F428022

General Info

Members Datasets Scaffolds Average Seq Length
378 231 756 347

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10022317|Ga0157372_100223172
Length 420
Sequence VDKILQQPVIIMSGLAVAVVIMLFAAFARMLRKVGPNQALIRYGLGGTHIVHGGAQLVLPIINSAHELSLELMSFDVAPQQDLYTNQGVAVTVEAVAQLKIKNDPESIRTAAEQFLTKPPQQRESLIRLVMEGHLRGIIGQLTVEQIVKQPEMVADRMRGNVAEDVAKMGLEVVSFTIKEVRDKNQYIENMGRPDIARIKSGADIAAAEAERDTAMKQAGYMREAAVARAEADQERVLAETQSLAKYEIQTNIMQQQVVAEAVNIDRVRKEGEIKVQEAEIQRKERELAATILKQAEAERKRISAYLEYNEAAVLDKLLAGLPEVVRALAEPLSKVDKITVVSTGGEXXXXVNKITADMATMVAQVPALIESLTGKKISELMRQVRPLMPGESPVTTDSGVKAPPSGIPGAPASPTAKKS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 5.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10022317 3300013307 Bacteria 6847
2 LJNas_1000010 3300000546 Bacteria 24841
3 Ga0058862_10057391 3300004803 Bacteria 2708
4 Ga0065707_10163282 3300005295 Bacteria 1544
5 Ga0070658_10002655 3300005327 Bacteria 14879
6 Ga0070683_100000011 3300005329 Bacteria 283682
7 Ga0070683_100011347 3300005329 Bacteria 7697
8 Ga0070683_100041155 3300005329 Unclassified 4249
9 Ga0070683_100044484 3300005329 Unclassified 4094
10 Ga0070683_100045010 3300005329 Unclassified 4073
11 Ga0068869_100013538 3300005334 Bacteria 5428
12 Ga0070680_100002635 3300005336 Bacteria 13294
13 Ga0070680_100003389 3300005336 Bacteria 11892
14 Ga0070682_100023615 3300005337 Unclassified 3652
15 Ga0068868_100048577 3300005338 Bacteria 3328
16 Ga0068868_100149191 3300005338 Unclassified 1925
17 Ga0070660_100061657 3300005339 Bacteria 2912
18 Ga0070689_100010285 3300005340 Bacteria 6668
19 Ga0070661_100010467 3300005344 Bacteria 6452
20 Ga0070692_10021747 3300005345 Unclassified 3123
21 Ga0070675_100002394 3300005354 Bacteria 13980
22 Ga0070671_100199293 3300005355 Bacteria 1697
23 Ga0070659_100001655 3300005366 Bacteria 16052
24 Ga0070714_100000154 3300005435 Bacteria 55244
25 Ga0070713_100028357 3300005436 Bacteria 4421
26 Ga0070713_100076168 3300005436 Bacteria 2848
27 Ga0070713_100205322 3300005436 Bacteria 1781
28 Ga0070710_10020447 3300005437 Bacteria 3434
29 Ga0070705_100011006 3300005440 Bacteria 4548
30 Ga0070694_100002144 3300005444 Bacteria 11696
31 Ga0070694_100037922 3300005444 Unclassified 3199
32 Ga0070708_100001940 3300005445 Bacteria 15961
33 Ga0070708_100017822 3300005445 Bacteria 5933
34 Ga0070708_100032447 3300005445 Bacteria 4531
35 Ga0070708_100095139 3300005445 Bacteria 2719
36 Ga0070663_100178802 3300005455 Bacteria 1644
37 Ga0070681_10000319 3300005458 Bacteria 39102
38 Ga0070681_10012743 3300005458 Bacteria 8347
39 Ga0070681_10041086 3300005458 Bacteria 4634
40 Ga0070706_100001245 3300005467 Bacteria 27259
41 Ga0070706_100073248 3300005467 Bacteria 3170
42 Ga0070706_100228202 3300005467 Unclassified 1738
43 Ga0070707_100026431 3300005468 Bacteria 5510
44 Ga0070707_100053331 3300005468 Bacteria 3877
45 Ga0070707_100160909 3300005468 Bacteria 2188
46 Ga0070699_100031016 3300005518 Bacteria 4616
47 Ga0070699_100061814 3300005518 Unclassified 3245
48 Ga0070679_100000411 3300005530 Bacteria 36449
49 Ga0070679_100007808 3300005530 Bacteria 10027
50 Ga0070679_100012574 3300005530 Bacteria 8093
51 Ga0070684_100000001 3300005535 Bacteria 300240
52 Ga0070684_100043592 3300005535 Unclassified 3875
53 Ga0070697_100000571 3300005536 Bacteria 27832
54 Ga0070697_100022979 3300005536 Unclassified 4959
55 Ga0068853_100081941 3300005539 Unclassified 2825
56 Ga0070695_100005932 3300005545 Bacteria 7211
57 Ga0070695_100028325 3300005545 Bacteria 3476
