F428042

General Info

Members Datasets Scaffolds Average Seq Length
378 201 349 375

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10005987|Ga0207695_1000598714
Length 417
Sequence MTLEDMNLLRVTTKTTIINTNSLFLSIKLRAFRINLDAFLYPYRMKITEVKTKADKKAFLDIARIIYKDDKNWICPLDNDIEAVFDPEKNPFFKHGQCTRWILTNDNGQLIGRVAAFINEKKAYNYEQPTGGMGFFESINDEKAAFLLFDTAKEWLKARGMKAMDGPINFGENDNFWGLLADGFVPPSYGMNYNPPYYVGFFEKYGFKTQYEQITNHVDAHKPFPERFTKIAEWVAQKPGYEFKHLKASQIEKFAEDFMEIYNDGWKDFENFVPIVKDTILESFRKMRPLMDENLIWFAYVNDEPASFVVILPDANQMIKGLNGKLNLIGKFKFLYNKWKGVKRMRAIVMGTKQKFQKHGLESALFIKLKEYILPLKQYDELELSWVGDFNDKMIALHHSMGGVFGKKHLTMRYIFN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
17 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
18 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
19 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
20 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
21 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
22 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
23 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
24 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
25 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
26 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
29 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
30 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
31 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
138 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
139 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.8
Metatranscriptomes 0.26
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0
Rhizoplane 0.79
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2086071 2162886007 Bacteria 2940
2 JGI24737J22298_10000823 3300001990 Bacteria 11028
3 JGI24737J22298_10002459 3300001990 Bacteria 6598
4 JGI24737J22298_10005730 3300001990 Bacteria 4275
5 JGI24735J21928_10000001 3300002067 Bacteria 650042
6 JGI25162J39368_1000011 3300002737 Bacteria 379156
7 JGI25162J39368_1000733 3300002737 Bacteria 22513
8 JGI25152J39213_1000398 3300002773 Bacteria 26491
9 JGI25150J39212_1000030 3300002774 Bacteria 101822
10 JGI25151J46595_10000129 3300003187 Bacteria 101822
11 JGI25165J46597_1001509 3300003214 Bacteria 11814
12 JGI25153J46596_10000096 3300003215 Bacteria 101822
13 rootH2_10006566 3300003320 Bacteria 99379
14 rootH2_10041278 3300003320 Bacteria 10366
15 rootL2_10144824 3300003322 Bacteria 2869
16 rootH1_10008575 3300003316 Bacteria 11244
17 rootH1_10008575 3300003323 Bacteria 2599
18 rootH1_10096670 3300003323 Bacteria 4894
19 Ga0055536_1000086 3300003781 Bacteria 80100
20 Ga0055530_10002958 3300003791 Bacteria 10248
21 Ga0065714_10010040 3300005288 Bacteria 3703
22 Ga0065714_10011928 3300005288 Bacteria 2935
23 Ga0065714_10065719 3300005288 Bacteria 8736
24 Ga0065714_10066179 3300005288 Bacteria 7422
25 Ga0065704_10070286 3300005289 Bacteria 39355
26 Ga0070658_10000045 3300005327 Bacteria 130728
27 Ga0070676_10002144 3300005328 Bacteria 10050
28 Ga0070683_100039125 3300005329 Unclassified 4352
29 Ga0070683_100176201 3300005329 Bacteria 2030
30 Ga0070670_100133811 3300005331 Bacteria 2142
31 Ga0068868_100011469 3300005338 Bacteria 6454
32 Ga0068868_100033982 3300005338 Bacteria 3934
33 Ga0070660_100002654 3300005339 Bacteria 12286
34 Ga0070660_100017781 3300005339 Bacteria 5185
35 Ga0070671_100004208 3300005355 Bacteria 11381
36 Ga0070671_100017998 3300005355 Bacteria 5734
37 Ga0070673_100099134 3300005364 Bacteria 2396
38 Ga0070659_100000154 3300005366 Bacteria 52564
39 Ga0070659_100008857 3300005366 Bacteria 7375
40 Ga0070659_100018691 3300005366 Bacteria 5232
41 Ga0070667_100014189 3300005367 Bacteria 6581
42 Ga0070662_100000103 3300005457 Bacteria 46838
43 Ga0068867_100001225 3300005459 Bacteria 17675
44 Ga0070684_100057240 3300005535 Bacteria 3403
45 Ga0068853_100032578 3300005539 Unclassified 4415
46 Ga0068853_100102372 3300005539 Bacteria 2534
47 Ga0070665_100000018 3300005548 Bacteria 434118
48 Ga0070665_100000083 3300005548 Bacteria 181044
49 Ga0068855_100000227 3300005563 Bacteria 71930
50 Ga0068855_100004780 3300005563 Bacteria 16536
51 Ga0068855_100038463 3300005563 Bacteria 5684
52 Ga0068855_100055068 3300005563 Bacteria 4673
53 Ga0068855_100098839 3300005563 Bacteria 3361
54 Ga0068855_100151778 3300005563 Bacteria 2634
55 Ga0068854_100014005 3300005578 Bacteria 5277
56 Ga0068856_100009813 3300005614 Bacteria 9301
57 Ga0068856_100086971 3300005614 Bacteria 3106
58 Ga0068852_100002453 3300005616 Bacteria 12768
59 Ga0068858_100054352 3300005842 Bacteria 3703
60 Ga0068860_100000040 3300005843 Bacteria 231652
61 Ga0075366_10015837 3300006195 Bacteria 4328
62 Ga0075366_10022134 3300006195 Bacteria 3696
63 Ga0097621_100000041 3300006237 Bacteria 66329
64 Ga0097621_100000796 3300006237 Bacteria 22187
65 Ga0068871_100000029 3300006358 Bacteria 77924
66 Ga0068871_100000719 3300006358 Bacteria 22424
67 Ga0068865_100000886 3300006881 Bacteria 16967
68 Ga0105244_10016810 3300009036 Bacteria 4155
69 Ga0105240_10000010 3300009093 Bacteria 537830
70 Ga0105240_10006526 3300009093 Bacteria 17130
71 Ga0105240_10006933 3300009093 Bacteria 16551
72 Ga0105240_10051628 3300009093 Bacteria 5172
73 Ga0105240_10169011 3300009093 Bacteria 2591
74 Ga0105240_10223039 3300009093 Bacteria 2195
