F428089

General Info

Members Datasets Scaffolds Average Seq Length
378 193 756 258

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0792215|Ga0436360_0792215_434_1291
Length 285
Sequence MIAAPASPFSVADVMEESPSMDLGLRDRACIVTGASGGIGRAVAASLAGEGAFVLLLGRRSETLSDVARACSDAGGRAEPLVLDVTTVDAGERAVQACLERFGRIDALVNGAGTSAVRSVEQLTDEEWQAQWDLHVMAPMRLMRAAGPVMAERGWGRIVNVCSSSGKRPSSTNMAYSVTKAAELSLSRSFADLYAARGVLVNSVSPGPIGGDLWLAPDGLAEQQARARGVTREEVLESVAARQPIGRLGTEEEIAAVIVFLCSEAASNVVGASWSVDGGAVPVII

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 8.99
Rhizosphere 81.22
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0792215 3300039438 Bacteria 4659
2 JGI25407J50210_10004581 3300003373 Bacteria 3366
3 JGI25407J50210_10018314 3300003373 Bacteria 1820
4 Ga0070683_100059442 3300005329 Bacteria 3551
5 Ga0070683_100147433 3300005329 Bacteria 2230
6 Ga0070680_100473463 3300005336 Bacteria 1070
7 Ga0070682_100171917 3300005337 Bacteria 1507
8 Ga0070682_100270553 3300005337 Bacteria 1234
9 Ga0070660_100006642 3300005339 Bacteria 8025
10 Ga0070660_100062755 3300005339 Bacteria 2887
11 Ga0070692_10058467 3300005345 Bacteria 2025
12 Ga0070674_100276006 3300005356 Bacteria 1330
13 Ga0070659_100000043 3300005366 Bacteria 102267
14 Ga0070714_100009040 3300005435 Bacteria 7806
15 Ga0070714_100095866 3300005435 Bacteria 2606
16 Ga0070714_100137561 3300005435 Bacteria 2189
17 Ga0070714_100147317 3300005435 Bacteria 2119
18 Ga0070714_100190318 3300005435 Bacteria 1872
19 Ga0070714_100193982 3300005435 Bacteria 1855
20 Ga0070714_100338384 3300005435 Bacteria 1411
21 Ga0070713_100015622 3300005436 Bacteria 5685
22 Ga0070713_100357385 3300005436 Bacteria 1356
23 Ga0070710_10000003 3300005437 Bacteria 277772
24 Ga0070710_10067403 3300005437 Bacteria 2054
25 Ga0070711_100087533 3300005439 Bacteria 2236
26 Ga0070711_100383502 3300005439 Bacteria 1137
27 Ga0070705_100000625 3300005440 Bacteria 20423
28 Ga0070708_100370456 3300005445 Bacteria 1350
29 Ga0070678_100405520 3300005456 Bacteria 1185
30 Ga0070681_10272642 3300005458 Bacteria 1603
31 Ga0070707_100138412 3300005468 Bacteria 2369
32 Ga0070672_100265538 3300005543 Bacteria 1448
33 Ga0070686_100324516 3300005544 Bacteria 1149
34 Ga0070693_100114543 3300005547 Bacteria 1664
35 Ga0070665_100113052 3300005548 Bacteria 2718
36 Ga0068855_100098969 3300005563 Bacteria 3359
37 Ga0068857_100160424 3300005577 Bacteria 2040
38 Ga0068856_100403474 3300005614 Bacteria 1387
39 Ga0081455_10042648 3300005937 Bacteria 3977
40 Ga0081538_10000099 3300005981 Bacteria 83947
41 Ga0081538_10000623 3300005981 Bacteria 39341
42 Ga0081538_10001033 3300005981 Bacteria 29696
43 Ga0081538_10019166 3300005981 Bacteria 5100
44 Ga0081539_10007617 3300005985 Bacteria 9777
45 Ga0070717_10000001 3300006028 Bacteria 465573
46 Ga0070717_10006633 3300006028 Bacteria 8529
47 Ga0070717_10059896 3300006028 Bacteria 3151
48 Ga0070717_10072573 3300006028 Bacteria 2874
49 Ga0070717_10120907 3300006028 Bacteria 2243
50 Ga0070717_10227855 3300006028 Bacteria 1640
51 Ga0070717_10288874 3300006028 Bacteria 1456
52 Ga0075365_10000157 3300006038 Bacteria 21599
53 Ga0075365_10001681 3300006038 Bacteria 10229
54 Ga0075365_10006484 3300006038 Bacteria 6442
55 Ga0070715_10072791 3300006163 Bacteria 1539
56 Ga0070716_100067996 3300006173 Bacteria 2083
57 Ga0070712_100004215 3300006175 Bacteria 8848
58 Ga0070712_100027541 3300006175 Bacteria 3795
59 Ga0075431_100002759 3300006847 Bacteria 17025
60 Ga0075434_100023785 3300006871 Bacteria 5977
61 Ga0075429_100283393 3300006880 Bacteria 1451
62 Ga0068865_100043790 3300006881 Bacteria 3061
63 Ga0075436_100028388 3300006914 Bacteria 3849
64 Ga0105240_10134768 3300009093 Bacteria 2958
65 Ga0105240_10173041 3300009093 Bacteria 2555
66 Ga0105245_10044068 3300009098 Bacteria 3981
67 Ga0105248_10142251 3300009177 Bacteria 2706
68 Ga0105238_10452041 3300009551 Bacteria 1282
69 Ga0105239_10084576 3300010375 Bacteria 3495