58 Ga0070696_100001200 3300005546 Bacteria 16801
59 Ga0070693_100000140 3300005547 Bacteria 32733
60 Ga0070693_100008232 3300005547 Bacteria 5128
61 Ga0070665_100014389 3300005548 Bacteria 7940
62 Ga0070704_100000801 3300005549 Bacteria 15584
63 Ga0068855_100068762 3300005563 Unclassified 4122
64 Ga0068855_100076600 3300005563 Bacteria 3881
65 Ga0070664_100017593 3300005564 Bacteria 5869
66 Ga0068857_100020246 3300005577 Bacteria 5850
67 Ga0068857_100035440 3300005577 Unclassified 4419
68 Ga0068854_100004383 3300005578 Bacteria 8904
69 Ga0068856_100034571 3300005614 Unclassified 4950
70 Ga0070702_100006449 3300005615 Bacteria 5553
71 Ga0068852_100017059 3300005616 Bacteria 5687
72 Ga0068852_100022156 3300005616 Bacteria 5090
73 Ga0068852_100029631 3300005616 Bacteria 4499
74 Ga0068859_100037901 3300005617 Unclassified 4838
75 Ga0068864_100023338 3300005618 Bacteria 5194
76 Ga0068863_100010955 3300005841 Bacteria 8792
77 Ga0068860_100028695 3300005843 Bacteria 5356
78 Ga0081539_10036142 3300005985 Bacteria 2960
79 Ga0070717_10003349 3300006028 Bacteria 11446
80 Ga0070717_10030261 3300006028 Unclassified 4349
81 Ga0075365_10003250 3300006038 Bacteria 8329
82 Ga0070716_100003210 3300006173 Bacteria 7668
83 Ga0070712_100019456 3300006175 Bacteria 4429
84 Ga0097621_100001499 3300006237 Bacteria 16025
85 Ga0097621_100013935 3300006237 Bacteria 6005
86 Ga0097621_100071448 3300006237 Bacteria 2868
87 Ga0068871_100001120 3300006358 Bacteria 17991
88 Ga0068871_100004299 3300006358 Bacteria 9892
89 Ga0068871_100026376 3300006358 Unclassified 4533
90 Ga0075436_100001289 3300006914 Bacteria 17037
91 Ga0075436_100004492 3300006914 Bacteria 9576
92 Ga0075436_100040297 3300006914 Unclassified 3224
93 Ga0097620_100037901 3300006931 Unclassified 4838
94 Ga0099794_10007425 3300007265 Bacteria 4505
95 Ga0105240_10001662 3300009093 Bacteria 37766
96 Ga0105240_10003071 3300009093 Bacteria 26225
97 Ga0105240_10009828 3300009093 Bacteria 13504
98 Ga0105240_10061421 3300009093 Bacteria 4683
99 Ga0105240_10092865 3300009093 Bacteria 3684
100 Ga0105240_10269387 3300009093 Bacteria 1961
101 Ga0105245_10008833 3300009098 Bacteria 8792
102 Ga0105245_10011996 3300009098 Bacteria 7535
103 Ga0105245_10012108 3300009098 Bacteria 7502
104 Ga0105241_10000059 3300009174 Bacteria 83637
105 Ga0105241_10035418 3300009174 Unclassified 3754
106 Ga0105242_10005600 3300009176 Bacteria 9695
107 Ga0105248_10053774 3300009177 Bacteria 4517
108 Ga0105248_10059056 3300009177 Unclassified 4308
109 Ga0105237_10002271 3300009545 Bacteria 23900
110 Ga0105237_10139059 3300009545 Bacteria 2423
111 Ga0105238_10000761 3300009551 Bacteria 33515
112 Ga0105238_10041584 3300009551 Unclassified 4655
113 Ga0105238_10065386 3300009551 Bacteria 3638
114 Ga0105249_10042292 3300009553 Bacteria 4144
115 Ga0105239_10014055 3300010375 Bacteria 8887
116 Ga0105246_10003648 3300011119 Bacteria 9318
117 Ga0157373_10048574 3300013100 Unclassified 3025
118 Ga0157371_10021130 3300013102 Unclassified 4784
119 Ga0157370_10060303 3300013104 Bacteria 3602
120 Ga0157370_10090819 3300013104 Bacteria 2867
121 Ga0157370_10106788 3300013104 Unclassified 2620
122 Ga0157369_10000062 3300013105 Bacteria 149758
123 Ga0157374_10000325 3300013296 Bacteria 44176
124 Ga0157374_10012355 3300013296 Bacteria 7430
125 Ga0157374_10014980 3300013296 Bacteria 6794
126 Ga0157378_10000260 3300013297 Bacteria 51886
127 Ga0163162_10042940 3300013306 Bacteria 4526
128 Ga0163162_10101362 3300013306 Bacteria 2971
