F427869

General Info

Members Datasets Scaffolds Average Seq Length
377 261 312 352

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746768|2785367764
Length 383
Sequence GNLRKVTSLGRVGGLRKVTSLGRVGGLRKVARLARRRPRVDLSHHARSPLGTSVVNCVTYKEGARIPVDGDLVDTVERVRRSRDGFVWLGLHEPSDHEFEGIADLFDLHPLAVEDAVEAHQRPKVERYGETLFAVFKTVCYVEHEELTATSEVVNTGEIMVFVGEDFVITVRHGSHGSLGPLREELEADPGQLAKGPAAVLHAIADHVVDDYLSVTDSVQSDIDLVETAVFSESGARVDPGRIYQLKRELLELKRAVVPLSRPIEELSTRPLQVITPEIQAYFRDVSDHLLRVKEQIAAFDELLNSILQAHLAQVTVAQNEDMRKITAWAAVIAVPTMVCGVYGMNFDHMPELHWTFGYPLVMGVIAVACAVLYRGFRRNGWL

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221670 Streptomyces sp. Root431 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
13 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
14 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
15 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
16 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
17 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
22 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
23 2808606394 Promicromonospora sp. C35 Isolate Unclassified
24 2808606448 Streptomyces sp. 193411 Isolate Unclassified
25 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
26 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
27 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
28 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
29 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
30 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
31 2862574272 Streptomyces sp. AcE210 Isolate Nodule
32 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
33 2867428634 Streptomyces sp. RP5T Isolate Unclassified
34 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
35 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
36 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
37 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
38 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
39 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
40 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
41 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
42 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
43 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
44 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
45 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
46 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
47 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
48 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
49 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
50 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
51 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
52 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
53 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
54 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
55 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
56 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
57 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
58 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
59 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
60 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
64 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
67 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
141 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
257 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
260 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
261 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.43
Metatranscriptomes 1.06
Isolates 17.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 3.71
Nodule 0.8
Rhizoplane 1.06
Rhizosphere 79.58
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010152 3300001979 Bacteria 3641
2 JGI24739J22299_10008021 3300001989 Bacteria 3948
3 JGI24739J22299_10021373 3300001989 Bacteria 2304
4 JGI24737J22298_10010845 3300001990 Bacteria 2997
5 rootH1_10000935 3300003316 Bacteria 20388
6 rootH1_10000935 3300003323 Bacteria 13271
7 rootH2_10040397 3300003320 Bacteria 6036
8 rootH1_10032890 3300003323 Bacteria 1910
9 rootH1_10109514 3300003323 Bacteria 1877
10 Ga0006562J51391_1075109 3300003578 Bacteria 1385
11 Ga0006562J51391_1112598 3300003578 Bacteria 4070
12 Ga0070683_100004714 3300005329 Bacteria 11273
13 Ga0070668_100004273 3300005347 Bacteria 10600
14 Ga0070667_100074855 3300005367 Bacteria 2889
15 Ga0070679_100087258 3300005530 Bacteria 3107
16 Ga0070679_100125080 3300005530 Bacteria 2554
17 Ga0068855_100063067 3300005563 Bacteria 4326
18 Ga0068856_100226530 3300005614 Bacteria 1885
19 Ga0068861_100152079 3300005719 Bacteria 1900
20 Ga0068862_100114549 3300005844 Bacteria 2370
21 Ga0075365_10142910 3300006038 Bacteria 1662
22 Ga0075363_100012671 3300006048 Bacteria 4068
23 Ga0075364_10009989 3300006051 Bacteria 5716
24 Ga0075367_10059026 3300006178 Bacteria 2284
25 Ga0075370_10106118 3300006353 Bacteria 1629
26 Ga0075429_100382965 3300006880 Bacteria 1231
27 Ga0099826_10036947 3300006948 Bacteria 3448
28 Ga0114129_10069028 3300009147 Bacteria 4927
29 Ga0105246_10046906 3300011119 Bacteria 2949
30 Ga0157372_10112077 3300013307 Bacteria 3126
31 Ga0157372_10300684 3300013307 Bacteria 1866
32 Ga0157372_10536735 3300013307 Bacteria 1364
33 Ga0163163_10076448 3300014325 Bacteria 3343