70 Ga0105239_10088160 3300010375 Bacteria 3421
71 Ga0157369_10049304 3300013105 Bacteria 4566
72 Ga0157374_10407442 3300013296 Bacteria 1357
73 Ga0157372_10269007 3300013307 Bacteria 1980
74 Ga0157380_10489221 3300014326 Bacteria 1192
75 Ga0157376_10085319 3300014969 Bacteria 2720
76 Ga0213874_10000102 3300021377 Bacteria 13749
77 Ga0213874_10021306 3300021377 Bacteria 1786
78 Ga0213876_10003172 3300021384 Bacteria 9462
79 Ga0213876_10020641 3300021384 Bacteria 3483
80 Ga0213876_10064105 3300021384 Bacteria 1940
81 Ga0213876_10075568 3300021384 Bacteria 1779
82 Ga0213876_10076730 3300021384 Bacteria 1765
83 Ga0213876_10175466 3300021384 Bacteria 1140
84 Ga0213875_10000351 3300021388 Bacteria 43186
85 Ga0213875_10046194 3300021388 Bacteria 2044
86 Ga0207692_10000016 3300025898 Bacteria 86771
87 Ga0207692_10006077 3300025898 Bacteria 4884
88 Ga0207692_10193593 3300025898 Bacteria 1191
89 Ga0207695_10216563 3300025913 Bacteria 1824
90 Ga0207693_10000942 3300025915 Bacteria 26110
91 Ga0207663_10081959 3300025916 Bacteria 2115
92 Ga0207660_10244264 3300025917 Bacteria 1415
93 Ga0207657_10069531 3300025919 Bacteria 2987
94 Ga0207694_10295263 3300025924 Bacteria 1333
95 Ga0207687_10018155 3300025927 Bacteria 4641
96 Ga0207687_10059621 3300025927 Bacteria 2689
97 Ga0207700_10205443 3300025928 Bacteria 1662
98 Ga0207664_10003392 3300025929 Bacteria 10603
99 Ga0207664_10102221 3300025929 Bacteria 2370
100 Ga0207664_10160473 3300025929 Bacteria 1917
101 Ga0207664_10244816 3300025929 Bacteria 1563
102 Ga0207690_10000095 3300025932 Bacteria 73025
103 Ga0207665_10038992 3300025939 Bacteria 3166
104 Ga0207691_10196850 3300025940 Bacteria 1755
105 Ga0207711_10128070 3300025941 Bacteria 2273
106 Ga0207661_10164758 3300025944 Bacteria 1925
107 Ga0207661_10250670 3300025944 Bacteria 1573
108 Ga0207667_10047026 3300025949 Bacteria 4568
109 Ga0207677_10074038 3300026023 Bacteria 2415
110 Ga0207702_10372806 3300026078 Bacteria 1371
111 Ga0207674_10370277 3300026116 Bacteria 1385
112 Ga0207698_10434201 3300026142 Bacteria 1264
113 Ga0268264_10050547 3300028381 Bacteria 3462
114 Ga0316576_10021960 3300031727 Bacteria 4424
115 Ga0307413_10085963 3300031824 Bacteria 2032
116 Ga0307410_10061948 3300031852 Bacteria 2561
117 Ga0307410_10067278 3300031852 Bacteria 2471
118 Ga0307406_10024679 3300031901 Bacteria 3593
119 Ga0307409_100008349 3300031995 Bacteria 6280
120 Ga0307409_100501600 3300031995 Bacteria 1182
121 Ga0307416_100078398 3300032002 Bacteria 2779
122 Ga0307415_100032203 3300032126 Bacteria 3387
123 Ga0307415_100138137 3300032126 Bacteria 1857
124 Ga0373954_0091339 3300035118 Bacteria 1463
125 Ga0373955_0151793 3300035172 Bacteria 1364
126 Ga0373935_0275346 3300035692 Bacteria 1184
127 Ga0373937_0021151 3300036401 Bacteria 5839
128 Ga0316584_0018916 3300036712 Bacteria 4975
129 Ga0395899_0001904 3300037312 Bacteria 17208
130 Ga0395899_0002120 3300037312 Bacteria 16301
131 Ga0395900_0008035 3300037418 Bacteria 10859
132 Ga0395900_0012033 3300037418 Bacteria 8844
133 Ga0395900_0013891 3300037418 Bacteria 8217
134 Ga0395900_0025695 3300037418 Bacteria 6029
135 Ga0395900_0065032 3300037418 Bacteria 3746
136 Ga0395900_0267678 3300037418 Bacteria 1704
137 Ga0395898_0002063 3300037466 Bacteria 25012
138 Ga0395898_0003604 3300037466 Bacteria 17245
139 Ga0395898_0028618 3300037466 Bacteria 5583
140 Ga0395898_0088500 3300037466 Bacteria 2981
141 Ga0395898_0095548 3300037466 Bacteria 2855
142 Ga0395898_0211625 3300037466 Bacteria 1849
143 Ga0395898_0304553 3300037466 Bacteria 1520
144 Ga0395898_0555297 3300037466 Unclassified 1090
145 Ga0395898_0579631 3300037466 Bacteria 1064
146 Ga0395905_0005897 3300037471 Bacteria 12432
147 Ga0395905_0012633 3300037471 Bacteria 8123
148 Ga0395905_0028856 3300037471 Bacteria 5229
149 Ga0395905_0039239 3300037471 Bacteria 4442
150 Ga0395905_0125327 3300037471 Bacteria 2415