129 Ga0157372_10001078 3300013307 Bacteria 29713
130 Ga0157372_10008184 3300013307 Bacteria 11115
131 Ga0157372_10022404 3300013307 Bacteria 6835
132 Ga0157372_10031106 3300013307 Bacteria 5843
133 Ga0157372_10134066 3300013307 Bacteria 2851
134 Ga0157375_10058522 3300013308 Unclassified 3813
135 Ga0157375_10081706 3300013308 Bacteria 3272
136 Ga0163163_10109753 3300014325 Bacteria 2786
137 Ga0157377_10004306 3300014745 Bacteria 6531
138 Ga0157376_10024753 3300014969 Unclassified 4719
139 Ga0157376_10123505 3300014969 Bacteria 2298
140 Ga0197907_10546338 3300020069 Unclassified 3643
141 Ga0197907_10939002 3300020069 Bacteria 2056
142 Ga0206349_1367405 3300020075 Bacteria 2326
143 Ga0206349_1630216 3300020075 Bacteria 3836
144 Ga0206355_1048980 3300020076 Bacteria 2004
145 Ga0206351_10608304 3300020077 Unclassified 2115
146 Ga0206351_10956946 3300020077 Bacteria 2609
147 Ga0206352_10484206 3300020078 Unclassified 2241
148 Ga0206352_11111793 3300020078 Bacteria 6239
149 Ga0206350_10372660 3300020080 Unclassified 3105
150 Ga0206350_10448724 3300020080 Bacteria 2634
151 Ga0206350_10974031 3300020080 Bacteria 3453
152 Ga0206353_10246383 3300020082 Unclassified 2847
153 Ga0224712_10004970 3300022467 Unclassified 3650
154 Ga0224712_10007675 3300022467 Bacteria 3154
155 Ga0207697_10001574 3300025315 Bacteria 12324
156 Ga0207653_10002375 3300025885 Bacteria 6003
157 Ga0207705_10068231 3300025909 Bacteria 2574
158 Ga0207684_10001708 3300025910 Bacteria 23313
159 Ga0207684_10004076 3300025910 Bacteria 13940
160 Ga0207654_10000017 3300025911 Bacteria 201589
161 Ga0207707_10001048 3300025912 Bacteria 26537
162 Ga0207707_10001232 3300025912 Bacteria 24002
163 Ga0207707_10139451 3300025912 Bacteria 2120
164 Ga0207695_10000106 3300025913 Bacteria 253001
165 Ga0207695_10002986 3300025913 Bacteria 24352
166 Ga0207695_10004159 3300025913 Bacteria 19871
167 Ga0207695_10033354 3300025913 Bacteria 5617
168 Ga0207671_10014048 3300025914 Bacteria 6348
169 Ga0207660_10018759 3300025917 Bacteria 4617
170 Ga0207660_10038593 3300025917 Bacteria 3335
171 Ga0207660_10080906 3300025917 Bacteria 2386
172 Ga0207649_10014074 3300025920 Unclassified 4477
173 Ga0207652_10000674 3300025921 Bacteria 33426
174 Ga0207652_10000951 3300025921 Bacteria 27138
175 Ga0207652_10016343 3300025921 Bacteria 6058
176 Ga0207646_10004665 3300025922 Bacteria 14782
177 Ga0207646_10009154 3300025922 Bacteria 9825
178 Ga0207646_10019052 3300025922 Bacteria 6387
179 Ga0207646_10062681 3300025922 Bacteria 3319
180 Ga0207646_10073198 3300025922 Bacteria 3061
181 Ga0207646_10192399 3300025922 Bacteria 1843
182 Ga0207694_10001003 3300025924 Bacteria 24665
183 Ga0207694_10046198 3300025924 Unclassified 3366
184 Ga0207650_10085336 3300025925 Bacteria 2402
185 Ga0207659_10019130 3300025926 Unclassified 4500
186 Ga0207687_10003552 3300025927 Bacteria 10490
187 Ga0207687_10025617 3300025927 Unclassified 3947
188 Ga0207700_10005302 3300025928 Bacteria 7690
189 Ga0207700_10072937 3300025928 Bacteria 2649
190 Ga0207664_10000241 3300025929 Bacteria 41182
191 Ga0207664_10129191 3300025929 Bacteria 2125
192 Ga0207644_10014435 3300025931 Bacteria 5283
193 Ga0207690_10016211 3300025932 Unclassified 4530
194 Ga0207706_10060364 3300025933 Bacteria 3339
195 Ga0207670_10017307 3300025936 Unclassified 4356
196 Ga0207665_10000024 3300025939 Bacteria 101596
197 Ga0207665_10061209 3300025939 Bacteria 2551
198 Ga0207711_10124762 3300025941 Unclassified 2302
