0333585 Ga0466966_0333585_424_885 152
363 3300044706 Ga0466964_0012046 Ga0466964_0012046_755_1216 152
364 3300044901 Ga0466960_0015172 Ga0466960_0015172_1848_2309 152
365 3300048914 Ga0496111_0437498 Ga0496111_0437498_137_598 152
366 3300048925 Ga0496122_0001352 Ga0496122_0001352_38431_38892 152
367 3300048926 Ga0496123_0000465 Ga0496123_0000465_7260_7721 152
368 3300048927 Ga0496124_0008038 Ga0496124_0008038_8912_9373 152
369 2162886007 SwRhRL2b_contig_3207873 SwRhRL2b_0996.00002050 153
370 3300005289 Ga0065704_10070205 Ga0065704_1007020570 153
371 3300005617 Ga0068859_100007204 Ga0068859_1000072048 153
372 3300005719 Ga0068861_100000002 Ga0068861_10000000218 153
373 3300006931 Ga0097620_100007204 Ga0097620_1000072044 153
374 3300009177 Ga0105248_10001984 Ga0105248_1000198410 153
375 3300014968 Ga0157379_10030325 Ga0157379_100303253 153
376 3300025941 Ga0207711_10002937 Ga0207711_1000293714 153
377 3300026118 Ga0207675_100000021 Ga0207675_1000000213 153
378 3300048927 Ga0496124_0279507 Ga0496124_0279507_732_1208 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

64

137

0.96

PF05899

Cupin_3

EutQ-like cupin domain

63

130

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9118 3 153
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9079 42 120
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.9063 27 119
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.8969 28 147
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8965 40 121
ID Description Score Start End Superfamily
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9012 28 140 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8943 27 119 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8908 40 118 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8874 42 119 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8816 27 119 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2YQ73-F1-model_v4 Cupin domain-containing protein 1.001 1 120 GO:0005886
GO:0015171
AF-A0A3S0THU0-F1-model_v4 Cupin domain-containing protein 0.9938 1 153 GO:0046872
AF-A0A4Q2YMQ0-F1-model_v4 Cupin domain-containing protein 0.9907 1 126 GO:0046872
AF-A0A7H0G819-F1-model_v4 deleted 0.9876 3 153
AF-A0A3S0THU0-F1-model_v4 Cupin domain-containing protein 0.9874 1 153 GO:0046872

Feature Viewer

pLDDT pTM Quality
94.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map