34 Ga0182008_10010032 3300014497 Bacteria 5085
35 Ga0182008_10013357 3300014497 Bacteria 4318
36 Ga0182007_10000129 3300015262 Bacteria 53263
37 Ga0182007_10002536 3300015262 Bacteria 8989
38 Ga0183367_1007 3300015688 Bacteria 498079
39 Ga0206353_10375918 3300020082 Bacteria 2036
40 Ga0206353_11540478 3300020082 Bacteria 1236
41 Ga0207647_10013506 3300025904 Bacteria 5655
42 Ga0207647_10055951 3300025904 Bacteria 2422
43 Ga0207647_10072260 3300025904 Bacteria 2081
44 Ga0207652_10095045 3300025921 Bacteria 2625
45 Ga0207700_10193829 3300025928 Bacteria 1709
46 Ga0207690_10257401 3300025932 Bacteria 1351
47 Ga0207661_10023369 3300025944 Bacteria 4670
48 Ga0207661_10139913 3300025944 Bacteria 2082
49 Ga0207668_10002670 3300025972 Bacteria 10433
50 Ga0207668_10036803 3300025972 Bacteria 3270
51 Ga0209371_1010012 3300027312 Bacteria 2958
52 Ga0209813_10016764 3300027866 Bacteria 2003
53 Ga0307517_10004603 3300028786 Bacteria 21130
54 Ga0307515_10000963 3300028794 Bacteria 65690
55 Ga0307515_10143502 3300028794 Bacteria 2545
56 Ga0268256_1010124 3300030500 Bacteria 3076
57 Ga0307511_10000298 3300030521 Bacteria 52404
58 Ga0307512_10010586 3300030522 Bacteria 8786
59 Ga0307512_10035595 3300030522 Bacteria 4238
60 Ga0314311_1091873 3300030733 Bacteria 2508
61 Ga0307513_10050749 3300031456 Bacteria 4481
62 Ga0307509_10006297 3300031507 Bacteria 16034
63 Ga0307509_10021039 3300031507 Bacteria 7388
64 Ga0307408_100041904 3300031548 Bacteria 3248
65 Ga0307508_10018990 3300031616 Bacteria 6246
66 Ga0307508_10021062 3300031616 Bacteria 5927
67 Ga0307514_10004684 3300031649 Bacteria 12504
68 Ga0307514_10066832 3300031649 Bacteria 2716
69 Ga0307514_10087348 3300031649 Bacteria 2285
70 Ga0307516_10000904 3300031730 Bacteria 40796
71 Ga0307516_10008457 3300031730 Bacteria 11646
72 Ga0307516_10015488 3300031730 Bacteria 8020
73 Ga0307405_10126320 3300031731 Bacteria 1759
74 Ga0307405_10274317 3300031731 Bacteria 1266
75 Ga0307413_10377299 3300031824 Bacteria 1103
76 Ga0307410_10155933 3300031852 Bacteria 1705
77 Ga0307406_10076696 3300031901 Bacteria 2209
78 Ga0307406_10150759 3300031901 Bacteria 1658
79 Ga0307407_10032895 3300031903 Bacteria 2824
80 Ga0307407_10073330 3300031903 Bacteria 2045
81 Ga0307409_100017094 3300031995 Bacteria 4822
82 Ga0307409_100025212 3300031995 Bacteria 4166
83 Ga0307409_100047062 3300031995 Bacteria 3270
84 Ga0307409_100128640 3300031995 Bacteria 2159
85 Ga0307409_100249798 3300031995 Bacteria 1621
86 Ga0307409_100357809 3300031995 Bacteria 1380
87 Ga0307416_100038786 3300032002 Bacteria 3679
88 Ga0307416_100040433 3300032002 Bacteria 3622
89 Ga0307416_100071297 3300032002 Bacteria 2886
90 Ga0307416_100092705 3300032002 Bacteria 2599
91 Ga0307416_100162097 3300032002 Bacteria 2068
92 Ga0307416_100238882 3300032002 Bacteria 1759
93 Ga0307416_100240086 3300032002 Bacteria 1755
94 Ga0307414_10088239 3300032004 Bacteria 2295
95 Ga0307414_10217819 3300032004 Bacteria 1565
96 Ga0307411_10088587 3300032005 Bacteria 2153
97 Ga0307411_10175238 3300032005 Bacteria 1622
98 Ga0307415_100064895 3300032126 Bacteria 2542
99 Ga0307415_100226649 3300032126 Bacteria 1502
100 Ga0307507_10013752 3300033179 Bacteria 9767
101 Ga0307507_10032773 3300033179 Bacteria 5414
102 Ga0307507_10109593 3300033179 Bacteria 2264
103 Ga0307510_10025745 3300033180 Bacteria 6779
104 Ga0307510_10039895 3300033180 Bacteria 5163
105 Ga0373932_0039643 3300035112 Bacteria 1352
106 Ga0373941_0068522 3300035115 Bacteria 1172
107 Ga0373942_0000986 3300035207 Bacteria 7731
108 Ga0373931_0129933 3300035691 Bacteria 1449
109 Ga0395900_0355236 3300037418 Bacteria 1438
110 Ga0395898_0013194 3300037466 Bacteria 8512
111 Ga0395898_0031291 3300037466 Bacteria 5318
112 Ga0395898_0110735 3300037466 Bacteria 2631
113 Ga0395901_0077989 3300038443 Bacteria 3458
114 Ga0395901_0244888 3300038443 Bacteria 1869
115 Ga0395901_0517797 3300038443 Bacteria 1212
116 Ga0439436_0009177 3300041404 Bacteria 3034
117 Ga0439439_0010754 3300041406 Bacteria 2193
118 Ga0439439_0011542 3300041406 Bacteria 2128
119 Ga0451853_3268434 3300041512 Bacteria 1470
120 Ga0439433_0003248 3300041999 Bacteria 3484
121 Ga0439448_0000713 3300042005 Bacteria 7999
122 Ga0439449_0004175 3300042007 Bacteria 5581
123 Ga0439449_0009380 3300042007 Bacteria 3711
124 Ga0439455_0005983 3300042012 Bacteria 2501
125 Ga0439457_000135 3300042014 Bacteria 18718
126 Ga0439457_003688 3300042014 Bacteria 4130
127 Ga0450894_001068 3300042131 Bacteria 4148
128 Ga0450898_000980 3300042134 Bacteria 3601
129 Ga0450899_001148 3300042135 Bacteria 3007
130 Ga0450903_000090 3300042138 Bacteria 18842
131 Ga0466969_0010926 3300044656 Bacteria 4809
132 Ga0466969_0018199 3300044656 Bacteria 3663
133 Ga0466969_0084016 3300044656 Bacteria 1515
134 Ga0466972_0001358 3300044658 Bacteria 11863
135 Ga0466972_0002713 3300044658 Bacteria 8760
136 Ga0466972_0003563 3300044658 Bacteria 7737
137 Ga0466972_0004165 3300044658 Bacteria 7220
138 Ga0466965_0006310 3300044683 Bacteria 5372
139 Ga0466965_0021959 3300044683 Bacteria 3075
140 Ga0466966_0001115 3300044684 Bacteria 17231
141 Ga0466966_0002497 3300044684 Bacteria 12055
142 Ga0466966_0005602 3300044684 Bacteria 8255
143 Ga0466966_0213972 3300044684 Bacteria 1164
144 Ga0466961_0000850 3300044693 Bacteria 19092
145 Ga0466961_0021359 3300044693 Bacteria 4167
146 Ga0466961_0039353 3300044693 Bacteria 3031