199 Ga0207689_10001463 3300025942 Bacteria 22608
200 Ga0207661_10000016 3300025944 Bacteria 305159
201 Ga0207661_10011209 3300025944 Bacteria 6485
202 Ga0207661_10024356 3300025944 Bacteria 4587
203 Ga0207661_10053857 3300025944 Unclassified 3221
204 Ga0207679_10010649 3300025945 Bacteria 5927
205 Ga0207679_10056041 3300025945 Unclassified 2908
206 Ga0207667_10003016 3300025949 Bacteria 20877
207 Ga0207667_10007065 3300025949 Bacteria 13566
208 Ga0207667_10056777 3300025949 Bacteria 4111
209 Ga0207667_10081693 3300025949 Unclassified 3348
210 Ga0207667_10101330 3300025949 Bacteria 2970
211 Ga0207712_10037485 3300025961 Bacteria 3308
212 Ga0207640_10021559 3300025981 Bacteria 3843
213 Ga0207677_10042557 3300026023 Unclassified 3012
214 Ga0207677_10085645 3300026023 Bacteria 2275
215 Ga0207703_10029718 3300026035 Bacteria 4314
216 Ga0207639_10144564 3300026041 Unclassified 1985
217 Ga0207678_10084709 3300026067 Bacteria 2711
218 Ga0207702_10000706 3300026078 Bacteria 35933
219 Ga0207702_10010924 3300026078 Bacteria 7574
220 Ga0207641_10022805 3300026088 Bacteria 5154
221 Ga0207641_10036252 3300026088 Bacteria 4116
222 Ga0207641_10128407 3300026088 Bacteria 2273
223 Ga0207676_10023709 3300026095 Unclassified 4532
224 Ga0207674_10001862 3300026116 Bacteria 26862
225 Ga0207674_10004805 3300026116 Bacteria 16178
226 Ga0207674_10040213 3300026116 Bacteria 4846
227 Ga0207683_10171161 3300026121 Bacteria 1967
228 Ga0207698_10012255 3300026142 Bacteria 5603
229 Ga0207698_10030630 3300026142 Bacteria 3872
230 Ga0207698_10061992 3300026142 Unclassified 2917
231 Ga0209588_1002507 3300027671 Bacteria 4981
232 Ga0265354_1000007 3300028016 Bacteria 30899
233 Ga0268266_10009078 3300028379 Bacteria 8778
234 Ga0265338_10013399 3300028800 Bacteria 9262
235 Ga0265338_10021549 3300028800 Bacteria 6714
236 Ga0265770_1002177 3300030878 Bacteria 2668
237 Ga0265760_10000622 3300031090 Bacteria 10039
238 Ga0265760_10001888 3300031090 Bacteria 6142
239 Ga0265760_10004995 3300031090 Bacteria 3795
240 Ga0265316_10010413 3300031344 Bacteria 8475
241 Ga0265314_10009501 3300031711 Bacteria 8200
242 Ga0265314_10041638 3300031711 Bacteria 3285
243 Ga0265342_10020058 3300031712 Bacteria 4297
244 Ga0307510_10016643 3300033180 Bacteria 8679
245 Ga0373923_0031485 3300035111 Bacteria 2139
246 Ga0373932_0000871 3300035112 Bacteria 8920
247 Ga0373936_0000770 3300035113 Bacteria 11281
248 Ga0373954_0001441 3300035118 Bacteria 9662
249 Ga0373956_0001621 3300035119 Bacteria 9255
250 Ga0373943_0000323 3300035170 Bacteria 20010
251 Ga0373946_0031750 3300035171 Bacteria 2118
252 Ga0373955_0011085 3300035172 Bacteria 4281
253 Ga0373924_0004218 3300035410 Bacteria 5010
254 Ga0373931_0003798 3300035691 Bacteria 6834
255 Ga0373931_0027002 3300035691 Bacteria 2927
256 Ga0373935_0001708 3300035692 Bacteria 12282
257 Ga0373935_0055671 3300035692 Bacteria 2520
258 Ga0373927_0000273 3300035695 Bacteria 40643
259 Ga0373927_0000335 3300035695 Bacteria 36911
260 Ga0373927_0000600 3300035695 Bacteria 27494
261 Ga0373927_0000827 3300035695 Bacteria 23687
262 Ga0373927_0009881 3300035695 Bacteria 6397
263 Ga0373933_0000314 3300035724 Bacteria 31450
264 Ga0373933_0000794 3300035724 Bacteria 19278
265 Ga0373947_0001242 3300035725 Bacteria 15680
266 Ga0373947_0001524 3300035725 Bacteria 14206
267 Ga0373947_0005592 3300035725 Bacteria 7329
268 Ga0373937_0000647 3300036401 Bacteria 30578
269 Ga0373937_0001704 3300036401 Bacteria 18477
270 Ga0373937_0038116 3300036401 Bacteria 4381