75 Ga0105240_10308911 3300009093 Bacteria 1806
76 Ga0105241_10005271 3300009174 Bacteria 9548
77 Ga0105241_10024043 3300009174 Bacteria 4524
78 Ga0105248_10001215 3300009177 Bacteria 28759
79 Ga0105237_10001190 3300009545 Bacteria 34836
80 Ga0105237_10003776 3300009545 Bacteria 17823
81 Ga0105237_10005875 3300009545 Bacteria 13760
82 Ga0105237_10007003 3300009545 Bacteria 12423
83 Ga0105237_10007552 3300009545 Bacteria 11881
84 Ga0105237_10063647 3300009545 Bacteria 3687
85 Ga0105237_10152405 3300009545 Bacteria 2308
86 Ga0105237_10187022 3300009545 Bacteria 2071
87 Ga0105237_10277430 3300009545 Bacteria 1679
88 Ga0105238_10072206 3300009551 Bacteria 3448
89 Ga0105249_10013587 3300009553 Bacteria 7193
90 Ga0105249_10283454 3300009553 Unclassified 1655
91 Ga0105239_10000002 3300010375 Bacteria 610298
92 Ga0105239_10000006 3300010375 Bacteria 442319
93 Ga0105239_10002369 3300010375 Bacteria 24039
94 Ga0105239_10003056 3300010375 Bacteria 20800
95 Ga0105239_10019909 3300010375 Bacteria 7406
96 Ga0105239_10020541 3300010375 Bacteria 7285
97 Ga0105239_10035026 3300010375 Bacteria 5513
98 Ga0105239_10294408 3300010375 Bacteria 1828
99 Ga0105239_10448520 3300010375 Bacteria 1463
100 Ga0157373_10000332 3300013100 Bacteria 38271
101 Ga0157373_10000496 3300013100 Bacteria 31139
102 Ga0157373_10002019 3300013100 Bacteria 15390
103 Ga0157373_10002319 3300013100 Bacteria 14426
104 Ga0157373_10063974 3300013100 Bacteria 2604
105 Ga0157371_10000141 3300013102 Bacteria 104396
106 Ga0157371_10000348 3300013102 Bacteria 59339
107 Ga0157371_10000869 3300013102 Bacteria 34259
108 Ga0157371_10017779 3300013102 Bacteria 5274
109 Ga0157371_10101244 3300013102 Bacteria 2044
110 Ga0157370_10007485 3300013104 Bacteria 11861
111 Ga0157370_10016882 3300013104 Bacteria 7379
112 Ga0157370_10080005 3300013104 Bacteria 3077
113 Ga0157370_10117471 3300013104 Bacteria 2484
114 Ga0157370_10120077 3300013104 Bacteria 2454
115 Ga0157370_10123351 3300013104 Bacteria 2419
116 Ga0157369_10000005 3300013105 Bacteria 470816
117 Ga0157369_10005105 3300013105 Bacteria 15365
118 Ga0157369_10035439 3300013105 Bacteria 5471
119 Ga0157369_10147238 3300013105 Bacteria 2489
120 Ga0157374_10000129 3300013296 Bacteria 69468
121 Ga0157374_10002780 3300013296 Bacteria 14698
122 Ga0157374_10009486 3300013296 Bacteria 8358
123 Ga0157378_10034532 3300013297 Unclassified 4472
124 Ga0157378_10097931 3300013297 Bacteria 2674
125 Ga0157378_10261262 3300013297 Bacteria 1661
126 Ga0163162_10000068 3300013306 Bacteria 97068
127 Ga0163162_10000205 3300013306 Bacteria 54827
128 Ga0163162_10005537 3300013306 Bacteria 12206
129 Ga0163162_10020843 3300013306 Bacteria 6445
130 Ga0163162_10051854 3300013306 Bacteria 4118
131 Ga0163162_10099436 3300013306 Bacteria 3000
132 Ga0157372_10000016 3300013307 Bacteria 220177
133 Ga0157372_10000418 3300013307 Bacteria 46635
134 Ga0157372_10001333 3300013307 Bacteria 26670
135 Ga0157372_10006352 3300013307 Bacteria 12570
136 Ga0157375_10004424 3300013308 Bacteria 12203
137 Ga0157375_10012166 3300013308 Bacteria 7627
138 Ga0163163_10000377 3300014325 Bacteria 42550
139 Ga0182008_10000009 3300014497 Bacteria 331416
140 Ga0182008_10000128 3300014497 Bacteria 57510
141 Ga0182008_10000159 3300014497 Bacteria 53199
142 Ga0182008_10031410 3300014497 Bacteria 2674
143 Ga0182008_10034974 3300014497 Bacteria 2518
144 Ga0157379_10022290 3300014968 Bacteria 5611
145 Ga0157376_10005526 3300014969 Bacteria 8832
146 Ga0157376_10138879 3300014969 Bacteria 2178
147 Ga0182006_1000743 3300015261 Bacteria 22312
148 Ga0182006_1002271 3300015261 Bacteria 10613
149 Ga0182006_1003034 3300015261 Bacteria 8828
150 Ga0182007_10000080 3300015262 Bacteria 73401
151 Ga0182007_10006303 3300015262 Bacteria 5102
152 Ga0182007_10024971 3300015262 Bacteria 2085
153 Ga0183373_1003 3300015682 Bacteria 558813
154 Ga0163161_10001556 3300017792 Bacteria 16932
155 Ga0163161_10006049 3300017792 Bacteria 8389
156 Ga0163161_10007957 3300017792 Bacteria 7335
157 Ga0163161_10008964 3300017792 Bacteria 6919
158 Ga0206351_10899269 3300020077 Bacteria 3977
159 Ga0207427_100090 3300025231 Bacteria 133759
160 Ga0209437_100017 3300025233 Bacteria 694471
161 Ga0209437_100034 3300025233 Bacteria 494007
162 Ga0207425_1000004 3300025245 Bacteria 1092421
163 Ga0209026_1000602 3300025250 Bacteria 23171
164 Ga0209026_1001610 3300025250 Bacteria 9667
165 Ga0209129_1000005 3300025258 Bacteria 777812
166 Ga0209233_1000038 3300025261 Bacteria 548972
167 Ga0209233_1015307 3300025261 Bacteria 2140
168 Ga0209676_1000001 3300025292 Bacteria 1852142
169 Ga0209025_1000009 3300025294 Bacteria 1092561
170 Ga0209758_1000010 3300025297 Bacteria 1092782
171 Ga0209050_1000408 3300025298 Bacteria 80140
172 Ga0207647_10000062 3300025904 Bacteria 83809
173 Ga0207647_10000263 3300025904 Bacteria 43120
174 Ga0207645_10005692 3300025907 Bacteria 9002
175 Ga0207705_10000080 3300025909 Bacteria 119562
176 Ga0207654_10024090 3300025911 Bacteria 3268
177 Ga0207654_10032404 3300025911 Bacteria 2888
178 Ga0207707_10192846 3300025912 Bacteria 1777
179 Ga0207695_10000019 3300025913 Bacteria 732137
180 Ga0207695_10005987 3300025913 Bacteria 15904
181 Ga0207695_10019778 3300025913 Bacteria 7739
182 Ga0207695_10327276 3300025913 Bacteria 1421
183 Ga0207695_10332438 3300025913 Bacteria 1408