147 Ga0466963_0000414 3300044694 Bacteria 19618
148 Ga0466963_0000701 3300044694 Bacteria 16341
149 Ga0466963_0144087 3300044694 Bacteria 1652
150 Ga0466964_0007583 3300044706 Bacteria 4059
151 Ga0466971_0000061 3300044719 Bacteria 41629
152 Ga0466971_0134727 3300044719 Bacteria 1148
153 Ga0466970_0002623 3300044765 Bacteria 8670
154 Ga0466970_0003588 3300044765 Bacteria 7566
155 Ga0466957_0000017 3300044842 Bacteria 66065
156 Ga0466960_0001357 3300044901 Bacteria 8902
157 Ga0466960_0122571 3300044901 Bacteria 1363
158 Ga0466959_0000248 3300045049 Bacteria 33380
159 Ga0466959_0050978 3300045049 Bacteria 3038
160 Ga0466959_0146596 3300045049 Bacteria 1665
161 Ga0466958_0003735 3300045836 Bacteria 7952
162 Ga0466967_0011334 3300045976 Bacteria 6745
163 Ga0466967_0019479 3300045976 Bacteria 5456
164 Ga0466967_0031173 3300045976 Bacteria 4485
165 Ga0466967_0040541 3300045976 Bacteria 4010
166 Ga0466967_0058360 3300045976 Bacteria 3411
167 Ga0466967_0073096 3300045976 Bacteria 3075
168 Ga0495617_020710 3300046452 Bacteria 2222
169 Ga0495627_014222 3300046453 Bacteria 2783
170 Ga0495592_0025567 3300046454 Bacteria 4481
171 Ga0495592_0029505 3300046454 Bacteria 4153
172 Ga0495603_0000963 3300046455 Bacteria 16592
173 Ga0495603_0019119 3300046455 Bacteria 4146
174 Ga0495629_0004661 3300046459 Bacteria 10264
175 Ga0495629_0007178 3300046459 Bacteria 8209
176 Ga0495629_0018718 3300046459 Bacteria 4949
177 Ga0495629_0028392 3300046459 Bacteria 3972
178 Ga0495629_0038243 3300046459 Bacteria 3380
179 Ga0495638_0050532 3300046460 Bacteria 2596
180 Ga0495638_0051615 3300046460 Bacteria 2565
181 Ga0495651_0041679 3300046462 Bacteria 3565
182 Ga0495582_0014103 3300046473 Bacteria 4398
183 Ga0495582_0027512 3300046473 Bacteria 3118
184 Ga0495605_0006524 3300046474 Bacteria 6699
185 Ga0495605_0055030 3300046474 Bacteria 1924
186 Ga0495639_0007665 3300046475 Bacteria 4644
187 Ga0495662_0001765 3300046476 Bacteria 10816
188 Ga0495662_0002973 3300046476 Bacteria 8555
189 Ga0495662_0022664 3300046476 Bacteria 3032
190 Ga0495664_0002789 3300046477 Bacteria 9399
191 Ga0495584_0080191 3300046491 Bacteria 1642
192 Ga0495585_0033647 3300046492 Bacteria 2901
193 Ga0495594_0020357 3300046499 Bacteria 3533
194 Ga0495594_0048296 3300046499 Bacteria 2338
195 Ga0495596_0008631 3300046500 Bacteria 4524
196 Ga0495596_0066289 3300046500 Bacteria 1404
197 Ga0495607_0041067 3300046501 Bacteria 2749
198 Ga0495583_0075668 3300046506 Bacteria 1472
199 Ga0495583_0096343 3300046506 Bacteria 1267
200 Ga0495606_0049931 3300046507 Bacteria 2740
201 Ga0495610_0031805 3300046512 Bacteria 2749
202 Ga0495616_0021562 3300046513 Bacteria 3486
203 Ga0495620_0007606 3300046515 Bacteria 5870
204 Ga0495620_0012644 3300046515 Bacteria 4350
205 Ga0495628_0093141 3300046516 Bacteria 2330
206 Ga0495630_0043599 3300046517 Bacteria 3352
207 Ga0495631_0058034 3300046518 Bacteria 1683
208 Ga0495637_0028472 3300046520 Bacteria 2496
209 Ga0495643_0003333 3300046522 Bacteria 11838
210 Ga0495648_0023368 3300046524 Bacteria 4235
211 Ga0495652_0102795 3300046529 Bacteria 2314
212 Ga0495640_0068243 3300046533 Bacteria 2393
213 Ga0495587_0002024 3300046536 Bacteria 13516
214 Ga0495597_0007954 3300046542 Bacteria 5339
215 Ga0495597_0022236 3300046542 Bacteria 2942
216 Ga0495645_0059696 3300046543 Bacteria 2765
217 Ga0495645_0211321 3300046543 Bacteria 1310
218 Ga0495633_0008207 3300046558 Bacteria 5911
219 Ga0495668_0018723 3300046616 Bacteria 4002
220 Ga0495668_0019259 3300046616 Bacteria 3936
221 Ga0495634_0002327 3300046642 Bacteria 15905
222 Ga0495611_0015861 3300046648 Bacteria 3219
223 Ga0495625_0050374 3300046660 Bacteria 2988
224 Ga0495625_0111973 3300046660 Bacteria 1865
225 Ga0495635_0041596 3300046663 Bacteria 3174
226 Ga0495661_0039294 3300046665 Bacteria 2941
227 Ga0495588_0002806 3300046674 Bacteria 7488
228 Ga0495588_0032978 3300046674 Bacteria 2613
229 Ga0495588_0081231 3300046674 Bacteria 1692
230 Ga0495657_0000957 3300046675 Bacteria 25502
231 Ga0495657_0059962 3300046675 Bacteria 2522
232 Ga0495646_0000705 3300046680 Bacteria 18483
233 Ga0495658_0098413 3300046683 Bacteria 1742
234 Ga0495613_0010001 3300046689 Bacteria 7045
235 Ga0495613_0017180 3300046689 Bacteria 5387
236 Ga0495613_0040625 3300046689 Bacteria 3446
237 Ga0495613_0253469 3300046689 Bacteria 1228
238 Ga0495624_0034777 3300046690 Bacteria 3256
239 Ga0495649_0024704 3300046694 Bacteria 3350
240 Ga0495649_0077866 3300046694 Bacteria 1774
241 Ga0495589_0014597 3300046794 Bacteria 4042
242 Ga0495589_0019977 3300046794 Bacteria 3426
243 Ga0495589_0020922 3300046794 Bacteria 3343
244 Ga0495600_0017445 3300046809 Bacteria 4567
245 Ga0495600_0057964 3300046809 Bacteria 2530
246 Ga0495660_0120108 3300046810 Bacteria 1330
247 Ga0495604_0021808 3300047317 Bacteria 5113
248 Ga0495636_0061668 3300047318 Bacteria 1586
249 Ga0495676_0005888 3300047321 Bacteria 11254
250 Ga0495676_0011324 3300047321 Bacteria 8053
251 Ga0495676_0021152 3300047321 Bacteria 5691
252 Ga0495676_0028057 3300047321 Bacteria 4816
253 Ga0495676_0034110 3300047321 Bacteria 4273
254 Ga0495680_0007811 3300047322 Bacteria 9770
255 Ga0495683_0021310 3300047323 Bacteria 3339
256 Ga0495687_002128 3300047443 Bacteria 16568
257 Ga0495687_017978 3300047443 Bacteria 3508
258 Ga0495687_045997 3300047443 Bacteria 1887
259 Ga0495675_0125450 3300047444 Bacteria 1597