271 Ga0373937_0112540 3300036401 Bacteria 2532
272 Ga0373925_0000437 3300037068 Bacteria 42142
273 Ga0373925_0001190 3300037068 Bacteria 22929
274 Ga0373925_0002175 3300037068 Bacteria 15972
275 Ga0451577_0030101 3300042876 Unclassified 4906
276 Ga0466969_0000250 3300044656 Bacteria 29585
277 Ga0453683_0029100 3300044673 Unclassified 3495
278 Ga0466966_0001453 3300044684 Bacteria 15233
279 Ga0466966_0054713 3300044684 Bacteria 2528
280 Ga0466961_0009972 3300044693 Bacteria 6054
281 Ga0466964_0002096 3300044706 Bacteria 7022
282 Ga0466968_0000673 3300044735 Bacteria 11746
283 Ga0466970_0000010 3300044765 Bacteria 93488
284 Ga0466959_0024235 3300045049 Bacteria 4494
285 Ga0466959_0136038 3300045049 Bacteria 1739
286 Ga0466967_0101805 3300045976 Bacteria 2626
287 Ga0495592_0005056 3300046454 Bacteria 9704
288 Ga0495603_0000331 3300046455 Bacteria 25550
289 Ga0495603_0018938 3300046455 Bacteria 4167
290 Ga0495629_0017790 3300046459 Bacteria 5094
291 Ga0495651_0003085 3300046462 Bacteria 12862
292 Ga0495651_0061034 3300046462 Unclassified 2886
293 Ga0495653_0002030 3300046463 Bacteria 15918
294 Ga0495580_0006837 3300046472 Bacteria 9237
295 Ga0495580_0014365 3300046472 Bacteria 6006
296 Ga0495580_0019853 3300046472 Bacteria 4984
297 Ga0495580_0020647 3300046472 Bacteria 4872
298 Ga0495605_0024057 3300046474 Bacteria 3192
299 Ga0495639_0007506 3300046475 Bacteria 4681
300 Ga0495664_0074026 3300046477 Bacteria 2037
301 Ga0495585_0002561 3300046492 Bacteria 12884
302 Ga0495594_0000392 3300046499 Bacteria 22067
303 Ga0495594_0000505 3300046499 Bacteria 19888
304 Ga0495594_0008712 3300046499 Bacteria 5231
305 Ga0495606_0062358 3300046507 Bacteria 2380
306 Ga0495608_0000062 3300046511 Bacteria 85886
307 Ga0495628_0003594 3300046516 Bacteria 13873
308 Ga0495630_0002398 3300046517 Bacteria 13021
309 Ga0495630_0006030 3300046517 Bacteria 8582
310 Ga0495644_0000001 3300046523 Bacteria 229227
311 Ga0495652_0002995 3300046529 Bacteria 16957
312 Ga0495640_0036341 3300046533 Bacteria 3480
313 Ga0495587_0000246 3300046536 Bacteria 39891
314 Ga0495609_0007741 3300046538 Bacteria 5326
315 Ga0495645_0000556 3300046543 Bacteria 25631
316 Ga0495645_0014895 3300046543 Bacteria 5525
317 Ga0495622_0019470 3300046557 Bacteria 3159
318 Ga0495633_0026978 3300046558 Bacteria 2812
319 Ga0495667_0002442 3300046559 Bacteria 12411
320 Ga0495634_0057821 3300046642 Bacteria 2587
321 Ga0495611_0008709 3300046648 Bacteria 4291
322 Ga0495625_0000174 3300046660 Bacteria 100401
323 Ga0495625_0007029 3300046660 Bacteria 9906
324 Ga0495635_0000383 3300046663 Bacteria 28129
325 Ga0495657_0001438 3300046675 Bacteria 20636
326 Ga0495599_0001600 3300046678 Bacteria 13057
327 Ga0495623_0000538 3300046679 Bacteria 25164
328 Ga0495669_0000499 3300046684 Bacteria 18027
329 Ga0495669_0038935 3300046684 Unclassified 2105
330 Ga0495613_0001541 3300046689 Bacteria 17532
331 Ga0495613_0037127 3300046689 Bacteria 3612
332 Ga0495670_0018377 3300046691 Bacteria 3442
333 Ga0495600_0000011 3300046809 Bacteria 141462
334 Ga0495581_0011432 3300047315 Bacteria 5138
335 Ga0495604_0000114 3300047317 Bacteria 68060
336 Ga0495604_0128750 3300047317 Bacteria 1822
337 Ga0495636_0012046 3300047318 Bacteria 3427
338 Ga0495674_0001833 3300047319 Bacteria 20951
339 Ga0495674_0040964 3300047319 Bacteria 4140
340 Ga0495674_0101121 3300047319 Bacteria 2452
341 Ga0495676_0044285 3300047321 Bacteria 3633
342 Ga0495680_0005601 3300047322 Bacteria 11772
343 Ga0495675_0039048 3300047444 Bacteria 3023