184 Ga0207671_10000667 3300025914 Bacteria 44873
185 Ga0207671_10001276 3300025914 Bacteria 29637
186 Ga0207671_10007625 3300025914 Bacteria 9354
187 Ga0207671_10019724 3300025914 Bacteria 5148
188 Ga0207671_10035698 3300025914 Bacteria 3687
189 Ga0207671_10095259 3300025914 Bacteria 2248
190 Ga0207671_10157324 3300025914 Bacteria 1758
191 Ga0207671_10223219 3300025914 Bacteria 1476
192 Ga0207657_10055933 3300025919 Bacteria 3406
193 Ga0207652_10015415 3300025921 Bacteria 6209
194 Ga0207644_10004371 3300025931 Bacteria 9169
195 Ga0207644_10092704 3300025931 Unclassified 2254
196 Ga0207690_10000518 3300025932 Bacteria 25073
197 Ga0207690_10005669 3300025932 Bacteria 7379
198 Ga0207690_10006760 3300025932 Bacteria 6796
199 Ga0207706_10004297 3300025933 Bacteria 13389
200 Ga0207704_10000037 3300025938 Bacteria 93990
201 Ga0207691_10005844 3300025940 Bacteria 11903
202 Ga0207661_10089955 3300025944 Bacteria 2555
203 Ga0207667_10000217 3300025949 Bacteria 80489
204 Ga0207667_10004777 3300025949 Bacteria 16568
205 Ga0207667_10010632 3300025949 Bacteria 10742
206 Ga0207667_10016394 3300025949 Bacteria 8375
207 Ga0207712_10123087 3300025961 Bacteria 1965
208 Ga0207640_10009616 3300025981 Bacteria 5420
209 Ga0207658_10033324 3300025986 Unclassified 3674
210 Ga0207677_10151425 3300026023 Bacteria 1790
211 Ga0207639_10038759 3300026041 Bacteria 3547
212 Ga0207639_10180672 3300026041 Bacteria 1794
213 Ga0207702_10000883 3300026078 Bacteria 31196
214 Ga0207702_10014288 3300026078 Bacteria 6592
215 Ga0207648_10006640 3300026089 Bacteria 11486
216 Ga0207683_10068687 3300026121 Bacteria 3129
217 Ga0207698_10031924 3300026142 Bacteria 3809
218 Ga0268266_10000095 3300028379 Bacteria 186169
219 Ga0307517_10005537 3300028786 Bacteria 18980
220 Ga0307515_10001752 3300028794 Bacteria 48338
221 Ga0307515_10003953 3300028794 Bacteria 30928
222 Ga0307515_10065830 3300028794 Bacteria 5033
223 Ga0265338_10014893 3300028800 Bacteria 8601
224 Ga0316177_1158708 3300030731 Bacteria 7707
225 Ga0316176_1034171 3300030732 Bacteria 18263
226 Ga0316183_1127428 3300030742 Bacteria 5052
227 Ga0316181_1213025 3300030744 Bacteria 6336
228 Ga0316182_1214835 3300030745 Bacteria 1920
229 Ga0265316_10002396 3300031344 Bacteria 19512
230 Ga0265316_10100329 3300031344 Bacteria 2201
231 Ga0307408_100002023 3300031548 Bacteria 14625
232 Ga0307408_100018224 3300031548 Bacteria 4712
233 Ga0316576_10006835 3300031727 Bacteria 7130
234 Ga0316576_10079591 3300031727 Bacteria 2429
235 Ga0316578_10132613 3300031728 Unclassified 1499
236 Ga0307405_10000030 3300031731 Bacteria 99574
237 Ga0307405_10032301 3300031731 Bacteria 3093
238 Ga0316577_10056142 3300031733 Bacteria 2197
239 Ga0307407_10000023 3300031903 Bacteria 118352
240 Ga0307412_10000084 3300031911 Bacteria 90908
241 Ga0307412_10019661 3300031911 Bacteria 4096
242 Ga0307409_100045879 3300031995 Bacteria 3304
243 Ga0307416_100000049 3300032002 Bacteria 118358
244 Ga0307416_100241924 3300032002 Bacteria 1749
245 Ga0307414_10000555 3300032004 Bacteria 19494
246 Ga0307414_10002575 3300032004 Bacteria 9540
247 Ga0307414_10007494 3300032004 Bacteria 6132
248 Ga0307414_10008951 3300032004 Bacteria 5721
249 Ga0307414_10020707 3300032004 Bacteria 4106
250 Ga0307414_10044122 3300032004 Bacteria 3042
251 Ga0307414_10045850 3300032004 Bacteria 2996
252 Ga0307414_10304791 3300032004 Bacteria 1349
253 Ga0307411_10056699 3300032005 Bacteria 2584
254 Ga0307507_10005801 3300033179 Bacteria 19805
255 Ga0307510_10003047 3300033180 Bacteria 19348
256 Ga0316582_0018814 3300036647 Bacteria 4029
257 Ga0316584_0003350 3300036712 Bacteria 10384
258 Ga0316584_0020175 3300036712 Bacteria 4828
259 Ga0395899_0000002 3300037312 Bacteria 1324310
260 Ga0395899_0000283 3300037312 Bacteria 65893
261 Ga0395900_0000095 3300037418 Bacteria 164383
262 Ga0395900_0000694 3300037418 Bacteria 44919
263 Ga0395900_0007931 3300037418 Bacteria 10931
264 Ga0395898_0046755 3300037466 Bacteria 4250
265 Ga0395905_0000841 3300037471 Bacteria 40055
266 Ga0395905_0010062 3300037471 Bacteria 9219
267 Ga0395901_0000890 3300038443 Bacteria 32857
268 Ga0395901_0006685 3300038443 Bacteria 11656
269 Ga0395901_0112884 3300038443 Bacteria 2854
270 Ga0400483_002155 3300039062 Bacteria 26328
271 Ga0400483_260295 3300039062 Bacteria 14690
272 Ga0439445_0021405 3300042004 Bacteria 1624
273 Ga0451577_0000379 3300042876 Bacteria 82741
274 Ga0451577_0001044 3300042876 Bacteria 40023
275 Ga0451577_0011295 3300042876 Bacteria 8455
276 Ga0451577_0015505 3300042876 Bacteria 7089
277 Ga0451577_0031125 3300042876 Bacteria 4816
278 Ga0451577_0110580 3300042876 Unclassified 2458
279 Ga0451577_0146340 3300042876 Bacteria 2125
280 Ga0466969_0055989 3300044656 Bacteria 1927
281 Ga0453683_0000005 3300044673 Bacteria 741657
282 Ga0453683_0000195 3300044673 Bacteria 82741
283 Ga0453683_0001595 3300044673 Bacteria 19160
284 Ga0453683_0087237 3300044673 Bacteria 1955
285 Ga0466966_0009096 3300044684 Bacteria 6579
286 Ga0466961_0007943 3300044693 Bacteria 6760
287 Ga0453684_0000256 3300044712 Bacteria 228862
288 Ga0453684_0000284 3300044712 Bacteria 218640
289 Ga0453684_0000610 3300044712 Bacteria 131386
290 Ga0453684_0001147 3300044712 Bacteria 82741
291 Ga0453684_0001203 3300044712 Bacteria 79834
292 Ga0453684_0009273 3300044712 Bacteria 17274
293 Ga0453684_0016211 3300044712 Bacteria 11673