260 Ga0495685_010643 3300047447 Bacteria 3088
261 Ga0495681_0060743 3300047470 Bacteria 1743
262 Ga0495684_0224271 3300047471 Bacteria 1377
263 Ga0495593_0012275 3300047673 Bacteria 4896
264 Ga0495593_0026270 3300047673 Bacteria 3216
265 Ga0495602_0090732 3300048088 Bacteria 2537
266 Ga0495614_0029608 3300048089 Bacteria 2356
267 Ga0495614_0056305 3300048089 Bacteria 1687
268 Ga0495626_0009016 3300048091 Bacteria 5409
269 Ga0496101_0027463 3300048904 Bacteria 3966
270 Ga0496102_0000375 3300048905 Bacteria 53640
271 Ga0496103_0023471 3300048906 Bacteria 3719
272 Ga0496114_0052551 3300048917 Bacteria 3395
273 Ga0495678_028072 3300049459 Bacteria 2379
274 Ga0501031_0102077 3300049568 Bacteria 1871
275 Ga0501032_0007043 3300049569 Bacteria 8247
276 Ga0501033_0003866 3300049570 Bacteria 12174
277 Ga0501033_0054435 3300049570 Bacteria 2960
278 Ga0501034_0055372 3300049571 Bacteria 3991
279 Ga0501036_0097703 3300049572 Bacteria 2482
280 Ga0501038_0003711 3300049574 Bacteria 14226
281 Ga0501038_0159441 3300049574 Bacteria 1834
282 Ga0501039_0166683 3300049575 Bacteria 1732
283 Ga0501040_0110424 3300049576 Bacteria 1923
284 Ga0501043_0028190 3300049579 Bacteria 4408
285 Ga0501046_0001916 3300049580 Bacteria 19748
286 Ga0501047_0041330 3300049581 Bacteria 4456
287 Ga0501047_0058413 3300049581 Bacteria 3726
288 Ga0501047_0106828 3300049581 Bacteria 2680
289 Ga0501067_0082101 3300049583 Bacteria 1787
290 Ga0501070_0159190 3300049586 Bacteria 1862
291 Ga0501243_006011 3300049675 Bacteria 1835
292 Ga0501261_007588 3300049690 Bacteria 1393
293 Ga0501080_0090615 3300049742 Bacteria 2840
294 Ga0501035_0009222 3300049822 Bacteria 9175
295 Ga0501035_0026385 3300049822 Bacteria 5315
296 Ga0501035_0201173 3300049822 Bacteria 1708
297 Ga0501044_0005100 3300049823 Bacteria 14652
298 Ga0501044_0041616 3300049823 Bacteria 4783
299 Ga0501044_0054921 3300049823 Bacteria 4092
300 Ga0501212_018120 3300049851 Bacteria 1070
301 nmdc:mga03n38_65356_c1 3300050490 Bacteria 1668
302 nmdc:mga04h51_13749_c1 3300050495 Bacteria 2298
303 nmdc:mga07m45_107910_c1 3300050496 Bacteria 1602
304 nmdc:mga09592_321950_c1 3300050508 Bacteria 1339
305 nmdc:mga0qj67_438280_c1 3300050509 Bacteria 1053
306 Ga0500644_0002794 3300053088 Bacteria 4343
307 Ga0500640_042040 3300053095 Bacteria 2007
308 Ga0500641_0000834 3300053096 Bacteria 11106
309 Ga0500572_005317 3300053111 Bacteria 2913
310 Ga0500568_0039218 3300053139 Bacteria 1913
311 Ga0501082_0169381 3300060353 Bacteria 1898
312 Ga0466962_0002122 3300061719 Bacteria 9365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0007043 Ga0501032_0007043_7098_8216 286
2 3300049568 Ga0501031_0102077 Ga0501031_0102077_535_1809 293
3 3300049570 Ga0501033_0054435 Ga0501033_0054435_1653_2927 293
4 3300049571 Ga0501034_0055372 Ga0501034_0055372_70_1344 293
5 3300049574 Ga0501038_0159441 Ga0501038_0159441_374_1648 293
6 3300049580 Ga0501046_0001916 Ga0501046_0001916_16920_18194 293
7 3300049581 Ga0501047_0058413 Ga0501047_0058413_455_1729 293
8 3300049583 Ga0501067_0082101 Ga0501067_0082101_153_1427 293
9 3300049586 Ga0501070_0159190 Ga0501070_0159190_185_1459 293
10 3300049822 Ga0501035_0009222 Ga0501035_0009222_220_1494 293
11 3300049823 Ga0501044_0041616 Ga0501044_0041616_3158_4432 293
12 3300060353 Ga0501082_0169381 Ga0501082_0169381_339_1613 293
13 3300032004 Ga0307414_10088239 Ga0307414_100882391 295
14 3300038443 Ga0395901_0517797 Ga0395901_0517797_97_1065 299
15 3300045976 Ga0466967_0031173 Ga0466967_0031173_17_985 300
16 3300047443 Ga0495687_045997 Ga0495687_045997_104_1030 306
17 3300046491 Ga0495584_0080191 Ga0495584_0080191_32_1024 308
18 3300044694 Ga0466963_0144087 Ga0466963_0144087_398_1381 312
19 3300046476 Ga0495662_0022664 Ga0495662_0022664_960_1964 312
20 3300006880 Ga0075429_100382965 Ga0075429_1003829652 313
21 3300009147 Ga0114129_10069028 Ga0114129_100690285 313
22 3300046500 Ga0495596_0066289 Ga0495596_0066289_407_1354 313
23 3300050508 nmdc:mga09592_321950_c1 nmdc:mga09592_321950_c1_213_1160 313
24 3300050509 nmdc:mga0qj67_438280_c1 nmdc:mga0qj67_438280_c1_84_1031 313
25 3300046543 Ga0495645_0211321 Ga0495645_0211321_21_1025 314
26 3300047444 Ga0495675_0125450 Ga0495675_0125450_96_1100 314
27 3300032002 Ga0307416_100240086 Ga0307416_1002400862 315
28 3300041406 Ga0439439_0010754 Ga0439439_0010754_53_1045 316
29 3300006051 Ga0075364_10009989 Ga0075364_100099893 317
30 iso_pu_bacteria 2984592036 2984594767 317
31 iso_pu_bacteria 2893684298 2893686339 318
32 3300003578 Ga0006562J51391_1112598 Ga0006562J51391_11125982 319
33 3300031731 Ga0307405_10126320 Ga0307405_101263201 319
34 3300031824 Ga0307413_10377299 Ga0307413_103772991 319
35 3300031901 Ga0307406_10150759 Ga0307406_101507591 319
36 3300031903 Ga0307407_10032895 Ga0307407_100328951 319
37 3300031995 Ga0307409_100128640 Ga0307409_1001286402 319
38 3300032002 Ga0307416_100092705 Ga0307416_1000927052 319
39 3300032004 Ga0307414_10217819 Ga0307414_102178191 319
40 3300046492 Ga0495585_0033647 Ga0495585_0033647_405_1550 319
41 3300046794 Ga0495589_0014597 Ga0495589_0014597_956_2101 319
42 3300046794 Ga0495589_0019977 Ga0495589_0019977_1178_2305 319
43 3300047318 Ga0495636_0061668 Ga0495636_0061668_75_1220 319
44 3300047447 Ga0495685_010643 Ga0495685_010643_1037_2182 319
45 3300049675 Ga0501243_006011 Ga0501243_006011_237_1247 319
