F427836

General Info

Members Datasets Scaffolds Average Seq Length
377 204 754 198

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0002158|Ga0501069_0002158_3603_4271
Length 222
Sequence MNPGLGTRDSGLGTLRRIVLASGNPGKLVELRELLAGSGIELTSKRDFGIPDPAETGTTFVENAIIKARHTAMLSGLPALADDSGICVDAQGGAPGLDSALYAGTHGADEANNDKLLAALADVPDAGRTAHYVCVLALLRGAGDPDPLIAIGRWHGRILRTRRGNHGFGYDPLFLPDDGGGLSSAELDPAVKNRLSHRGQALAELHRLLFPSPSGRGCPQGG

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 2.65
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0002158 3300049585 Bacteria 9899
2 MBSR1b_contig_7472051 2162886012 Bacteria 800
3 JGI24742J22300_10018492 3300002244 Bacteria 1181
4 Ga0065707_10087200 3300005295 Bacteria 5121
5 Ga0070676_10332437 3300005328 Bacteria 1040
6 Ga0070690_100002107 3300005330 Bacteria 10629
7 Ga0070690_100174850 3300005330 Bacteria 1480
8 Ga0070670_100015962 3300005331 Bacteria 6444
9 Ga0070670_100300132 3300005331 Bacteria 1405
10 Ga0070677_10006442 3300005333 Bacteria 3901
11 Ga0070677_10192062 3300005333 Bacteria 979
12 Ga0068869_100005500 3300005334 Bacteria 7973
13 Ga0068869_100432747 3300005334 Bacteria 1087
14 Ga0068869_101539205 3300005334 Bacteria 591
15 Ga0070666_10108461 3300005335 Bacteria 1918
16 Ga0070680_100205232 3300005336 Bacteria 1662
17 Ga0070680_100639479 3300005336 Bacteria 914
18 Ga0070680_101156374 3300005336 Bacteria 669
19 Ga0070682_100053021 3300005337 Bacteria 2540
20 Ga0068868_100199912 3300005338 Bacteria 1666
21 Ga0070689_100059376 3300005340 Bacteria 2972
22 Ga0070689_100272688 3300005340 Bacteria 1401
23 Ga0070691_10147863 3300005341 Bacteria 1202
24 Ga0070687_100002248 3300005343 Bacteria 7161
25 Ga0070687_100077032 3300005343 Bacteria 1808
26 Ga0070661_100001590 3300005344 Bacteria 15755
27 Ga0070668_100017108 3300005347 Bacteria 5426
28 Ga0070668_100622593 3300005347 Bacteria 946
29 Ga0070669_100035096 3300005353 Bacteria 3632
30 Ga0070675_100003567 3300005354 Bacteria 11826
31 Ga0070675_100014091 3300005354 Bacteria 6298
32 Ga0070675_100059698 3300005354 Bacteria 3147
33 Ga0070675_100499659 3300005354 Bacteria 1096
34 Ga0070671_100145012 3300005355 Bacteria 2004
35 Ga0070674_100061867 3300005356 Bacteria 2614
36 Ga0070674_100238158 3300005356 Bacteria 1423
37 Ga0070674_100343280 3300005356 Bacteria 1204
38 Ga0070674_100454527 3300005356 Bacteria 1058
39 Ga0070674_100689518 3300005356 Bacteria 872
40 Ga0070673_100003858 3300005364 Bacteria 9412
41 Ga0070673_100067928 3300005364 Bacteria 2852
42 Ga0070673_100186231 3300005364 Bacteria 1780
43 Ga0070688_100007326 3300005365 Bacteria 5943
44 Ga0070688_100086668 3300005365 Bacteria 2038
45 Ga0070688_100188027 3300005365 Bacteria 1437
46 Ga0070659_100187786 3300005366 Bacteria 1698
47 Ga0070667_100027185 3300005367 Bacteria 4761
48 Ga0070701_10006492 3300005438 Bacteria 4927
49 Ga0070701_10049954 3300005438 Bacteria 2164
50 Ga0070705_100040338 3300005440 Bacteria 2654
51 Ga0070700_100036658 3300005441 Bacteria 2976
52 Ga0070700_100097364 3300005441 Bacteria 1932
53 Ga0070694_100793813 3300005444 Bacteria 776
54 Ga0070663_100684832 3300005455 Bacteria 870
55 Ga0070678_100035001 3300005456 Bacteria 3502
56 Ga0070678_100144339 3300005456 Bacteria 1909
57 Ga0070662_100014306 3300005457 Bacteria 5298