294 Ga0453684_0035380 3300044712 Bacteria 6904
295 Ga0453684_0035478 3300044712 Bacteria 6890
296 Ga0453684_0063194 3300044712 Bacteria 4738
297 Ga0453684_0189642 3300044712 Bacteria 2406
298 Ga0453684_0407730 3300044712 Bacteria 1521
299 Ga0451576_0000193 3300045051 Bacteria 154108
300 Ga0451576_0000378 3300045051 Bacteria 104355
301 Ga0451576_0000528 3300045051 Bacteria 82741
302 Ga0451576_0003862 3300045051 Bacteria 20098
303 Ga0451576_0012262 3300045051 Bacteria 9648
304 Ga0495650_0000014 3300046471 Bacteria 581606
305 Ga0495585_0000408 3300046492 Bacteria 41651
306 Ga0495585_0002656 3300046492 Bacteria 12556
307 Ga0495607_0104787 3300046501 Unclassified 1508
308 Ga0495606_0000241 3300046507 Bacteria 96663
309 Ga0495606_0017245 3300046507 Bacteria 5469
310 Ga0495606_0030229 3300046507 Bacteria 3788
311 Ga0495610_0000565 3300046512 Bacteria 37056
312 Ga0495610_0004805 3300046512 Bacteria 9859
313 Ga0495610_0005548 3300046512 Bacteria 8931
314 Ga0495616_0003236 3300046513 Bacteria 10478
315 Ga0495616_0005420 3300046513 Bacteria 7861
316 Ga0495609_0020847 3300046538 Bacteria 3025
317 Ga0495633_0000044 3300046558 Bacteria 171185
318 Ga0495633_0002743 3300046558 Bacteria 12174
319 Ga0495668_0000012 3300046616 Bacteria 458817
320 Ga0495668_0072364 3300046616 Bacteria 1894
321 Ga0495625_0000003 3300046660 Bacteria 686847
322 Ga0495625_0003718 3300046660 Bacteria 14874
323 Ga0495625_0025434 3300046660 Bacteria 4491
324 Ga0495625_0121645 3300046660 Bacteria 1775
325 Ga0495661_0002857 3300046665 Bacteria 13074
326 Ga0495661_0034927 3300046665 Bacteria 3159
327 Ga0495649_0000002 3300046694 Bacteria 1093458
328 Ga0495683_0011665 3300047323 Bacteria 4624
329 Ga0495687_000785 3300047443 Bacteria 34129
330 Ga0495687_015019 3300047443 Bacteria 3954
331 Ga0495686_0000582 3300047472 Bacteria 51799
332 Ga0495686_0001784 3300047472 Bacteria 21898
333 Ga0495614_0014350 3300048089 Bacteria 3468
334 Ga0496100_0017392 3300048903 Bacteria 4243
335 Ga0496115_0039260 3300048918 Bacteria 3759
336 Ga0496122_0001073 3300048925 Bacteria 47498
337 Ga0496125_0053407 3300048928 Bacteria 3313
338 Ga0501037_0067238 3300049573 Bacteria 2610
339 Ga0501047_0092245 3300049581 Bacteria 2907
340 Ga0501223_000832 3300049663 Bacteria 7325
341 nmdc:mga0k408_367_c2 3300050493 Bacteria 5439
342 nmdc:mga0k408_608_c1 3300050493 Bacteria 9462
343 Ga0500635_0000725 3300053080 Bacteria 8283
344 Ga0500608_001234 3300053122 Bacteria 9125
345 Ga0500608_009194 3300053122 Bacteria 4187
346 Ga0500618_000002 3300053125 Bacteria 370822
347 Ga0500568_0034150 3300053139 Bacteria 2082
348 Ga0500622_0000509 3300053156 Bacteria 36122
349 Ga0500624_000602 3300053157 Bacteria 9830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0018814 Ga0316582_0018814_12_1133 328
2 3300053139 Ga0500568_0034150 Ga0500568_0034150_56_1087 341
3 3300045051 Ga0451576_0012262 Ga0451576_0012262_7737_8954 351
4 3300020077 Ga0206351_10899269 Ga0206351_108992694 353
5 3300025940 Ga0207691_10005844 Ga0207691_100058443 355
6 3300044712 Ga0453684_0009273 Ga0453684_0009273_8201_9433 357
7 3300044712 Ga0453684_0035478 Ga0453684_0035478_4605_5831 357
8 3300031727 Ga0316576_10006835 Ga0316576_100068358 358
9 3300031728 Ga0316578_10132613 Ga0316578_101326131 358
10 3300036712 Ga0316584_0020175 Ga0316584_0020175_2516_3733 358
11 3300042876 Ga0451577_0011295 Ga0451577_0011295_122_1321 358
12 3300044712 Ga0453684_0000256 Ga0453684_0000256_55987_57177 358
13 3300044712 Ga0453684_0000284 Ga0453684_0000284_47061_48260 358
14 3300042876 Ga0451577_0110580 Ga0451577_0110580_1004_2167 359
15 3300031344 Ga0265316_10100329 Ga0265316_101003291 362
16 3300042876 Ga0451577_0031125 Ga0451577_0031125_1153_2370 364
17 3300044712 Ga0453684_0016211 Ga0453684_0016211_1511_2728 364
18 3300032004 Ga0307414_10020707 Ga0307414_100207074 366
19 iso_pu_bacteria 2842903701 2842906859 366
20 iso_pu_bacteria 2585427687 2586208045 368
21 iso_pu_bacteria 2738541283 2738753946 368
22 iso_pu_bacteria 2738541302 2738853416 368
23 iso_pu_bacteria 2738543023 2739304721 368
24 iso_pu_bacteria 2739367651 2739591117 368
25 iso_pu_bacteria 2739367663 2739644745 368
26 iso_pu_bacteria 2818991437 2819548900 368
27 iso_pu_bacteria 2842722452 2842723375 368
28 iso_pu_bacteria 2842909656 2842909868 368
29 iso_pu_bacteria 2849281842 2849286440 368
30 iso_pu_bacteria 2852627209 2852627569 368
31 iso_pu_bacteria 2857627736 2857628746 368
32 iso_pu_bacteria 2884933994 2884936966 368
33 iso_pu_bacteria 2895498888 2895502352 368
34 iso_pu_bacteria 2902048731 2902051270 368
35 iso_pu_bacteria 2904445276 2904446069 368
36 iso_pu_bacteria 2919186247 2919187738 368
37 iso_pu_bacteria 2939664404 2939664995 368
38 iso_pu_bacteria 2945997725 2946000181 368
39 iso_pu_bacteria 2954016120 2954017097 368
40 iso_pu_bacteria 2977232053 2977232976 368
41 iso_pu_bacteria 2599185184 2599477263 369
42 iso_pu_bacteria 2739367656 2739615519 369
43 iso_pu_bacteria 2852623160 2852624114 369
44 iso_pu_bacteria 2919437846 2919440764 369
45 iso_pu_bacteria 2928078545 2928079179 369
46 iso_pu_bacteria 2928147474 2928148450 369
47 iso_pu_bacteria 2932082852 2932085747 369
48 3300030731 Ga0316177_1158708 Ga0316177_11587088 370
49 3300030732 Ga0316176_1034171 Ga0316176_103417112 370
50 3300030742 Ga0316183_1127428 Ga0316183_11274283 370