344 Ga0495684_0000143 3300047471 Bacteria 52869
345 Ga0495684_0019426 3300047471 Bacteria 5232
346 Ga0495602_0000421 3300048088 Bacteria 39667
347 Ga0495614_0007398 3300048089 Bacteria 4890
348 Ga0496102_0037874 3300048905 Bacteria 4350
349 Ga0496104_0114756 3300048907 Bacteria 2584
350 Ga0496105_0006314 3300048908 Bacteria 9106
351 Ga0496108_0068565 3300048911 Bacteria 2993
352 Ga0496110_0071238 3300048913 Bacteria 3082
353 Ga0496112_0002663 3300048915 Bacteria 14441
354 Ga0496112_0097480 3300048915 Bacteria 2911
355 Ga0496115_0006402 3300048918 Bacteria 8626
356 Ga0496115_0091297 3300048918 Bacteria 2489
357 Ga0496126_0001475 3300048929 Bacteria 36589
358 Ga0501033_0031065 3300049570 Viruses 4016
359 Ga0501034_0026704 3300049571 Bacteria 5875
360 Ga0501034_0047842 3300049571 Viruses 4317
361 Ga0501043_0062450 3300049579 Bacteria 2925
362 Ga0501047_0047274 3300049581 Bacteria 4158
363 Ga0501047_0112871 3300049581 Bacteria 2600
364 Ga0501070_0032277 3300049586 Viruses 4382
365 Ga0501070_0037537 3300049586 Bacteria 4044
366 Ga0501249_004960 3300049679 Bacteria 2717
367 Ga0501045_0194623 3300049824 Bacteria 1511
368 nmdc:mga0n895_26314_c1 3300050512 Bacteria 5508
369 nmdc:mga0rr50_663_c1 3300050513 Bacteria 18471
370 nmdc:mga08x19_125_c1 3300050514 Bacteria 67457
371 nmdc:mga08x19_15425_c1 3300050514 Bacteria 4649
372 nmdc:mga08x19_643_c1 3300050514 Bacteria 22586
373 Ga0495601_0002582 3300053077 Bacteria 10285
374 Ga0495601_0020156 3300053077 Bacteria 4071
375 Ga0495612_0000280 3300053078 Bacteria 21002
376 Ga0500595_000051 3300053119 Bacteria 88542
377 Ga0500637_0089701 3300053178 Bacteria 1780
378 Ga0466962_0026183 3300061719 Unclassified 2801
379 Ga0157372_10022317
380 LJNas_1000010
381 Ga0058862_10057391
382 Ga0065707_10163282
383 Ga0070658_10002655
384 Ga0070683_100000011
385 Ga0070683_100011347
386 Ga0070683_100041155
387 Ga0070683_100044484
388 Ga0070683_100045010
389 Ga0068869_100013538
390 Ga0070680_100002635
391 Ga0070680_100003389
392 Ga0070682_100023615
393 Ga0068868_100048577
394 Ga0068868_100149191
395 Ga0070660_100061657
396 Ga0070689_100010285
397 Ga0070661_100010467
398 Ga0070692_10021747
399 Ga0070675_100002394
400 Ga0070671_100199293
401 Ga0070659_100001655
402 Ga0070714_100000154
403 Ga0070713_100028357
404 Ga0070713_100076168
405 Ga0070713_100205322
406 Ga0070710_10020447
407 Ga0070705_100011006
408 Ga0070694_100002144
409 Ga0070694_100037922
410 Ga0070708_100001940
411 Ga0070708_100017822
412 Ga0070708_100032447
413 Ga0070708_100095139
414 Ga0070663_100178802
415 Ga0070681_10000319
416 Ga0070681_10012743
417 Ga0070681_10041086
418 Ga0070706_100001245
419 Ga0070706_100073248
420 Ga0070706_100228202
421 Ga0070707_100026431
422 Ga0070707_100053331
423 Ga0070707_100160909
424 Ga0070699_100031016
425 Ga0070699_100061814
426 Ga0070679_100000411
427 Ga0070679_100007808
428 Ga0070679_100012574
429 Ga0070684_100000001
430 Ga0070684_100043592
431 Ga0070697_100000571
432 Ga0070697_100022979
433 Ga0068853_100081941
434 Ga0070695_100005932
435 Ga0070695_100028325
436 Ga0070696_100001200
437 Ga0070693_100000140
438 Ga0070693_100008232
439 Ga0070665_100014389
440 Ga0070704_100000801
441 Ga0068855_100068762
442 Ga0068855_100076600
443 Ga0070664_100017593
444 Ga0068857_100020246
445 Ga0068857_100035440
446 Ga0068854_100004383
447 Ga0068856_100034571
448 Ga0070702_100006449
449 Ga0068852_100017059
450 Ga0068852_100022156
451 Ga0068852_100029631
452 Ga0068859_100037901
453 Ga0068864_100023338