151 Ga0395905_0364642 3300037471 Bacteria 1337
152 Ga0436364_0358577 3300037853 Bacteria 27430
153 Ga0436364_0790855 3300037853 Bacteria 6788
154 Ga0436364_0838033 3300037853 Bacteria 3277
155 Ga0436364_0840900 3300037853 Bacteria 42362
156 Ga0436364_1229417 3300037853 Bacteria 1915
157 Ga0436364_1426665 3300037853 Bacteria 33049
158 Ga0395901_0006616 3300038443 Bacteria 11710
159 Ga0395901_0014444 3300038443 Bacteria 8035
160 Ga0395901_0021137 3300038443 Bacteria 6667
161 Ga0395901_0050962 3300038443 Bacteria 4301
162 Ga0395901_0059641 3300038443 Bacteria 3970
163 Ga0395901_0095260 3300038443 Bacteria 3119
164 Ga0395901_0489233 3300038443 Bacteria 1254
165 Ga0436365_0013991 3300039437 Bacteria 2073
166 Ga0436365_0025272 3300039437 Bacteria 37971
167 Ga0436365_0062040 3300039437 Bacteria 25145
168 Ga0436365_0095147 3300039437 Bacteria 17914
169 Ga0436365_0462535 3300039437 Bacteria 2822
170 Ga0436365_0720259 3300039437 Bacteria 5859
171 Ga0436365_1041614 3300039437 Bacteria 1392
172 Ga0436365_1120359 3300039437 Bacteria 2916
173 Ga0436365_1411275 3300039437 Bacteria 1764
174 Ga0436365_1486005 3300039437 Bacteria 16123
175 Ga0436365_1625258 3300039437 Bacteria 1850
176 Ga0436361_0842471 3300039447 Bacteria 2175
177 Ga0436363_0023518 3300039450 Bacteria 29320
178 Ga0436363_0074161 3300039450 Bacteria 3605
179 Ga0436363_0493572 3300039450 Bacteria 1082
180 Ga0436363_0700550 3300039450 Bacteria 4935
181 Ga0436362_0389186 3300039453 Bacteria 1833
182 Ga0436362_1152796 3300039453 Bacteria 1346
183 Ga0439439_0023920 3300041406 Bacteria 1532
184 Ga0439431_0024681 3300041997 Bacteria 1464
185 Ga0450915_002162 3300042119 Bacteria 1004
186 Ga0466969_0058777 3300044656 Bacteria 1871
187 Ga0466965_0035088 3300044683 Bacteria 2456
188 Ga0466966_0008157 3300044684 Bacteria 6942
189 Ga0466966_0088810 3300044684 Bacteria 1920
190 Ga0466966_0252048 3300044684 Bacteria 1063
191 Ga0466961_0006650 3300044693 Bacteria 7353
192 Ga0466961_0018734 3300044693 Bacteria 4454
193 Ga0466961_0078658 3300044693 Bacteria 2089
194 Ga0466961_0104172 3300044693 Bacteria 1787
195 Ga0466961_0391333 3300044693 Bacteria 844
196 Ga0466963_0002619 3300044694 Bacteria 10102
197 Ga0466963_0003799 3300044694 Bacteria 8705
198 Ga0466963_0011899 3300044694 Bacteria 5312
199 Ga0466963_0018662 3300044694 Bacteria 4340
200 Ga0466963_0044357 3300044694 Bacteria 2927
201 Ga0466963_0095506 3300044694 Bacteria 2029
202 Ga0466963_0114624 3300044694 Bacteria 1852
203 Ga0466963_0250479 3300044694 Bacteria 1243
204 Ga0466971_0017704 3300044719 Bacteria 3154
205 Ga0466971_0036917 3300044719 Bacteria 2191
206 Ga0466968_0007357 3300044735 Bacteria 4184
207 Ga0466970_0162158 3300044765 Bacteria 1237
208 Ga0466970_0189499 3300044765 Bacteria 1142
209 Ga0466957_0031455 3300044842 Bacteria 3171
210 Ga0466957_0057677 3300044842 Bacteria 2377
211 Ga0466957_0093700 3300044842 Bacteria 1885
212 Ga0466957_0119658 3300044842 Bacteria 1678
213 Ga0466957_0251429 3300044842 Bacteria 1175
214 Ga0466957_0342478 3300044842 Bacteria 1013
215 Ga0466960_0064267 3300044901 Bacteria 1809
216 Ga0466960_0225255 3300044901 Bacteria 1033
217 Ga0466959_0017231 3300045049 Bacteria 5291
218 Ga0466959_0034204 3300045049 Bacteria 3761
219 Ga0466959_0125198 3300045049 Bacteria 1824
220 Ga0466959_0144778 3300045049 Bacteria 1677
221 Ga0466959_0161851 3300045049 Bacteria 1573
222 Ga0466959_0181752 3300045049 Bacteria 1471
223 Ga0466959_0185976 3300045049 Bacteria 1451
224 Ga0466959_0406084 3300045049 Bacteria 925
225 Ga0466958_0006842 3300045836 Bacteria 6233
226 Ga0466958_0021518 3300045836 Bacteria 3771
227 Ga0466958_0026285 3300045836 Bacteria 3439
228 Ga0466958_0220290 3300045836 Bacteria 1210
229 Ga0466967_0000614 3300045976 Bacteria 17767
230 Ga0466967_0005224 3300045976 Bacteria 8945
231 Ga0466967_0022305 3300045976 Bacteria 5163
232 Ga0466967_0033117 3300045976 Bacteria 4373