51 3300030744 Ga0316181_1213025 Ga0316181_12130255 370
52 3300030745 Ga0316182_1214835 Ga0316182_12148353 370
53 3300031731 Ga0307405_10032301 Ga0307405_100323014 371
54 3300031911 Ga0307412_10019661 Ga0307412_100196613 371
55 3300049663 Ga0501223_000832 Ga0501223_000832_5977_7092 371
56 3300001990 JGI24737J22298_10002459 JGI24737J22298_100024595 372
57 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011149 372
58 3300003781 Ga0055536_1000086 Ga0055536_100008619 372
59 3300003791 Ga0055530_10002958 Ga0055530_100029587 372
60 3300005288 Ga0065714_10010040 Ga0065714_100100403 372
61 3300005288 Ga0065714_10065719 Ga0065714_100657193 372
62 3300005329 Ga0070683_100039125 Ga0070683_1000391253 372
63 3300005331 Ga0070670_100133811 Ga0070670_1001338112 372
64 3300005339 Ga0070660_100002654 Ga0070660_1000026542 372
65 3300005355 Ga0070671_100004208 Ga0070671_1000042082 372
66 3300005366 Ga0070659_100000154 Ga0070659_10000015416 372
67 3300005366 Ga0070659_100018691 Ga0070659_1000186912 372
68 3300005367 Ga0070667_100014189 Ga0070667_1000141894 372
69 3300005535 Ga0070684_100057240 Ga0070684_1000572401 372
70 3300005563 Ga0068855_100000227 Ga0068855_10000022765 372
71 3300005563 Ga0068855_100004780 Ga0068855_10000478012 372
72 3300005563 Ga0068855_100055068 Ga0068855_1000550684 372
73 3300005578 Ga0068854_100014005 Ga0068854_1000140053 372
74 3300005842 Ga0068858_100054352 Ga0068858_1000543522 372
75 3300006195 Ga0075366_10015837 Ga0075366_100158375 372
76 3300006237 Ga0097621_100000796 Ga0097621_10000079612 372
77 3300006358 Ga0068871_100000029 Ga0068871_10000002953 372
78 3300009036 Ga0105244_10016810 Ga0105244_100168105 372
79 3300009093 Ga0105240_10169011 Ga0105240_101690112 372
80 3300009093 Ga0105240_10223039 Ga0105240_102230393 372
81 3300009177 Ga0105248_10001215 Ga0105248_1000121512 372
82 3300009545 Ga0105237_10005875 Ga0105237_1000587514 372
83 3300009545 Ga0105237_10187022 Ga0105237_101870222 372
84 3300009545 Ga0105237_10277430 Ga0105237_102774302 372
85 3300009553 Ga0105249_10013587 Ga0105249_100135872 372
86 3300009553 Ga0105249_10283454 Ga0105249_102834542 372
87 3300010375 Ga0105239_10000002 Ga0105239_1000000239 372
88 3300010375 Ga0105239_10020541 Ga0105239_100205412 372
89 3300010375 Ga0105239_10035026 Ga0105239_100350262 372
90 3300013100 Ga0157373_10000332 Ga0157373_100003327 372
91 3300013100 Ga0157373_10002019 Ga0157373_100020194 372
92 3300013100 Ga0157373_10063974 Ga0157373_100639742 372
93 3300013102 Ga0157371_10000141 Ga0157371_1000014146 372
94 3300013102 Ga0157371_10000348 Ga0157371_1000034834 372
95 3300013104 Ga0157370_10007485 Ga0157370_100074854 372
96 3300013104 Ga0157370_10016882 Ga0157370_100168827 372
97 3300013104 Ga0157370_10117471 Ga0157370_101174713 372
98 3300013105 Ga0157369_10000005 Ga0157369_10000005371 372
99 3300013105 Ga0157369_10147238 Ga0157369_101472383 372
100 3300013297 Ga0157378_10034532 Ga0157378_100345323 372
101 3300013297 Ga0157378_10097931 Ga0157378_100979313 372
102 3300013306 Ga0163162_10000205 Ga0163162_1000020514 372
103 3300013306 Ga0163162_10005537 Ga0163162_100055376 372
104 3300013306 Ga0163162_10020843 Ga0163162_100208435 372
105 3300013306 Ga0163162_10051854 Ga0163162_100518544 372
106 3300013306 Ga0163162_10099436 Ga0163162_100994363 372
107 3300013307 Ga0157372_10000418 Ga0157372_1000041815 372
108 3300013307 Ga0157372_10006352 Ga0157372_100063526 372
109 3300014325 Ga0163163_10000377 Ga0163163_1000037725 372
110 3300014497 Ga0182008_10000128 Ga0182008_1000012866 372
111 3300014497 Ga0182008_10000159 Ga0182008_1000015914 372
112 3300014497 Ga0182008_10031410 Ga0182008_100314102 372
113 3300014497 Ga0182008_10034974 Ga0182008_100349742 372
114 3300014968 Ga0157379_10022290 Ga0157379_100222904 372
115 3300014969 Ga0157376_10005526 Ga0157376_100055264 372
116 3300015261 Ga0182006_1000743 Ga0182006_10007433 372
117 3300015261 Ga0182006_1003034 Ga0182006_10030343 372
118 3300015262 Ga0182007_10000080 Ga0182007_1000008051 372
119 3300015262 Ga0182007_10006303 Ga0182007_100063034 372
120 3300015682 Ga0183373_1003 Ga0183373_1003188 372
121 3300017792 Ga0163161_10001556 Ga0163161_100015568 372
122 3300017792 Ga0163161_10006049 Ga0163161_100060493 372
123 3300017792 Ga0163161_10007957 Ga0163161_100079573 372
124 3300017792 Ga0163161_10008964 Ga0163161_100089645 372
125 3300025233 Ga0209437_100017 Ga0209437_100017312 372
126 3300025250 Ga0209026_1000602 Ga0209026_100060210 372
127 3300025292 Ga0209676_1000001 Ga0209676_1000001318 372
128 3300025298 Ga0209050_1000408 Ga0209050_100040818 372
129 3300025904 Ga0207647_10000263 Ga0207647_1000026336 372
130 3300025913 Ga0207695_10332438 Ga0207695_103324381 372
131 3300025914 Ga0207671_10095259 Ga0207671_100952592 372
132 3300025914 Ga0207671_10157324 Ga0207671_101573242 372
133 3300025919 Ga0207657_10055933 Ga0207657_100559332 372
134 3300025931 Ga0207644_10092704 Ga0207644_100927042 372
135 3300025932 Ga0207690_10000518 Ga0207690_1000051813 372
136 3300025932 Ga0207690_10006760 Ga0207690_100067609 372
137 3300025944 Ga0207661_10089955 Ga0207661_100899552 372
138 3300025949 Ga0207667_10000217 Ga0207667_1000021714 372
139 3300025949 Ga0207667_10004777 Ga0207667_1000477712 372
140 3300025949 Ga0207667_10016394 Ga0207667_100163942 372