58 Ga0070662_100077753 3300005457 Bacteria 2463
59 Ga0068867_100057541 3300005459 Bacteria 2879
60 Ga0070685_10002190 3300005466 Bacteria 10093
61 Ga0070685_10099586 3300005466 Bacteria 1773
62 Ga0070684_100001081 3300005535 Bacteria 19541
63 Ga0068853_100552521 3300005539 Bacteria 1091
64 Ga0070672_100017055 3300005543 Bacteria 5217
65 Ga0070672_100193424 3300005543 Bacteria 1699
66 Ga0070686_100002681 3300005544 Bacteria 9803
67 Ga0070695_100654194 3300005545 Bacteria 830
68 Ga0070693_100693183 3300005547 Bacteria 745
69 Ga0070665_100056768 3300005548 Bacteria 3926
70 Ga0070665_100238306 3300005548 Bacteria 1820
71 Ga0070665_100477040 3300005548 Bacteria 1258
72 Ga0070704_100099774 3300005549 Bacteria 2184
73 Ga0070664_100004278 3300005564 Bacteria 11486
74 Ga0070664_100782876 3300005564 Bacteria 891
75 Ga0068857_100006531 3300005577 Bacteria 10006
76 Ga0068857_100075565 3300005577 Bacteria 3004
77 Ga0070702_100477935 3300005615 Bacteria 910
78 Ga0068859_100000702 3300005617 Bacteria 33593
79 Ga0068859_100398107 3300005617 Bacteria 1473
80 Ga0068864_100000596 3300005618 Bacteria 30698
81 Ga0068866_10398641 3300005718 Bacteria 887
82 Ga0068861_100000608 3300005719 Bacteria 21194
83 Ga0068861_100011557 3300005719 Bacteria 6143
84 Ga0068861_100173304 3300005719 Bacteria 1790
85 Ga0068870_10001252 3300005840 Bacteria 10191
86 Ga0068870_10036775 3300005840 Bacteria 2520
87 Ga0068870_10066000 3300005840 Bacteria 1959
88 Ga0068870_10624686 3300005840 Bacteria 735
89 Ga0068863_100001379 3300005841 Bacteria 24112
90 Ga0068863_100074904 3300005841 Bacteria 3202
91 Ga0068858_100052136 3300005842 Bacteria 3785
92 Ga0068858_100565699 3300005842 Bacteria 1101
93 Ga0068860_100332130 3300005843 Bacteria 1493
94 Ga0068862_100024576 3300005844 Bacteria 5056
95 Ga0068862_101363405 3300005844 Bacteria 712
96 Ga0081455_10009435 3300005937 Bacteria 10038
97 Ga0097621_100028926 3300006237 Bacteria 4373
98 Ga0097621_100029604 3300006237 Bacteria 4327
99 Ga0097621_100107984 3300006237 Bacteria 2349
100 Ga0097621_100149944 3300006237 Bacteria 1999
101 Ga0068871_100059311 3300006358 Bacteria 3118
102 Ga0068871_100088671 3300006358 Bacteria 2574
103 Ga0068871_100132980 3300006358 Bacteria 2110
104 Ga0075428_100003877 3300006844 Bacteria 16440
105 Ga0075428_100007584 3300006844 Bacteria 12024
106 Ga0075428_100017320 3300006844 Bacteria 7963
107 Ga0075428_100018181 3300006844 Bacteria 7766
108 Ga0075428_100204026 3300006844 Bacteria 2137
109 Ga0075430_100006753 3300006846 Bacteria 9676
110 Ga0075430_100016559 3300006846 Bacteria 6280
111 Ga0075430_100166569 3300006846 Bacteria 1833
112 Ga0075431_100000328 3300006847 Bacteria 37639
113 Ga0075431_100019168 3300006847 Bacteria 6972
114 Ga0075431_100094931 3300006847 Bacteria 3078
115 Ga0075431_100771702 3300006847 Bacteria 936
116 Ga0075434_100000678 3300006871 Bacteria 26446
117 Ga0075434_100171475 3300006871 Bacteria 2190
118 Ga0075429_100007799 3300006880 Bacteria 9297
119 Ga0075429_100038515 3300006880 Bacteria 4162
120 Ga0075429_100415740 3300006880 Bacteria 1178
121 Ga0075429_100425484 3300006880 Bacteria 1163
122 Ga0068865_100008985 3300006881 Bacteria 6183
123 Ga0068865_100111072 3300006881 Bacteria 2023
124 Ga0097620_100000702 3300006931 Bacteria 33593