233 Ga0466967_0048661 3300045976 Bacteria 3704
234 Ga0466967_0050993 3300045976 Bacteria 3625
235 Ga0466967_0059770 3300045976 Bacteria 3375
236 Ga0466967_0135903 3300045976 Bacteria 2286
237 Ga0466967_0195239 3300045976 Bacteria 1915
238 Ga0466967_0204960 3300045976 Bacteria 1869
239 Ga0466967_0289782 3300045976 Bacteria 1573
240 Ga0466967_0668243 3300045976 Bacteria 1028
241 Ga0495629_0183168 3300046459 Bacteria 1451
242 Ga0495641_0039801 3300046461 Bacteria 2190
243 Ga0495651_0005072 3300046462 Bacteria 10053
244 Ga0495653_0014238 3300046463 Bacteria 6485
245 Ga0495584_0057656 3300046491 Bacteria 1954
246 Ga0495584_0174990 3300046491 Bacteria 1091
247 Ga0495585_0129736 3300046492 Bacteria 1328
248 Ga0495596_0055560 3300046500 Bacteria 1547
249 Ga0495608_0002842 3300046511 Bacteria 12409
250 Ga0495618_0006254 3300046514 Bacteria 7225
251 Ga0495628_0058703 3300046516 Bacteria 3022
252 Ga0495609_0075097 3300046538 Bacteria 1482
253 Ga0495645_0059894 3300046543 Bacteria 2760
254 Ga0495635_0004649 3300046663 Bacteria 9528
255 Ga0495635_0311280 3300046663 Bacteria 1055
256 Ga0495659_0050358 3300046664 Bacteria 1515
257 Ga0495646_0038376 3300046680 Bacteria 2958
258 Ga0495658_0033237 3300046683 Bacteria 2823
259 Ga0495658_0161369 3300046683 Bacteria 1383
260 Ga0495613_0131638 3300046689 Bacteria 1791
261 Ga0495604_0005298 3300047317 Bacteria 10232
262 Ga0495674_0195180 3300047319 Bacteria 1681
263 Ga0495680_0065618 3300047322 Bacteria 2779
264 Ga0495593_0106790 3300047673 Bacteria 1432
265 Ga0495602_0016507 3300048088 Bacteria 7424
266 Ga0496100_0460159 3300048903 Bacteria 976
267 Ga0496101_0151723 3300048904 Bacteria 1773
268 Ga0496102_0101192 3300048905 Bacteria 2677
269 Ga0496102_0227499 3300048905 Bacteria 1759
270 Ga0496104_0026563 3300048907 Bacteria 5349
271 Ga0496104_0250247 3300048907 Bacteria 1685
272 Ga0496105_0009143 3300048908 Bacteria 7732
273 Ga0496105_0032284 3300048908 Bacteria 4296
274 Ga0496106_0026470 3300048909 Bacteria 4319
275 Ga0496107_0312207 3300048910 Bacteria 1170
276 Ga0496108_0037687 3300048911 Bacteria 4028
277 Ga0496108_0051889 3300048911 Bacteria 3435
278 Ga0496108_0118282 3300048911 Bacteria 2271
279 Ga0496109_0012722 3300048912 Bacteria 7270
280 Ga0496109_0018040 3300048912 Bacteria 6195
281 Ga0496109_0215274 3300048912 Bacteria 1806
282 Ga0496110_0035647 3300048913 Bacteria 4317
283 Ga0496110_0227983 3300048913 Bacteria 1694
284 Ga0496111_0032761 3300048914 Bacteria 3705
285 Ga0496111_0097186 3300048914 Bacteria 2162
286 Ga0496111_0317659 3300048914 Bacteria 1154
287 Ga0496112_0002731 3300048915 Bacteria 14290
288 Ga0496112_0037516 3300048915 Bacteria 4729
289 Ga0496112_0061399 3300048915 Bacteria 3705
290 Ga0496112_0083198 3300048915 Bacteria 3165
291 Ga0496113_0029946 3300048916 Bacteria 3936
292 Ga0496113_0031502 3300048916 Bacteria 3849
293 Ga0496113_0050928 3300048916 Bacteria 3089
294 Ga0496113_0106111 3300048916 Bacteria 2182
295 Ga0496113_0717850 3300048916 Bacteria 797
296 Ga0496114_0004212 3300048917 Bacteria 11147
297 Ga0496114_0018174 3300048917 Bacteria 5679
298 Ga0496115_0016920 3300048918 Bacteria 5562
299 Ga0496115_0066653 3300048918 Bacteria 2910
300 Ga0496121_0013406 3300048924 Bacteria 8813
301 Ga0501031_0007597 3300049568 Bacteria 7058
302 Ga0501031_0130566 3300049568 Bacteria 1641
303 Ga0501032_0144925 3300049569 Bacteria 1563
304 Ga0501034_0064949 3300049571 Bacteria 3663
305 Ga0501034_0240967 3300049571 Bacteria 1754
306 Ga0501034_0300335 3300049571 Bacteria 1542
307 Ga0501036_0010235 3300049572 Bacteria 7734
308 Ga0501036_0155021 3300049572 Bacteria 1932
309 Ga0501036_0241553 3300049572 Bacteria 1514
310 Ga0501037_0065949 3300049573 Bacteria 2637
311 Ga0501037_0073464 3300049573 Bacteria 2487
312 Ga0501038_0018169 3300049574 Bacteria 6349
313 Ga0501039_0083616 3300049575 Bacteria 2486
314 Ga0501039_0114068 3300049575 Bacteria 2114
315 Ga0501040_0006291 3300049576 Bacteria 7708