141 3300025981 Ga0207640_10009616 Ga0207640_100096163 372
142 3300025986 Ga0207658_10033324 Ga0207658_100333242 372
143 3300026078 Ga0207702_10000883 Ga0207702_1000088323 372
144 3300026142 Ga0207698_10031924 Ga0207698_100319244 372
145 3300028794 Ga0307515_10001752 Ga0307515_1000175213 372
146 3300028794 Ga0307515_10003953 Ga0307515_1000395328 372
147 3300028800 Ga0265338_10014893 Ga0265338_1001489310 372
148 3300031548 Ga0307408_100002023 Ga0307408_1000020233 372
149 3300031548 Ga0307408_100018224 Ga0307408_1000182244 372
150 3300031731 Ga0307405_10000030 Ga0307405_1000003076 372
151 3300031903 Ga0307407_10000023 Ga0307407_1000002344 372
152 3300031995 Ga0307409_100045879 Ga0307409_1000458794 372
153 3300032002 Ga0307416_100000049 Ga0307416_10000004968 372
154 3300032002 Ga0307416_100241924 Ga0307416_1002419241 372
155 3300032004 Ga0307414_10002575 Ga0307414_100025753 372
156 3300032004 Ga0307414_10007494 Ga0307414_100074942 372
157 3300032004 Ga0307414_10008951 Ga0307414_100089516 372
158 3300032004 Ga0307414_10045850 Ga0307414_100458503 372
159 3300032005 Ga0307411_10056699 Ga0307411_100566992 372
160 3300033179 Ga0307507_10005801 Ga0307507_1000580110 372
161 3300037312 Ga0395899_0000002 Ga0395899_0000002_752202_753323 372
162 3300038443 Ga0395901_0112884 Ga0395901_0112884_1102_2220 372
163 3300042004 Ga0439445_0021405 Ga0439445_0021405_252_1370 372
164 3300042876 Ga0451577_0000379 Ga0451577_0000379_9714_10877 372
165 3300042876 Ga0451577_0001044 Ga0451577_0001044_24210_25373 372
166 3300042876 Ga0451577_0146340 Ga0451577_0146340_21_1184 372
167 3300044673 Ga0453683_0000005 Ga0453683_0000005_631328_632491 372
168 3300044673 Ga0453683_0000195 Ga0453683_0000195_71865_73028 372
169 3300044673 Ga0453683_0087237 Ga0453683_0087237_365_1528 372
170 3300044712 Ga0453684_0000610 Ga0453684_0000610_109704_110867 372
171 3300044712 Ga0453684_0001147 Ga0453684_0001147_71865_73028 372
172 3300044712 Ga0453684_0035380 Ga0453684_0035380_2049_3215 372
173 3300044712 Ga0453684_0063194 Ga0453684_0063194_1003_2124 372
174 3300044712 Ga0453684_0407730 Ga0453684_0407730_292_1455 372
175 3300045051 Ga0451576_0000193 Ga0451576_0000193_43238_44401 372
176 3300045051 Ga0451576_0000528 Ga0451576_0000528_71865_73028 372
177 3300045051 Ga0451576_0003862 Ga0451576_0003862_13826_14989 372
178 3300046501 Ga0495607_0104787 Ga0495607_0104787_106_1224 372
179 3300046507 Ga0495606_0017245 Ga0495606_0017245_1811_2929 372
180 3300046512 Ga0495610_0000565 Ga0495610_0000565_25441_26559 372
181 3300046512 Ga0495610_0005548 Ga0495610_0005548_6781_7899 372
182 3300046538 Ga0495609_0020847 Ga0495609_0020847_1084_2202 372
183 3300046558 Ga0495633_0000044 Ga0495633_0000044_22460_23578 372
184 3300046616 Ga0495668_0000012 Ga0495668_0000012_245833_246951 372
185 3300046660 Ga0495625_0025434 Ga0495625_0025434_303_1421 372
186 3300046665 Ga0495661_0002857 Ga0495661_0002857_509_1627 372
187 3300047472 Ga0495686_0001784 Ga0495686_0001784_1718_2836 372
188 3300048089 Ga0495614_0014350 Ga0495614_0014350_1541_2659 372
189 3300048903 Ga0496100_0017392 Ga0496100_0017392_25_1146 372
190 3300048918 Ga0496115_0039260 Ga0496115_0039260_1070_2188 372
191 3300048925 Ga0496122_0001073 Ga0496122_0001073_11011_12129 372
192 3300048928 Ga0496125_0053407 Ga0496125_0053407_2028_3146 372
193 3300049573 Ga0501037_0067238 Ga0501037_0067238_828_1949 372
194 3300049581 Ga0501047_0092245 Ga0501047_0092245_111_1232 372
195 3300050493 nmdc:mga0k408_367_c2 nmdc:mga0k408_367_c2_637_1755 372
196 3300050493 nmdc:mga0k408_608_c1 nmdc:mga0k408_608_c1_711_1829 372
197 3300053122 Ga0500608_001234 Ga0500608_001234_617_1735 372
198 3300053125 Ga0500618_000002 Ga0500618_000002_213664_214782 372
199 3300053156 Ga0500622_0000509 Ga0500622_0000509_16765_17883 372
200 3300053157 Ga0500624_000602 Ga0500624_000602_8578_9696 372
201 3300001990 JGI24737J22298_10000823 JGI24737J22298_100008235 373
202 3300001990 JGI24737J22298_10005730 JGI24737J22298_100057303 373
203 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001365 373
204 3300002737 JGI25162J39368_1000733 JGI25162J39368_100073322 373
205 3300003214 JGI25165J46597_1001509 JGI25165J46597_10015095 373
206 3300003320 rootH2_10006566 rootH2_1000656610 373
207 3300003320 rootH2_10041278 rootH2_100412784 373
208 3300003322 rootL2_10144824 rootL2_101448244 373
209 3300003323 rootH1_10008575 rootH1_100085755 373
210 3300003323 rootH1_10096670 rootH1_100966701 373
211 3300005288 Ga0065714_10011928 Ga0065714_100119283 373
212 3300005289 Ga0065704_10070286 Ga0065704_1007028628 373
213 3300005328 Ga0070676_10002144 Ga0070676_100021447 373
214 3300005338 Ga0068868_100011469 Ga0068868_1000114694 373
215 3300005338 Ga0068868_100033982 Ga0068868_1000339823 373
216 3300005339 Ga0070660_100017781 Ga0070660_1000177816 373
217 3300005355 Ga0070671_100017998 Ga0070671_1000179985 373
218 3300005364 Ga0070673_100099134 Ga0070673_1000991343 373
219 3300005366 Ga0070659_100008857 Ga0070659_1000088575 373
220 3300005457 Ga0070662_100000103 Ga0070662_10000010310 373
221 3300005459 Ga0068867_100001225 Ga0068867_1000012254 373
222 3300005539 Ga0068853_100032578 Ga0068853_1000325784 373
223 3300005539 Ga0068853_100102372 Ga0068853_1001023723 373
224 3300005548 Ga0070665_100000018 Ga0070665_100000018134 373
225 3300005548 Ga0070665_100000083 Ga0070665_10000008351 373