454 Ga0068863_100010955
455 Ga0068860_100028695
456 Ga0081539_10036142
457 Ga0070717_10003349
458 Ga0070717_10030261
459 Ga0075365_10003250
460 Ga0070716_100003210
461 Ga0070712_100019456
462 Ga0097621_100001499
463 Ga0097621_100013935
464 Ga0097621_100071448
465 Ga0068871_100001120
466 Ga0068871_100004299
467 Ga0068871_100026376
468 Ga0075436_100001289
469 Ga0075436_100004492
470 Ga0075436_100040297
471 Ga0097620_100037901
472 Ga0099794_10007425
473 Ga0105240_10001662
474 Ga0105240_10003071
475 Ga0105240_10009828
476 Ga0105240_10061421
477 Ga0105240_10092865
478 Ga0105240_10269387
479 Ga0105245_10008833
480 Ga0105245_10011996
481 Ga0105245_10012108
482 Ga0105241_10000059
483 Ga0105241_10035418
484 Ga0105242_10005600
485 Ga0105248_10053774
486 Ga0105248_10059056
487 Ga0105237_10002271
488 Ga0105237_10139059
489 Ga0105238_10000761
490 Ga0105238_10041584
491 Ga0105238_10065386
492 Ga0105249_10042292
493 Ga0105239_10014055
494 Ga0105246_10003648
495 Ga0157373_10048574
496 Ga0157371_10021130
497 Ga0157370_10060303
498 Ga0157370_10090819
499 Ga0157370_10106788
500 Ga0157369_10000062
501 Ga0157374_10000325
502 Ga0157374_10012355
503 Ga0157374_10014980
504 Ga0157378_10000260
505 Ga0163162_10042940
506 Ga0163162_10101362
507 Ga0157372_10001078
508 Ga0157372_10008184
509 Ga0157372_10022404
510 Ga0157372_10031106
511 Ga0157372_10134066
512 Ga0157375_10058522
513 Ga0157375_10081706
514 Ga0163163_10109753
515 Ga0157377_10004306
516 Ga0157376_10024753
517 Ga0157376_10123505
518 Ga0197907_10546338
519 Ga0197907_10939002
520 Ga0206349_1367405
521 Ga0206349_1630216
522 Ga0206355_1048980
523 Ga0206351_10608304
524 Ga0206351_10956946
525 Ga0206352_10484206
526 Ga0206352_11111793
527 Ga0206350_10372660
528 Ga0206350_10448724
529 Ga0206350_10974031
530 Ga0206353_10246383
531 Ga0224712_10004970
532 Ga0224712_10007675
533 Ga0207697_10001574
534 Ga0207653_10002375
535 Ga0207705_10068231
536 Ga0207684_10001708
537 Ga0207684_10004076
538 Ga0207654_10000017
539 Ga0207707_10001048
540 Ga0207707_10001232
541 Ga0207707_10139451
542 Ga0207695_10000106
543 Ga0207695_10002986
544 Ga0207695_10004159
545 Ga0207695_10033354
546 Ga0207671_10014048
547 Ga0207660_10018759
548 Ga0207660_10038593
549 Ga0207660_10080906
550 Ga0207649_10014074
551 Ga0207652_10000674
552 Ga0207652_10000951
553 Ga0207652_10016343
554 Ga0207646_10004665
555 Ga0207646_10009154
556 Ga0207646_10019052
557 Ga0207646_10062681
558 Ga0207646_10073198
559 Ga0207646_10192399
560 Ga0207694_10001003
561 Ga0207694_10046198
562 Ga0207650_10085336
563 Ga0207659_10019130
564 Ga0207687_10003552
565 Ga0207687_10025617
566 Ga0207700_10005302
567 Ga0207700_10072937
568 Ga0207664_10000241
569 Ga0207664_10129191
570 Ga0207644_10014435
571 Ga0207690_10016211
572 Ga0207706_10060364
573 Ga0207670_10017307
574 Ga0207665_10000024
575 Ga0207665_10061209
576 Ga0207711_10124762
577 Ga0207689_10001463
578 Ga0207661_10000016
579 Ga0207661_10011209
580 Ga0207661_10024356
581 Ga0207661_10053857
582 Ga0207679_10010649
583 Ga0207679_10056041
584 Ga0207667_10003016
585 Ga0207667_10007065
586 Ga0207667_10056777
587 Ga0207667_10081693
588 Ga0207667_10101330
589 Ga0207712_10037485
590 Ga0207640_10021559
591 Ga0207677_10042557
592 Ga0207677_10085645
593 Ga0207703_10029718
594 Ga0207639_10144564
595 Ga0207678_10084709
596 Ga0207702_10000706
597 Ga0207702_10010924
598 Ga0207641_10022805
599 Ga0207641_10036252
600 Ga0207641_10128407
601 Ga0207676_10023709
602 Ga0207674_10001862
603 Ga0207674_10004805