316 Ga0501040_0068674 3300049576 Bacteria 2444
317 Ga0501041_0178546 3300049577 Bacteria 1329
318 Ga0501042_0008233 3300049578 Bacteria 6871
319 Ga0501042_0041308 3300049578 Bacteria 3279
320 Ga0501042_0063320 3300049578 Bacteria 2643
321 Ga0501043_0055352 3300049579 Bacteria 3116
322 Ga0501046_0019635 3300049580 Bacteria 5602
323 Ga0501047_0057994 3300049581 Bacteria 3741
324 Ga0501047_0284858 3300049581 Bacteria 1496
325 Ga0501048_0014894 3300049582 Bacteria 5750
326 Ga0501048_0043609 3300049582 Bacteria 3210
327 Ga0501048_0147650 3300049582 Bacteria 1663
328 Ga0501067_0018060 3300049583 Bacteria 3905
329 Ga0501067_0195562 3300049583 Bacteria 1126
330 Ga0501068_0108137 3300049584 Bacteria 1727
331 Ga0501069_0016588 3300049585 Bacteria 3958
332 Ga0501069_0053833 3300049585 Bacteria 2241
333 Ga0501070_0035205 3300049586 Bacteria 4184
334 Ga0501071_0014735 3300049587 Bacteria 5350
335 Ga0501071_0090910 3300049587 Bacteria 2242
336 Ga0501072_0006148 3300049588 Bacteria 9153
337 Ga0501072_0160086 3300049588 Bacteria 1796
338 Ga0501072_0413543 3300049588 Bacteria 1069
339 Ga0501073_0276906 3300049589 Bacteria 1157
340 Ga0501074_0007289 3300049590 Bacteria 7995
341 Ga0501074_0096341 3300049590 Bacteria 2118
342 Ga0501075_0011437 3300049591 Bacteria 6282
343 Ga0501076_0007033 3300049592 Bacteria 8172
344 Ga0501076_0202845 3300049592 Bacteria 1620
345 Ga0501077_0090798 3300049593 Bacteria 1936
346 Ga0501077_0214912 3300049593 Bacteria 1222
347 Ga0501079_0016141 3300049741 Bacteria 5707
348 Ga0501079_0112108 3300049741 Bacteria 2120
349 Ga0501079_0137098 3300049741 Bacteria 1906
350 Ga0501081_0063787 3300049743 Bacteria 2557
351 Ga0501083_0184682 3300049744 Bacteria 1361
352 Ga0501035_0196685 3300049822 Bacteria 1731
353 Ga0501045_0243581 3300049824 Bacteria 1338
354 nmdc:mga0yw44_14739_c1 3300050492 Bacteria 4162
355 nmdc:mga0yw44_875_c1 3300050492 Bacteria 11324
356 nmdc:mga05p37_160973_c1 3300050507 Bacteria 2741
357 nmdc:mga09592_151600_c1 3300050508 Bacteria 2000
358 nmdc:mga09592_6559_c1 3300050508 Bacteria 9475
359 nmdc:mga06r32_234691_c1 3300050510 Bacteria 1822
360 nmdc:mga0n895_33618_c1 3300050512 Bacteria 4930
361 nmdc:mga0n895_434372_c1 3300050512 Bacteria 1326
362 nmdc:mga08x19_7047_c1 3300050514 Bacteria 6675
363 Ga0495612_0064629 3300053078 Bacteria 1519
364 Ga0495595_0028670 3300053084 Bacteria 2487
365 Ga0495619_0011182 3300053085 Bacteria 5646
366 Ga0501084_0010764 3300054114 Bacteria 7573
367 Ga0501084_0022867 3300054114 Bacteria 5217
368 Ga0587091_002005 3300059511 Bacteria 2333
369 Ga0587079_012967 3300059647 Bacteria 1373
370 Ga0501082_0188482 3300060353 Bacteria 1794
371 Ga0466962_0004893 3300061719 Bacteria 6444
372 Ga0466962_0008632 3300061719 Bacteria 4886
373 Ga0466962_0020519 3300061719 Bacteria 3175
374 Ga0466962_0039330 3300061719 Bacteria 2265
375 Ga0466962_0139367 3300061719 Bacteria 1175
376 Ga0530510_0010950 3300061734 Bacteria 6364
377 Ga0530510_0037571 3300061734 Bacteria 3494
378 Ga0530510_0071458 3300061734 Bacteria 2519
379 Ga0436360_0792215
380 JGI25407J50210_10004581
381 JGI25407J50210_10018314
382 Ga0070683_100059442
383 Ga0070683_100147433
384 Ga0070680_100473463
385 Ga0070682_100171917
386 Ga0070682_100270553
387 Ga0070660_100006642
388 Ga0070660_100062755
389 Ga0070692_10058467
390 Ga0070674_100276006
391 Ga0070659_100000043
392 Ga0070714_100009040
393 Ga0070714_100095866
394 Ga0070714_100137561
395 Ga0070714_100147317
396 Ga0070714_100190318
397 Ga0070714_100193982
398 Ga0070714_100338384
399 Ga0070713_100015622
400 Ga0070713_100357385
401 Ga0070710_10000003
402 Ga0070710_10067403
403 Ga0070711_100087533
404 Ga0070711_100383502
405 Ga0070705_100000625
406 Ga0070708_100370456
407 Ga0070678_100405520
408 Ga0070681_10272642
409 Ga0070707_100138412
410 Ga0070672_100265538
411 Ga0070686_100324516
412 Ga0070693_100114543
413 Ga0070665_100113052