46 3300049690 Ga0501261_007588 Ga0501261_007588_69_1079 319
47 3300049851 Ga0501212_018120 Ga0501212_018120_46_1056 319
48 3300046459 Ga0495629_0028392 Ga0495629_0028392_961_2025 320
49 3300046473 Ga0495582_0014103 Ga0495582_0014103_1102_2166 320
50 3300046473 Ga0495582_0027512 Ga0495582_0027512_1257_2315 320
51 3300046476 Ga0495662_0002973 Ga0495662_0002973_1538_2602 320
52 3300046689 Ga0495613_0010001 Ga0495613_0010001_592_1656 320
53 3300048905 Ga0496102_0000375 Ga0496102_0000375_43547_44602 320
54 3300048906 Ga0496103_0023471 Ga0496103_0023471_668_1723 320
55 3300014325 Ga0163163_10076448 Ga0163163_100764483 321
56 3300035691 Ga0373931_0129933 Ga0373931_0129933_345_1319 321
57 3300047321 Ga0495676_0021152 Ga0495676_0021152_1270_2415 321
58 3300048904 Ga0496101_0027463 Ga0496101_0027463_781_1755 321
59 3300005329 Ga0070683_100004714 Ga0070683_1000047144 322
60 3300025944 Ga0207661_10023369 Ga0207661_100233694 322
61 3300046474 Ga0495605_0055030 Ga0495605_0055030_622_1767 322
62 3300048917 Ga0496114_0052551 Ga0496114_0052551_704_1738 322
63 3300049575 Ga0501039_0166683 Ga0501039_0166683_50_1039 322
64 3300044901 Ga0466960_0122571 Ga0466960_0122571_218_1210 323
65 3300046689 Ga0495613_0253469 Ga0495613_0253469_31_1101 324
66 3300045976 Ga0466967_0040541 Ga0466967_0040541_1245_2255 325
67 3300031995 Ga0307409_100357809 Ga0307409_1003578091 327
68 3300032002 Ga0307416_100038786 Ga0307416_1000387862 327
69 3300032005 Ga0307411_10175238 Ga0307411_101752381 327
70 3300025904 Ga0207647_10072260 Ga0207647_100722601 329
71 3300031995 Ga0307409_100025212 Ga0307409_1000252123 329
72 3300032002 Ga0307416_100040433 Ga0307416_1000404333 329
73 3300042007 Ga0439449_0009380 Ga0439449_0009380_1364_2491 330
74 3300044658 Ga0466972_0004165 Ga0466972_0004165_1444_2571 330
75 3300044901 Ga0466960_0001357 Ga0466960_0001357_6266_7393 330
76 3300025944 Ga0207661_10139913 Ga0207661_101399132 331
77 3300046454 Ga0495592_0029505 Ga0495592_0029505_972_2099 331
78 3300046455 Ga0495603_0000963 Ga0495603_0000963_8541_9662 331
79 3300046459 Ga0495629_0007178 Ga0495629_0007178_3690_4811 331
80 3300046475 Ga0495639_0007665 Ga0495639_0007665_1408_2529 331
81 3300046516 Ga0495628_0093141 Ga0495628_0093141_820_1947 331
82 3300046542 Ga0495597_0022236 Ga0495597_0022236_281_1402 331
83 3300046663 Ga0495635_0041596 Ga0495635_0041596_1914_3041 331
84 3300046674 Ga0495588_0032978 Ga0495588_0032978_446_1567 331
85 3300046674 Ga0495588_0081231 Ga0495588_0081231_34_1071 331
86 3300046690 Ga0495624_0034777 Ga0495624_0034777_1715_2842 331
87 3300046794 Ga0495589_0020922 Ga0495589_0020922_1181_2302 331
88 3300046809 Ga0495600_0057964 Ga0495600_0057964_486_1613 331
89 3300047322 Ga0495680_0007811 Ga0495680_0007811_7321_8448 331
90 3300047443 Ga0495687_017978 Ga0495687_017978_1922_3043 331
91 3300047471 Ga0495684_0224271 Ga0495684_0224271_30_1157 331
92 3300048088 Ga0495602_0090732 Ga0495602_0090732_184_1311 331
93 3300005530 Ga0070679_100125080 Ga0070679_1001250802 333
94 3300020082 Ga0206353_11540478 Ga0206353_115404781 333
95 3300025921 Ga0207652_10095045 Ga0207652_100950452 333
96 3300032126 Ga0307415_100064895 Ga0307415_1000648952 333
97 3300046452 Ga0495617_020710 Ga0495617_020710_906_2033 333
98 3300046453 Ga0495627_014222 Ga0495627_014222_1467_2594 333
99 3300046455 Ga0495603_0019119 Ga0495603_0019119_2518_3645 333
100 3300046459 Ga0495629_0004661 Ga0495629_0004661_5840_6967 333
101 3300046460 Ga0495638_0050532 Ga0495638_0050532_212_1339 333
102 3300046474 Ga0495605_0006524 Ga0495605_0006524_993_2120 333
103 3300046499 Ga0495594_0048296 Ga0495594_0048296_1141_2268 333
104 3300046501 Ga0495607_0041067 Ga0495607_0041067_905_2032 333
105 3300046506 Ga0495583_0096343 Ga0495583_0096343_70_1197 333
106 3300046507 Ga0495606_0049931 Ga0495606_0049931_200_1327 333
107 3300046512 Ga0495610_0031805 Ga0495610_0031805_1209_2336 333
108 3300046513 Ga0495616_0021562 Ga0495616_0021562_1968_3095 333
109 3300046515 Ga0495620_0007606 Ga0495620_0007606_2348_3475 333
110 3300046515 Ga0495620_0012644 Ga0495620_0012644_2718_3845 333
111 3300046518 Ga0495631_0058034 Ga0495631_0058034_55_1182 333
112 3300046520 Ga0495637_0028472 Ga0495637_0028472_711_1838 333
113 3300046522 Ga0495643_0003333 Ga0495643_0003333_9767_10894 333
114 3300046524 Ga0495648_0023368 Ga0495648_0023368_307_1434 333
115 3300046542 Ga0495597_0007954 Ga0495597_0007954_2245_3372 333
116 3300046558 Ga0495633_0008207 Ga0495633_0008207_377_1504 333
117 3300046616 Ga0495668_0018723 Ga0495668_0018723_1137_2264 333
118 3300046616 Ga0495668_0019259 Ga0495668_0019259_70_1197 333
119 3300046648 Ga0495611_0015861 Ga0495611_0015861_1991_3118 333
120 3300046665 Ga0495661_0039294 Ga0495661_0039294_1138_2265 333
121 3300046675 Ga0495657_0059962 Ga0495657_0059962_218_1345 333
122 3300046689 Ga0495613_0017180 Ga0495613_0017180_3870_4997 333
123 3300046694 Ga0495649_0024704 Ga0495649_0024704_1954_3081 333
124 3300046694 Ga0495649_0077866 Ga0495649_0077866_578_1705 333
125 3300046810 Ga0495660_0120108 Ga0495660_0120108_70_1197 333
126 3300047317 Ga0495604_0021808 Ga0495604_0021808_123_1250 333
127 3300047321 Ga0495676_0011324 Ga0495676_0011324_5909_7036 333
128 3300047321 Ga0495676_0034110 Ga0495676_0034110_2487_3614 333
129 3300047323 Ga0495683_0021310 Ga0495683_0021310_2063_3190 333
130 3300047470 Ga0495681_0060743 Ga0495681_0060743_490_1617 333