226 3300005563 Ga0068855_100098839 Ga0068855_1000988394 373
227 3300005563 Ga0068855_100151778 Ga0068855_1001517783 373
228 3300005614 Ga0068856_100009813 Ga0068856_1000098136 373
229 3300005616 Ga0068852_100002453 Ga0068852_10000245312 373
230 3300005843 Ga0068860_100000040 Ga0068860_100000040201 373
231 3300006195 Ga0075366_10022134 Ga0075366_100221343 373
232 3300006237 Ga0097621_100000041 Ga0097621_10000004141 373
233 3300006358 Ga0068871_100000719 Ga0068871_10000071911 373
234 3300006881 Ga0068865_100000886 Ga0068865_10000088615 373
235 3300009093 Ga0105240_10000010 Ga0105240_10000010325 373
236 3300009093 Ga0105240_10006526 Ga0105240_100065265 373
237 3300009093 Ga0105240_10006933 Ga0105240_1000693314 373
238 3300009093 Ga0105240_10051628 Ga0105240_100516282 373
239 3300009093 Ga0105240_10308911 Ga0105240_103089112 373
240 3300009174 Ga0105241_10005271 Ga0105241_100052719 373
241 3300009174 Ga0105241_10024043 Ga0105241_100240433 373
242 3300009545 Ga0105237_10001190 Ga0105237_1000119025 373
243 3300009545 Ga0105237_10003776 Ga0105237_100037767 373
244 3300009545 Ga0105237_10007003 Ga0105237_1000700310 373
245 3300009545 Ga0105237_10007552 Ga0105237_1000755213 373
246 3300009545 Ga0105237_10152405 Ga0105237_101524051 373
247 3300009551 Ga0105238_10072206 Ga0105238_100722065 373
248 3300010375 Ga0105239_10000006 Ga0105239_1000000689 373
249 3300010375 Ga0105239_10002369 Ga0105239_100023698 373
250 3300010375 Ga0105239_10019909 Ga0105239_100199097 373
251 3300010375 Ga0105239_10294408 Ga0105239_102944082 373
252 3300010375 Ga0105239_10448520 Ga0105239_104485202 373
253 3300013100 Ga0157373_10002319 Ga0157373_1000231913 373
254 3300013102 Ga0157371_10000869 Ga0157371_1000086915 373
255 3300013102 Ga0157371_10017779 Ga0157371_100177796 373
256 3300013104 Ga0157370_10120077 Ga0157370_101200773 373
257 3300013104 Ga0157370_10123351 Ga0157370_101233512 373
258 3300013105 Ga0157369_10005105 Ga0157369_100051058 373
259 3300013105 Ga0157369_10035439 Ga0157369_100354393 373
260 3300013296 Ga0157374_10000129 Ga0157374_1000012933 373
261 3300013296 Ga0157374_10002780 Ga0157374_1000278012 373
262 3300013296 Ga0157374_10009486 Ga0157374_100094865 373
263 3300013297 Ga0157378_10261262 Ga0157378_102612622 373
264 3300013306 Ga0163162_10000068 Ga0163162_1000006851 373
265 3300013307 Ga0157372_10000016 Ga0157372_10000016190 373
266 3300013307 Ga0157372_10001333 Ga0157372_1000133323 373
267 3300013308 Ga0157375_10004424 Ga0157375_100044246 373
268 3300014497 Ga0182008_10000009 Ga0182008_10000009131 373
269 3300014969 Ga0157376_10138879 Ga0157376_101388793 373
270 3300015262 Ga0182007_10024971 Ga0182007_100249713 373
271 3300025231 Ga0207427_100090 Ga0207427_10009066 373
272 3300025233 Ga0209437_100034 Ga0209437_100034275 373
273 3300025250 Ga0209026_1001610 Ga0209026_10016104 373
274 3300025261 Ga0209233_1000038 Ga0209233_1000038275 373
275 3300025261 Ga0209233_1015307 Ga0209233_10153072 373
276 3300025904 Ga0207647_10000062 Ga0207647_1000006245 373
277 3300025907 Ga0207645_10005692 Ga0207645_100056926 373
278 3300025911 Ga0207654_10024090 Ga0207654_100240905 373
279 3300025911 Ga0207654_10032404 Ga0207654_100324043 373
280 3300025912 Ga0207707_10192846 Ga0207707_101928462 373
281 3300025913 Ga0207695_10000019 Ga0207695_10000019130 373
282 3300025913 Ga0207695_10019778 Ga0207695_100197783 373
283 3300025913 Ga0207695_10327276 Ga0207695_103272762 373
284 3300025914 Ga0207671_10000667 Ga0207671_1000066722 373
285 3300025914 Ga0207671_10001276 Ga0207671_100012763 373
286 3300025914 Ga0207671_10007625 Ga0207671_100076256 373
287 3300025914 Ga0207671_10019724 Ga0207671_100197245 373
288 3300025914 Ga0207671_10223219 Ga0207671_102232192 373
289 3300025921 Ga0207652_10015415 Ga0207652_100154155 373
290 3300025931 Ga0207644_10004371 Ga0207644_1000437110 373
291 3300025932 Ga0207690_10005669 Ga0207690_100056694 373
292 3300025933 Ga0207706_10004297 Ga0207706_1000429710 373
293 3300025938 Ga0207704_10000037 Ga0207704_1000003739 373
294 3300025949 Ga0207667_10010632 Ga0207667_100106324 373
295 3300026023 Ga0207677_10151425 Ga0207677_101514252 373
296 3300026041 Ga0207639_10038759 Ga0207639_100387593 373
297 3300026078 Ga0207702_10014288 Ga0207702_100142885 373
298 3300026089 Ga0207648_10006640 Ga0207648_100066406 373
299 3300026121 Ga0207683_10068687 Ga0207683_100686873 373
300 3300028379 Ga0268266_10000095 Ga0268266_1000009555 373
301 3300028786 Ga0307517_10005537 Ga0307517_100055372 373
302 3300031344 Ga0265316_10002396 Ga0265316_100023963 373
303 3300031727 Ga0316576_10079591 Ga0316576_100795912 373
304 3300031733 Ga0316577_10056142 Ga0316577_100561421 373
305 3300031911 Ga0307412_10000084 Ga0307412_1000008459 373
306 3300032004 Ga0307414_10000555 Ga0307414_100005553 373
307 3300032004 Ga0307414_10304791 Ga0307414_103047912 373
308 3300033180 Ga0307510_10003047 Ga0307510_100030479 373
309 3300036712 Ga0316584_0003350 Ga0316584_0003350_2104_3306 373
310 3300037312 Ga0395899_0000283 Ga0395899_0000283_13706_14827 373
311 3300037418 Ga0395900_0000694 Ga0395900_0000694_31788_32909 373
312 3300037418 Ga0395900_0007931 Ga0395900_0007931_9117_10238 373
313 3300037466 Ga0395898_0046755 Ga0395898_0046755_928_2049 373
314 3300037471 Ga0395905_0000841 Ga0395905_0000841_38565_39686 373