414 Ga0068855_100098969
415 Ga0068857_100160424
416 Ga0068856_100403474
417 Ga0081455_10042648
418 Ga0081538_10000099
419 Ga0081538_10000623
420 Ga0081538_10001033
421 Ga0081538_10019166
422 Ga0081539_10007617
423 Ga0070717_10000001
424 Ga0070717_10006633
425 Ga0070717_10059896
426 Ga0070717_10072573
427 Ga0070717_10120907
428 Ga0070717_10227855
429 Ga0070717_10288874
430 Ga0075365_10000157
431 Ga0075365_10001681
432 Ga0075365_10006484
433 Ga0070715_10072791
434 Ga0070716_100067996
435 Ga0070712_100004215
436 Ga0070712_100027541
437 Ga0075431_100002759
438 Ga0075434_100023785
439 Ga0075429_100283393
440 Ga0068865_100043790
441 Ga0075436_100028388
442 Ga0105240_10134768
443 Ga0105240_10173041
444 Ga0105245_10044068
445 Ga0105248_10142251
446 Ga0105238_10452041
447 Ga0105239_10084576
448 Ga0105239_10088160
449 Ga0157369_10049304
450 Ga0157374_10407442
451 Ga0157372_10269007
452 Ga0157380_10489221
453 Ga0157376_10085319
454 Ga0213874_10000102
455 Ga0213874_10021306
456 Ga0213876_10003172
457 Ga0213876_10020641
458 Ga0213876_10064105
459 Ga0213876_10075568
460 Ga0213876_10076730
461 Ga0213876_10175466
462 Ga0213875_10000351
463 Ga0213875_10046194
464 Ga0207692_10000016
465 Ga0207692_10006077
466 Ga0207692_10193593
467 Ga0207695_10216563
468 Ga0207693_10000942
469 Ga0207663_10081959
470 Ga0207660_10244264
471 Ga0207657_10069531
472 Ga0207694_10295263
473 Ga0207687_10018155
474 Ga0207687_10059621
475 Ga0207700_10205443
476 Ga0207664_10003392
477 Ga0207664_10102221
478 Ga0207664_10160473
479 Ga0207664_10244816
480 Ga0207690_10000095
481 Ga0207665_10038992
482 Ga0207691_10196850
483 Ga0207711_10128070
484 Ga0207661_10164758
485 Ga0207661_10250670
486 Ga0207667_10047026
487 Ga0207677_10074038
488 Ga0207702_10372806
489 Ga0207674_10370277
490 Ga0207698_10434201
491 Ga0268264_10050547
492 Ga0316576_10021960
493 Ga0307413_10085963
494 Ga0307410_10061948
495 Ga0307410_10067278
496 Ga0307406_10024679
497 Ga0307409_100008349
498 Ga0307409_100501600
499 Ga0307416_100078398
500 Ga0307415_100032203
501 Ga0307415_100138137
502 Ga0373954_0091339
503 Ga0373955_0151793
504 Ga0373935_0275346
505 Ga0373937_0021151
506 Ga0316584_0018916
507 Ga0395899_0001904
508 Ga0395899_0002120
509 Ga0395900_0008035
510 Ga0395900_0012033
511 Ga0395900_0013891
512 Ga0395900_0025695
513 Ga0395900_0065032
514 Ga0395900_0267678
515 Ga0395898_0002063
516 Ga0395898_0003604
517 Ga0395898_0028618
518 Ga0395898_0088500
519 Ga0395898_0095548
520 Ga0395898_0211625
521 Ga0395898_0304553
522 Ga0395898_0555297
523 Ga0395898_0579631
524 Ga0395905_0005897
525 Ga0395905_0012633
526 Ga0395905_0028856
527 Ga0395905_0039239
528 Ga0395905_0125327
529 Ga0395905_0364642
530 Ga0436364_0358577
531 Ga0436364_0790855
532 Ga0436364_0838033
533 Ga0436364_0840900
534 Ga0436364_1229417
535 Ga0436364_1426665
536 Ga0395901_0006616
537 Ga0395901_0014444
538 Ga0395901_0021137
539 Ga0395901_0050962
540 Ga0395901_0059641
541 Ga0395901_0095260
542 Ga0395901_0489233
543 Ga0436365_0013991
544 Ga0436365_0025272
545 Ga0436365_0062040
546 Ga0436365_0095147
547 Ga0436365_0462535
548 Ga0436365_0720259
549 Ga0436365_1041614
550 Ga0436365_1120359
551 Ga0436365_1411275
552 Ga0436365_1486005
553 Ga0436365_1625258
554 Ga0436361_0842471
555 Ga0436363_0023518
556 Ga0436363_0074161
557 Ga0436363_0493572
558 Ga0436363_0700550
559 Ga0436362_0389186
560 Ga0436362_1152796
561 Ga0439439_0023920
562 Ga0439431_0024681
563 Ga0450915_002162
564 Ga0466969_0058777
565 Ga0466965_0035088
566 Ga0466966_0008157
567 Ga0466966_0088810
568 Ga0466966_0252048
569 Ga0466961_0006650
570 Ga0466961_0018734
571 Ga0466961_0078658
572 Ga0466961_0104172
573 Ga0466961_0391333
574 Ga0466963_0002619
575 Ga0466963_0003799
576 Ga0466963_0011899
577 Ga0466963_0018662
578 Ga0466963_0044357
579 Ga0466963_0095506
580 Ga0466963_0114624
581 Ga0466963_0250479
582 Ga0466971_0017704
583 Ga0466971_0036917
584 Ga0466968_0007357