131 3300047673 Ga0495593_0026270 Ga0495593_0026270_28_1155 333
132 3300048089 Ga0495614_0056305 Ga0495614_0056305_243_1370 333
133 3300048091 Ga0495626_0009016 Ga0495626_0009016_423_1550 333
134 3300049459 Ga0495678_028072 Ga0495678_028072_1052_2179 333
135 3300045976 Ga0466967_0073096 Ga0466967_0073096_859_1986 334
136 3300003316 rootH1_10000935 rootH1_100009352 335
137 3300003323 rootH1_10032890 rootH1_100328902 335
138 3300014497 Ga0182008_10010032 Ga0182008_100100322 335
139 3300014497 Ga0182008_10013357 Ga0182008_100133572 335
140 3300015262 Ga0182007_10000129 Ga0182007_1000012910 335
141 3300015262 Ga0182007_10002536 Ga0182007_100025368 335
142 3300027312 Ga0209371_1010012 Ga0209371_10100123 335
143 3300030500 Ga0268256_1010124 Ga0268256_10101243 335
144 3300053096 Ga0500641_0000834 Ga0500641_0000834_6584_7636 335
145 3300003323 rootH1_10109514 rootH1_101095142 336
146 3300006048 Ga0075363_100012671 Ga0075363_1000126716 336
147 3300006353 Ga0075370_10106118 Ga0075370_101061181 336
148 3300006948 Ga0099826_10036947 Ga0099826_100369473 336
149 3300015688 Ga0183367_1007 Ga0183367_1007228 336
150 3300031456 Ga0307513_10050749 Ga0307513_100507491 336
151 3300031649 Ga0307514_10087348 Ga0307514_100873483 336
152 3300042131 Ga0450894_001068 Ga0450894_001068_1873_3000 336
153 3300042134 Ga0450898_000980 Ga0450898_000980_399_1526 336
154 3300042135 Ga0450899_001148 Ga0450899_001148_1668_2795 336
155 3300050490 nmdc:mga03n38_65356_c1 nmdc:mga03n38_65356_c1_366_1493 336
156 3300050496 nmdc:mga07m45_107910_c1 nmdc:mga07m45_107910_c1_134_1261 336
157 3300006178 Ga0075367_10059026 Ga0075367_100590263 337
158 3300027866 Ga0209813_10016764 Ga0209813_100167642 337
159 3300035115 Ga0373941_0068522 Ga0373941_0068522_43_1095 337
160 3300044656 Ga0466969_0084016 Ga0466969_0084016_36_1127 337
161 3300044684 Ga0466966_0002497 Ga0466966_0002497_5482_6573 337
162 3300044693 Ga0466961_0039353 Ga0466961_0039353_1662_2753 337
163 3300044694 Ga0466963_0000701 Ga0466963_0000701_5360_6487 337
164 3300044765 Ga0466970_0002623 Ga0466970_0002623_1857_2984 337
165 3300050495 nmdc:mga04h51_13749_c1 nmdc:mga04h51_13749_c1_740_1867 337
166 3300011119 Ga0105246_10046906 Ga0105246_100469064 338
167 3300013307 Ga0157372_10112077 Ga0157372_101120772 338
168 3300028794 Ga0307515_10143502 Ga0307515_101435022 338
169 3300030522 Ga0307512_10035595 Ga0307512_100355951 338
170 3300031649 Ga0307514_10066832 Ga0307514_100668322 338
171 3300032002 Ga0307416_100238882 Ga0307416_1002388822 338
172 3300041512 Ga0451853_3268434 Ga0451853_3268434_320_1447 338
173 3300044658 Ga0466972_0001358 Ga0466972_0001358_2736_3827 338
174 iso_pu_bacteria 2738541272 2738694112 338
175 iso_pu_bacteria 2738543027 2739325352 338
176 iso_pu_bacteria 2739367654 2739609278 338
177 iso_pu_bacteria 2758568621 2760625919 338
178 iso_pu_bacteria 2808606394 2809030927 338
179 iso_pu_bacteria 8056579771 8056584301 338
180 3300001989 JGI24739J22299_10021373 JGI24739J22299_100213732 339
181 3300005563 Ga0068855_100063067 Ga0068855_1000630671 339
182 3300042005 Ga0439448_0000713 Ga0439448_0000713_4610_5743 339
183 3300042012 Ga0439455_0005983 Ga0439455_0005983_789_1922 339
184 3300042138 Ga0450903_000090 Ga0450903_000090_4532_5665 339
185 3300044684 Ga0466966_0213972 Ga0466966_0213972_81_1136 339
186 3300049572 Ga0501036_0097703 Ga0501036_0097703_1010_2137 339
187 3300049574 Ga0501038_0003711 Ga0501038_0003711_1796_2923 339
188 3300049579 Ga0501043_0028190 Ga0501043_0028190_2188_3315 339
189 3300049581 Ga0501047_0041330 Ga0501047_0041330_1904_3031 339
190 iso_pu_bacteria 2758568522 2760305602 339
191 3300003320 rootH2_10040397 rootH2_100403973 340
192 3300030522 Ga0307512_10010586 Ga0307512_100105869 340
193 3300031548 Ga0307408_100041904 Ga0307408_1000419042 340
194 3300031616 Ga0307508_10021062 Ga0307508_100210624 340
195 3300031995 Ga0307409_100017094 Ga0307409_1000170944 340
196 3300031995 Ga0307409_100249798 Ga0307409_1002497981 340
197 3300032126 Ga0307415_100226649 Ga0307415_1002266492 340
198 3300033179 Ga0307507_10109593 Ga0307507_101095931 340
199 3300046459 Ga0495629_0018718 Ga0495629_0018718_3433_4554 340
200 3300046660 Ga0495625_0050374 Ga0495625_0050374_1613_2734 340
201 3300046674 Ga0495588_0002806 Ga0495588_0002806_4661_5782 340
202 3300049581 Ga0501047_0106828 Ga0501047_0106828_259_1386 340
203 3300049742 Ga0501080_0090615 Ga0501080_0090615_1603_2730 340
204 3300049822 Ga0501035_0201173 Ga0501035_0201173_401_1528 340
205 3300049823 Ga0501044_0054921 Ga0501044_0054921_2385_3512 340
206 3300005367 Ga0070667_100074855 Ga0070667_1000748552 341
207 3300005614 Ga0068856_100226530 Ga0068856_1002265302 341
208 3300013307 Ga0157372_10536735 Ga0157372_105367351 341
209 3300025932 Ga0207690_10257401 Ga0207690_102574011 341
210 3300030733 Ga0314311_1091873 Ga0314311_10918732 341
211 3300046536 Ga0495587_0002024 Ga0495587_0002024_942_2069 341
212 3300046680 Ga0495646_0000705 Ga0495646_0000705_1064_2191 341
213 3300053139 Ga0500568_0039218 Ga0500568_0039218_24_1160 341
214 3300028786 Ga0307517_10004603 Ga0307517_1000460317 342
215 3300028794 Ga0307515_10000963 Ga0307515_1000096337 342
216 3300031507 Ga0307509_10021039 Ga0307509_100210397 342
217 3300031616 Ga0307508_10018990 Ga0307508_100189901 342
218 3300033179 Ga0307507_10013752 Ga0307507_1001375212 342
219 3300033179 Ga0307507_10032773 Ga0307507_100327735 342