604 Ga0207674_10040213
605 Ga0207683_10171161
606 Ga0207698_10012255
607 Ga0207698_10030630
608 Ga0207698_10061992
609 Ga0209588_1002507
610 Ga0265354_1000007
611 Ga0268266_10009078
612 Ga0265338_10013399
613 Ga0265338_10021549
614 Ga0265770_1002177
615 Ga0265760_10000622
616 Ga0265760_10001888
617 Ga0265760_10004995
618 Ga0265316_10010413
619 Ga0265314_10009501
620 Ga0265314_10041638
621 Ga0265342_10020058
622 Ga0307510_10016643
623 Ga0373923_0031485
624 Ga0373932_0000871
625 Ga0373936_0000770
626 Ga0373954_0001441
627 Ga0373956_0001621
628 Ga0373943_0000323
629 Ga0373946_0031750
630 Ga0373955_0011085
631 Ga0373924_0004218
632 Ga0373931_0003798
633 Ga0373931_0027002
634 Ga0373935_0001708
635 Ga0373935_0055671
636 Ga0373927_0000273
637 Ga0373927_0000335
638 Ga0373927_0000600
639 Ga0373927_0000827
640 Ga0373927_0009881
641 Ga0373933_0000314
642 Ga0373933_0000794
643 Ga0373947_0001242
644 Ga0373947_0001524
645 Ga0373947_0005592
646 Ga0373937_0000647
647 Ga0373937_0001704
648 Ga0373937_0038116
649 Ga0373937_0112540
650 Ga0373925_0000437
651 Ga0373925_0001190
652 Ga0373925_0002175
653 Ga0451577_0030101
654 Ga0466969_0000250
655 Ga0453683_0029100
656 Ga0466966_0001453
657 Ga0466966_0054713
658 Ga0466961_0009972
659 Ga0466964_0002096
660 Ga0466968_0000673
661 Ga0466970_0000010
662 Ga0466959_0024235
663 Ga0466959_0136038
664 Ga0466967_0101805
665 Ga0495592_0005056
666 Ga0495603_0000331
667 Ga0495603_0018938
668 Ga0495629_0017790
669 Ga0495651_0003085
670 Ga0495651_0061034
671 Ga0495653_0002030
672 Ga0495580_0006837
673 Ga0495580_0014365
674 Ga0495580_0019853
675 Ga0495580_0020647
676 Ga0495605_0024057
677 Ga0495639_0007506
678 Ga0495664_0074026
679 Ga0495585_0002561
680 Ga0495594_0000392
681 Ga0495594_0000505
682 Ga0495594_0008712
683 Ga0495606_0062358
684 Ga0495608_0000062
685 Ga0495628_0003594
686 Ga0495630_0002398
687 Ga0495630_0006030
688 Ga0495644_0000001
689 Ga0495652_0002995
690 Ga0495640_0036341
691 Ga0495587_0000246
692 Ga0495609_0007741
693 Ga0495645_0000556
694 Ga0495645_0014895
695 Ga0495622_0019470
696 Ga0495633_0026978
697 Ga0495667_0002442
698 Ga0495634_0057821
699 Ga0495611_0008709
700 Ga0495625_0000174
701 Ga0495625_0007029
702 Ga0495635_0000383
703 Ga0495657_0001438
704 Ga0495599_0001600
705 Ga0495623_0000538
706 Ga0495669_0000499
707 Ga0495669_0038935
708 Ga0495613_0001541
709 Ga0495613_0037127
710 Ga0495670_0018377
711 Ga0495600_0000011
712 Ga0495581_0011432
713 Ga0495604_0000114
714 Ga0495604_0128750
715 Ga0495636_0012046
716 Ga0495674_0001833
717 Ga0495674_0040964
718 Ga0495674_0101121
719 Ga0495676_0044285
720 Ga0495680_0005601
721 Ga0495675_0039048
722 Ga0495684_0000143
723 Ga0495684_0019426
724 Ga0495602_0000421
725 Ga0495614_0007398
726 Ga0496102_0037874
727 Ga0496104_0114756
728 Ga0496105_0006314
729 Ga0496108_0068565
730 Ga0496110_0071238
731 Ga0496112_0002663
732 Ga0496112_0097480
733 Ga0496115_0006402
734 Ga0496115_0091297
735 Ga0496126_0001475
736 Ga0501033_0031065
737 Ga0501034_0026704
738 Ga0501034_0047842
739 Ga0501043_0062450
740 Ga0501047_0047274
741 Ga0501047_0112871
742 Ga0501070_0032277
743 Ga0501070_0037537
744 Ga0501249_004960
745 Ga0501045_0194623
746 nmdc:mga0n895_26314_c1
747 nmdc:mga0rr50_663_c1
748 nmdc:mga08x19_125_c1
749 nmdc:mga08x19_15425_c1
750 nmdc:mga08x19_643_c1
751 Ga0495601_0002582
752 Ga0495601_0020156
753 Ga0495612_0000280
754 Ga0500595_000051
755 Ga0500637_0089701
756 Ga0466962_0026183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

32

242

0.93

Map