585 Ga0466970_0162158
586 Ga0466970_0189499
587 Ga0466957_0031455
588 Ga0466957_0057677
589 Ga0466957_0093700
590 Ga0466957_0119658
591 Ga0466957_0251429
592 Ga0466957_0342478
593 Ga0466960_0064267
594 Ga0466960_0225255
595 Ga0466959_0017231
596 Ga0466959_0034204
597 Ga0466959_0125198
598 Ga0466959_0144778
599 Ga0466959_0161851
600 Ga0466959_0181752
601 Ga0466959_0185976
602 Ga0466959_0406084
603 Ga0466958_0006842
604 Ga0466958_0021518
605 Ga0466958_0026285
606 Ga0466958_0220290
607 Ga0466967_0000614
608 Ga0466967_0005224
609 Ga0466967_0022305
610 Ga0466967_0033117
611 Ga0466967_0048661
612 Ga0466967_0050993
613 Ga0466967_0059770
614 Ga0466967_0135903
615 Ga0466967_0195239
616 Ga0466967_0204960
617 Ga0466967_0289782
618 Ga0466967_0668243
619 Ga0495629_0183168
620 Ga0495641_0039801
621 Ga0495651_0005072
622 Ga0495653_0014238
623 Ga0495584_0057656
624 Ga0495584_0174990
625 Ga0495585_0129736
626 Ga0495596_0055560
627 Ga0495608_0002842
628 Ga0495618_0006254
629 Ga0495628_0058703
630 Ga0495609_0075097
631 Ga0495645_0059894
632 Ga0495635_0004649
633 Ga0495635_0311280
634 Ga0495659_0050358
635 Ga0495646_0038376
636 Ga0495658_0033237
637 Ga0495658_0161369
638 Ga0495613_0131638
639 Ga0495604_0005298
640 Ga0495674_0195180
641 Ga0495680_0065618
642 Ga0495593_0106790
643 Ga0495602_0016507
644 Ga0496100_0460159
645 Ga0496101_0151723
646 Ga0496102_0101192
647 Ga0496102_0227499
648 Ga0496104_0026563
649 Ga0496104_0250247
650 Ga0496105_0009143
651 Ga0496105_0032284
652 Ga0496106_0026470
653 Ga0496107_0312207
654 Ga0496108_0037687
655 Ga0496108_0051889
656 Ga0496108_0118282
657 Ga0496109_0012722
658 Ga0496109_0018040
659 Ga0496109_0215274
660 Ga0496110_0035647
661 Ga0496110_0227983
662 Ga0496111_0032761
663 Ga0496111_0097186
664 Ga0496111_0317659
665 Ga0496112_0002731
666 Ga0496112_0037516
667 Ga0496112_0061399
668 Ga0496112_0083198
669 Ga0496113_0029946
670 Ga0496113_0031502
671 Ga0496113_0050928
672 Ga0496113_0106111
673 Ga0496113_0717850
674 Ga0496114_0004212
675 Ga0496114_0018174
676 Ga0496115_0016920
677 Ga0496115_0066653
678 Ga0496121_0013406
679 Ga0501031_0007597
680 Ga0501031_0130566
681 Ga0501032_0144925
682 Ga0501034_0064949
683 Ga0501034_0240967
684 Ga0501034_0300335
685 Ga0501036_0010235
686 Ga0501036_0155021
687 Ga0501036_0241553
688 Ga0501037_0065949
689 Ga0501037_0073464
690 Ga0501038_0018169
691 Ga0501039_0083616
692 Ga0501039_0114068
693 Ga0501040_0006291
694 Ga0501040_0068674
695 Ga0501041_0178546
696 Ga0501042_0008233
697 Ga0501042_0041308
698 Ga0501042_0063320
699 Ga0501043_0055352
700 Ga0501046_0019635
701 Ga0501047_0057994
702 Ga0501047_0284858
703 Ga0501048_0014894
704 Ga0501048_0043609
705 Ga0501048_0147650
706 Ga0501067_0018060
707 Ga0501067_0195562
708 Ga0501068_0108137
709 Ga0501069_0016588
710 Ga0501069_0053833
711 Ga0501070_0035205
712 Ga0501071_0014735
713 Ga0501071_0090910
714 Ga0501072_0006148
715 Ga0501072_0160086
716 Ga0501072_0413543
717 Ga0501073_0276906
718 Ga0501074_0007289
719 Ga0501074_0096341
720 Ga0501075_0011437
721 Ga0501076_0007033
722 Ga0501076_0202845
723 Ga0501077_0090798
724 Ga0501077_0214912
725 Ga0501079_0016141
726 Ga0501079_0112108
727 Ga0501079_0137098
728 Ga0501081_0063787
729 Ga0501083_0184682
730 Ga0501035_0196685
731 Ga0501045_0243581
732 nmdc:mga0yw44_14739_c1
733 nmdc:mga0yw44_875_c1
734 nmdc:mga05p37_160973_c1
735 nmdc:mga09592_151600_c1
736 nmdc:mga09592_6559_c1
737 nmdc:mga06r32_234691_c1
738 nmdc:mga0n895_33618_c1
739 nmdc:mga0n895_434372_c1
740 nmdc:mga08x19_7047_c1
741 Ga0495612_0064629
742 Ga0495595_0028670
743 Ga0495619_0011182
744 Ga0501084_0010764
745 Ga0501084_0022867
746 Ga0587091_002005
747 Ga0587079_012967
748 Ga0501082_0188482
749 Ga0466962_0004893
750 Ga0466962_0008632
751 Ga0466962_0020519
752 Ga0466962_0039330
753 Ga0466962_0139367
754 Ga0530510_0010950
755 Ga0530510_0037571
756 Ga0530510_0071458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