220 3300033180 Ga0307510_10039895 Ga0307510_100398955 342
221 3300046454 Ga0495592_0025567 Ga0495592_0025567_1074_2201 342
222 3300046460 Ga0495638_0051615 Ga0495638_0051615_525_1652 342
223 3300046462 Ga0495651_0041679 Ga0495651_0041679_1381_2508 342
224 3300046476 Ga0495662_0001765 Ga0495662_0001765_2471_3598 342
225 3300046477 Ga0495664_0002789 Ga0495664_0002789_5574_6701 342
226 3300046506 Ga0495583_0075668 Ga0495583_0075668_210_1337 342
227 3300046517 Ga0495630_0043599 Ga0495630_0043599_1789_2916 342
228 3300046529 Ga0495652_0102795 Ga0495652_0102795_677_1804 342
229 3300046533 Ga0495640_0068243 Ga0495640_0068243_1174_2301 342
230 3300046543 Ga0495645_0059696 Ga0495645_0059696_103_1230 342
231 3300046642 Ga0495634_0002327 Ga0495634_0002327_14523_15650 342
232 3300046675 Ga0495657_0000957 Ga0495657_0000957_18299_19426 342
233 3300046683 Ga0495658_0098413 Ga0495658_0098413_106_1233 342
234 3300046689 Ga0495613_0040625 Ga0495613_0040625_1457_2584 342
235 3300046809 Ga0495600_0017445 Ga0495600_0017445_256_1383 342
236 3300047321 Ga0495676_0028057 Ga0495676_0028057_1072_2199 342
237 3300047673 Ga0495593_0012275 Ga0495593_0012275_1076_2203 342
238 3300048089 Ga0495614_0029608 Ga0495614_0029608_393_1520 342
239 3300049576 Ga0501040_0110424 Ga0501040_0110424_52_1173 342
240 3300053088 Ga0500644_0002794 Ga0500644_0002794_3019_4146 342
241 3300053095 Ga0500640_042040 Ga0500640_042040_626_1753 342
242 3300053111 Ga0500572_005317 Ga0500572_005317_641_1768 342
243 3300044656 Ga0466969_0010926 Ga0466969_0010926_517_1644 343
244 3300044658 Ga0466972_0002713 Ga0466972_0002713_1412_2539 343
245 3300044683 Ga0466965_0021959 Ga0466965_0021959_1161_2288 343
246 3300044684 Ga0466966_0005602 Ga0466966_0005602_2952_4079 343
247 3300044693 Ga0466961_0021359 Ga0466961_0021359_55_1182 343
248 3300045049 Ga0466959_0050978 Ga0466959_0050978_1119_2246 343
249 3300031852 Ga0307410_10155933 Ga0307410_101559332 344
250 3300031903 Ga0307407_10073330 Ga0307407_100733302 344
251 3300032002 Ga0307416_100162097 Ga0307416_1001620972 344
252 3300041404 Ga0439436_0009177 Ga0439436_0009177_1296_2447 344
253 3300041406 Ga0439439_0011542 Ga0439439_0011542_930_2057 344
254 3300041999 Ga0439433_0003248 Ga0439433_0003248_1393_2544 344
255 3300042007 Ga0439449_0004175 Ga0439449_0004175_2611_3744 344
256 3300042014 Ga0439457_000135 Ga0439457_000135_17434_18585 344
257 3300042014 Ga0439457_003688 Ga0439457_003688_1268_2395 344
258 3300045976 Ga0466967_0058360 Ga0466967_0058360_1323_2450 344
259 3300020082 Ga0206353_10375918 Ga0206353_103759183 345
260 3300025904 Ga0207647_10055951 Ga0207647_100559512 345
261 3300032005 Ga0307411_10088587 Ga0307411_100885872 345
262 3300046459 Ga0495629_0038243 Ga0495629_0038243_363_1457 345
263 3300046499 Ga0495594_0020357 Ga0495594_0020357_19_1113 345
264 3300047321 Ga0495676_0005888 Ga0495676_0005888_4841_5935 345
265 iso_pu_bacteria 2622736605 2623499128 346
266 3300005347 Ga0070668_100004273 Ga0070668_1000042738 347
267 3300005719 Ga0068861_100152079 Ga0068861_1001520792 347
268 3300005844 Ga0068862_100114549 Ga0068862_1001145491 347
269 3300025928 Ga0207700_10193829 Ga0207700_101938291 347
270 3300025972 Ga0207668_10002670 Ga0207668_100026704 347
271 3300031731 Ga0307405_10274317 Ga0307405_102743171 347
272 3300031901 Ga0307406_10076696 Ga0307406_100766962 347
273 3300031995 Ga0307409_100047062 Ga0307409_1000470623 347
274 3300032002 Ga0307416_100071297 Ga0307416_1000712973 347
275 3300035112 Ga0373932_0039643 Ga0373932_0039643_94_1212 347
276 3300035207 Ga0373942_0000986 Ga0373942_0000986_3295_4413 347
277 3300045049 Ga0466959_0146596 Ga0466959_0146596_326_1447 347
278 3300045976 Ga0466967_0019479 Ga0466967_0019479_2971_4092 347
279 iso_pu_bacteria 2912757875 2912764337 347
280 3300005530 Ga0070679_100087258 Ga0070679_1000872582 348
281 iso_pu_bacteria 2582581313 2585307678 349
282 iso_pu_bacteria 2582581314 2585314275 349
283 iso_pu_bacteria 2616644814 2616694103 349
284 iso_pu_bacteria 2643221548 2643762080 349
285 iso_pu_bacteria 2643221647 2644270944 349
286 iso_pu_bacteria 2643221670 2644386127 349
287 iso_pu_bacteria 2643221678 2644435612 349
288 iso_pu_bacteria 2643221682 2644459141 349
289 iso_pu_bacteria 2643221714 2644629552 349
290 iso_pu_bacteria 2784132148 2784587234 349
291 iso_pu_bacteria 2784746768 2785367764 349
292 iso_pu_bacteria 2786546132 2786668809 349
293 iso_pu_bacteria 2808606359 2808848230 349
294 iso_pu_bacteria 2808606375 2808918996 349
295 iso_pu_bacteria 2808606448 2809230802 349
296 iso_pu_bacteria 2811994879 2812359764 349
297 iso_pu_bacteria 2852635781 2852638258 349
298 iso_pu_bacteria 2862178590 2862182705 349
299 iso_pu_bacteria 2862281513 2862288889 349
300 iso_pu_bacteria 2863404153 2863406377 349
301 iso_pu_bacteria 2867428634 2867437159 349
302 iso_pu_bacteria 2873151551 2873157185 349
303 iso_pu_bacteria 2877676314 2877682792 349
304 iso_pu_bacteria 2912715099 2912721821 349
305 iso_pu_bacteria 2912723979 2912725628 349
306 iso_pu_bacteria 2918501144 2918501904 349
307 iso_pu_bacteria 2919468124 2919473130 349
308 iso_pu_bacteria 2946064051 2946066144 349
309 iso_pu_bacteria 2946072368 2946074430 349
310 iso_pu_bacteria 2947224130 2947231233 349
311 iso_pu_bacteria 2954002825 2954004528 349
312 iso_pu_bacteria 2954380949 2954387987 349
313 iso_pu_bacteria 2954673503 2954675088 349