315 3300037471 Ga0395905_0010062 Ga0395905_0010062_481_1602 373
316 3300038443 Ga0395901_0000890 Ga0395901_0000890_28803_29924 373
317 3300038443 Ga0395901_0006685 Ga0395901_0006685_7761_8882 373
318 3300039062 Ga0400483_002155 Ga0400483_002155_14126_15304 373
319 3300039062 Ga0400483_260295 Ga0400483_260295_269_1447 373
320 3300042876 Ga0451577_0015505 Ga0451577_0015505_771_1970 373
321 3300044656 Ga0466969_0055989 Ga0466969_0055989_537_1658 373
322 3300044673 Ga0453683_0001595 Ga0453683_0001595_3711_4910 373
323 3300044684 Ga0466966_0009096 Ga0466966_0009096_1546_2667 373
324 3300044693 Ga0466961_0007943 Ga0466961_0007943_2600_3721 373
325 3300044712 Ga0453684_0001203 Ga0453684_0001203_63899_65098 373
326 3300044712 Ga0453684_0189642 Ga0453684_0189642_218_1417 373
327 3300045051 Ga0451576_0000378 Ga0451576_0000378_3711_4910 373
328 3300046471 Ga0495650_0000014 Ga0495650_0000014_35619_36740 373
329 3300046492 Ga0495585_0002656 Ga0495585_0002656_3980_5101 373
330 3300046507 Ga0495606_0000241 Ga0495606_0000241_45749_46870 373
331 3300046507 Ga0495606_0030229 Ga0495606_0030229_2230_3351 373
332 3300046512 Ga0495610_0004805 Ga0495610_0004805_2225_3346 373
333 3300046513 Ga0495616_0003236 Ga0495616_0003236_8319_9440 373
334 3300046513 Ga0495616_0005420 Ga0495616_0005420_6702_7823 373
335 3300046558 Ga0495633_0002743 Ga0495633_0002743_3443_4564 373
336 3300046616 Ga0495668_0072364 Ga0495668_0072364_449_1570 373
337 3300046660 Ga0495625_0000003 Ga0495625_0000003_199766_200887 373
338 3300046660 Ga0495625_0121645 Ga0495625_0121645_449_1570 373
339 3300046665 Ga0495661_0034927 Ga0495661_0034927_81_1202 373
340 3300046694 Ga0495649_0000002 Ga0495649_0000002_806106_807227 373
341 3300047323 Ga0495683_0011665 Ga0495683_0011665_79_1200 373
342 3300047443 Ga0495687_000785 Ga0495687_000785_16392_17513 373
343 3300047443 Ga0495687_015019 Ga0495687_015019_751_1875 373
344 3300053080 Ga0500635_0000725 Ga0500635_0000725_1836_2960 373
345 3300053122 Ga0500608_009194 Ga0500608_009194_1593_2714 373
346 3300046492 Ga0495585_0000408 Ga0495585_0000408_17451_18596 378
347 3300046660 Ga0495625_0003718 Ga0495625_0003718_9736_10881 378
348 3300005329 Ga0070683_100176201 Ga0070683_1001762012 379
349 iso_pu_bacteria 2738541284 2738762830 379
350 3300002773 JGI25152J39213_1000398 JGI25152J39213_100039820 380
351 3300002774 JGI25150J39212_1000030 JGI25150J39212_100003014 380
352 3300003187 JGI25151J46595_10000129 JGI25151J46595_1000012981 380
353 3300003215 JGI25153J46596_10000096 JGI25153J46596_1000009681 380
354 3300009545 Ga0105237_10063647 Ga0105237_100636474 380
355 3300010375 Ga0105239_10003056 Ga0105239_1000305623 380
356 3300025245 Ga0207425_1000004 Ga0207425_1000004297 380
357 3300025258 Ga0209129_1000005 Ga0209129_1000005643 380
358 3300025294 Ga0209025_1000009 Ga0209025_1000009297 380
359 3300025297 Ga0209758_1000010 Ga0209758_1000010298 380
360 3300025914 Ga0207671_10035698 Ga0207671_100356984 380
361 3300026041 Ga0207639_10180672 Ga0207639_101806723 380
362 3300037418 Ga0395900_0000095 Ga0395900_0000095_707_1861 380
363 3300005327 Ga0070658_10000045 Ga0070658_1000004585 381
364 3300005563 Ga0068855_100038463 Ga0068855_1000384635 381
365 3300005614 Ga0068856_100086971 Ga0068856_1000869713 381
366 3300013308 Ga0157375_10012166 Ga0157375_100121668 381
367 3300025909 Ga0207705_10000080 Ga0207705_1000008042 381
368 3300047472 Ga0495686_0000582 Ga0495686_0000582_47052_48209 381
369 3300025961 Ga0207712_10123087 Ga0207712_101230872 382
370 3300028794 Ga0307515_10065830 Ga0307515_100658303 382
371 3300032004 Ga0307414_10044122 Ga0307414_100441223 382
372 2162886007 SwRhRL2b_contig_2086071 SwRhRL2b_0181.00004120 383
373 3300005288 Ga0065714_10066179 Ga0065714_100661793 383
374 3300013100 Ga0157373_10000496 Ga0157373_100004966 383
375 3300013102 Ga0157371_10101244 Ga0157371_101012442 383
376 3300013104 Ga0157370_10080005 Ga0157370_100800053 383
377 3300015261 Ga0182006_1002271 Ga0182006_10022718 383
378 3300025913 Ga0207695_10005987 Ga0207695_1000598714 383

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8307 64 178
7ypv-assembly1.cif.gz_B crystal structure of ore-st-f 0.8307 64 178
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8289 64 178
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.8289 64 178
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8276 64 178
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9077 14 381 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9008 14 381 3.40.630.30
af_A0A0R4IVU6_40_273_3.40.570.10 Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A 0.8506 61 86 3.40.570.10
af_Q54G61_12_170_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8151 221 368 3.40.630.30
af_I1MRQ6_38_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8127 64 127 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0Q0UXC4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9929 11 382
AF-A0A1I2DYH8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9911 11 382
AF-A0A6I4I7R5-F1-model_v4 GNAT family N-acetyltransferase 0.9903 11 382 GO:0016740
AF-A0A0Q0UXC4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9903 11 382
AF-A0A6N4EBF7-F1-model_v4 deleted 0.9889 11 122

Feature Viewer

pLDDT pTM Quality
89.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map