28

216

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

34

281

0.89

PF08659

KR

KR domain

29

209

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

30

208

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rh4-assembly1.cif.gz_B actinorhodin ketoreductase, actkr, with nadph and inhibitor emodin 0.9238 7 241
6jhb-assembly1.cif.gz_B-2 crystal structure of nadph and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa 0.9182 1 244
4dc0-assembly1.cif.gz_B crystal structure of f189w actinorhodin polyketide ketoreductase with nadph 0.9179 7 241
4cql-assembly2.cif.gz_C crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9178 8 240
3wds-assembly1.cif.gz_C crystal structure of 3-quinuclidinone reductase from agrobacterium tumefaciens 0.9139 3 242
ID Description Score Start End Superfamily
af_A0A1D6GEP1_1_92_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 7 38 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9542 3 39 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 76 171 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9281 66 242 3.40.50.720
af_P05707_2_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9246 8 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D4B535-F1-model_v4 Short-chain dehydrogenase 0.9436 67 242 GO:0016616
AF-A0A7X3QL79-F1-model_v4 SDR family oxidoreductase 0.9351 5 171 GO:0016491
AF-A0A7V1QTB5-F1-model_v4 SDR family oxidoreductase 0.9344 1 245
AF-D9TIE3-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9339 1 173 GO:0016020
GO:0016491
AF-A0A1M3BLS1-F1-model_v4 3-ketoacyl-ACP reductase 0.9332 1 242 GO:0016616

Map