314 iso_pu_bacteria 2954682443 2954689047 349
315 iso_pu_bacteria 2954691527 2954698798 349
316 iso_pu_bacteria 2954701450 2954703425 349
317 iso_pu_bacteria 2954711539 2954717770 349
318 iso_pu_bacteria 2954721474 2954727736 349
319 iso_pu_bacteria 2954731030 2954734066 349
320 iso_pu_bacteria 2954740390 2954746628 349
321 iso_pu_bacteria 2954749733 2954752950 349
322 iso_pu_bacteria 2954759201 2954765746 349
323 iso_pu_bacteria 2990059506 2990060318 349
324 iso_pu_bacteria 3006393351 3006397031 349
325 iso_pu_bacteria 3006493962 3006495392 349
326 iso_pu_bacteria 8008558824 8008561931 349
327 iso_pu_bacteria 8008574985 8008580237 349
328 iso_pu_bacteria 8023623736 8023627991 349
329 iso_pu_bacteria 8056829672 8056831069 349
330 3300037466 Ga0395898_0110735 Ga0395898_0110735_1274_2383 350
331 3300038443 Ga0395901_0244888 Ga0395901_0244888_161_1270 350
332 iso_pu_bacteria 2515154155 2515852755 350
333 3300031730 Ga0307516_10015488 Ga0307516_100154883 351
334 3300044719 Ga0466971_0134727 Ga0466971_0134727_12_1103 351
335 3300003578 Ga0006562J51391_1075109 Ga0006562J51391_10751092 353
336 3300006038 Ga0075365_10142910 Ga0075365_101429101 353
337 3300030521 Ga0307511_10000298 Ga0307511_1000029837 353
338 3300031507 Ga0307509_10006297 Ga0307509_100062975 353
339 3300031649 Ga0307514_10004684 Ga0307514_100046842 353
340 3300031730 Ga0307516_10000904 Ga0307516_1000090410 353
341 3300031730 Ga0307516_10008457 Ga0307516_1000845712 353
342 3300033180 Ga0307510_10025745 Ga0307510_100257455 353
343 3300037418 Ga0395900_0355236 Ga0395900_0355236_14_1141 353
344 3300037466 Ga0395898_0013194 Ga0395898_0013194_735_1859 353
345 3300037466 Ga0395898_0031291 Ga0395898_0031291_3425_4552 353
346 3300038443 Ga0395901_0077989 Ga0395901_0077989_1051_2178 353
347 3300044656 Ga0466969_0018199 Ga0466969_0018199_1011_2138 353
348 3300044658 Ga0466972_0003563 Ga0466972_0003563_2409_3536 353
349 3300044683 Ga0466965_0006310 Ga0466965_0006310_3572_4699 353
350 3300044684 Ga0466966_0001115 Ga0466966_0001115_8241_9368 353
351 3300044693 Ga0466961_0000850 Ga0466961_0000850_16869_17996 353
352 3300044694 Ga0466963_0000414 Ga0466963_0000414_8134_9261 353
353 3300044706 Ga0466964_0007583 Ga0466964_0007583_379_1506 353
354 3300044719 Ga0466971_0000061 Ga0466971_0000061_28804_29931 353
355 3300044765 Ga0466970_0003588 Ga0466970_0003588_1582_2709 353
356 3300044842 Ga0466957_0000017 Ga0466957_0000017_31521_32648 353
357 3300045049 Ga0466959_0000248 Ga0466959_0000248_11819_12946 353
358 3300045836 Ga0466958_0003735 Ga0466958_0003735_1221_2348 353
359 3300045976 Ga0466967_0011334 Ga0466967_0011334_3889_5016 353
360 3300046500 Ga0495596_0008631 Ga0495596_0008631_1619_2746 353
361 3300047443 Ga0495687_002128 Ga0495687_002128_2478_3605 353
362 3300049570 Ga0501033_0003866 Ga0501033_0003866_2571_3698 353
363 3300049822 Ga0501035_0026385 Ga0501035_0026385_1365_2492 353
364 3300049823 Ga0501044_0005100 Ga0501044_0005100_6420_7547 353
365 3300061719 Ga0466962_0002122 Ga0466962_0002122_4082_5209 353
366 iso_pu_bacteria 2862574272 2862583142 355
367 iso_pu_bacteria 2816332119 2816426752 356
368 iso_pu_bacteria 8025530807 8025533931 356
369 iso_pu_bacteria 2675903058 2676477840 358
370 iso_pu_bacteria 2827628540 2827629164 358
371 3300001979 JGI24740J21852_10010152 JGI24740J21852_100101522 361
372 3300001989 JGI24739J22299_10008021 JGI24739J22299_100080212 361
373 3300001990 JGI24737J22298_10010845 JGI24737J22298_100108453 361
374 3300013307 Ga0157372_10300684 Ga0157372_103006842 361
375 3300025904 Ga0207647_10013506 Ga0207647_100135063 361
376 3300025972 Ga0207668_10036803 Ga0207668_100368034 361
377 3300046660 Ga0495625_0111973 Ga0495625_0111973_267_1352 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

83

379

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.844 37 357
5jrw-assembly1.cif.gz_B crystal structure of thermotoga maritima mutant d89r/d253r 0.8308 31 356
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8244 37 357
5jtg-assembly1.cif.gz_E crystal structure of thermotoga maritima mutant d89k/d253k 0.8186 33 357
3nvo-assembly1.cif.gz_A the soluble domain structure of the zntb zn2+ efflux system 0.8186 31 298
ID Description Score Start End Superfamily
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.9419 51 173 3.30.460.20
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9398 175 287 1.20.58.340
5jtgA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9349 179 282 1.20.58.340
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9342 177 282 1.20.58.340
2iubA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9326 177 282 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A1C5BG78-F1-model_v4 Magnesium transporter 0.9467 34 214 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A4R7JDC9-F1-model_v4 deleted 0.9434 32 155
AF-A0A5E3ZX14-F1-model_v4 Cobalt/magnesium transport protein CorA 0.9391 33 361 GO:0000287
GO:0003723
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A346Y4V1-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9345 34 361 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A7Y3G1W9-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9324 34 330 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Feature Viewer

pLDDT pTM Quality
83.22 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map