125 Ga0097620_100398087 3300006931 Bacteria 1473
126 Ga0075435_100204945 3300007076 Bacteria 1672
127 Ga0111539_10003512 3300009094 Bacteria 20670
128 Ga0111539_10020186 3300009094 Bacteria 8211
129 Ga0111539_10108266 3300009094 Bacteria 3261
130 Ga0111539_10296905 3300009094 Bacteria 1880
131 Ga0111539_10390945 3300009094 Bacteria 1620
132 Ga0114129_10012746 3300009147 Bacteria 11969
133 Ga0114129_10050295 3300009147 Bacteria 5854
134 Ga0114129_10365715 3300009147 Bacteria 1908
135 Ga0114129_10777175 3300009147 Bacteria 1224
136 Ga0105243_10855222 3300009148 Bacteria 901
137 Ga0105248_10051288 3300009177 Bacteria 4630
138 Ga0105248_10308341 3300009177 Bacteria 1783
139 Ga0105249_10016587 3300009553 Bacteria 6537
140 Ga0105249_10037388 3300009553 Bacteria 4405
141 Ga0105246_10186517 3300011119 Bacteria 1602
142 Ga0157371_10206732 3300013102 Bacteria 1408
143 Ga0157378_10171428 3300013297 Bacteria 2035
144 Ga0163162_10046968 3300013306 Bacteria 4328
145 Ga0163162_10128386 3300013306 Bacteria 2643
146 Ga0157372_10092306 3300013307 Bacteria 3444
147 Ga0157375_10004588 3300013308 Bacteria 12002
148 Ga0157375_10694787 3300013308 Bacteria 1171
149 Ga0157375_11143160 3300013308 Bacteria 912
150 Ga0163163_10002427 3300014325 Bacteria 15768
151 Ga0157380_10007721 3300014326 Bacteria 7655
152 Ga0157380_10030144 3300014326 Bacteria 4152
153 Ga0157380_10075579 3300014326 Bacteria 2738
154 Ga0157380_11083001 3300014326 Bacteria 839
155 Ga0157380_11205494 3300014326 Bacteria 801
156 Ga0157377_10026547 3300014745 Bacteria 3100
157 Ga0157379_10179461 3300014968 Bacteria 1913
158 Ga0157379_10229374 3300014968 Bacteria 1683
159 Ga0157376_10161724 3300014969 Bacteria 2030
160 Ga0163161_10238559 3300017792 Bacteria 1413
161 Ga0163161_10438824 3300017792 Bacteria 1053
162 Ga0207673_1027799 3300025290 Bacteria 778
163 Ga0207682_10006561 3300025893 Bacteria 4683
164 Ga0207682_10028404 3300025893 Bacteria 2232
165 Ga0207642_10036398 3300025899 Bacteria 2112
166 Ga0207642_10066167 3300025899 Bacteria 1701
167 Ga0207642_10218534 3300025899 Bacteria 1064
168 Ga0207688_10012729 3300025901 Bacteria 4576
169 Ga0207680_10015048 3300025903 Bacteria 4026
170 Ga0207645_10048632 3300025907 Bacteria 2709
171 Ga0207643_10005567 3300025908 Bacteria 6732
172 Ga0207643_10008552 3300025908 Bacteria 5490
173 Ga0207643_10054199 3300025908 Bacteria 2279
174 Ga0207643_10152752 3300025908 Bacteria 1385
175 Ga0207660_10051361 3300025917 Bacteria 2931
176 Ga0207660_10677584 3300025917 Bacteria 841
177 Ga0207662_10007519 3300025918 Bacteria 5931
178 Ga0207662_10062042 3300025918 Bacteria 2245
179 Ga0207662_10094209 3300025918 Bacteria 1846
180 Ga0207681_10008092 3300025923 Bacteria 6434
181 Ga0207681_10493532 3300025923 Bacteria 1001
182 Ga0207650_10030172 3300025925 Bacteria 3903
183 Ga0207659_10017753 3300025926 Bacteria 4652
184 Ga0207659_10094410 3300025926 Bacteria 2241
185 Ga0207644_10118096 3300025931 Bacteria 2015
186 Ga0207644_10161957 3300025931 Bacteria 1740
187 Ga0207644_10805005 3300025931 Bacteria 786
188 Ga0207690_10215525 3300025932 Bacteria 1466
189 Ga0207706_10006506 3300025933 Bacteria 10841
190 Ga0207706_10031342 3300025933 Bacteria 4737
191 Ga0207686_10035764 3300025934 Bacteria 2984
192 Ga0207709_10522334 3300025935 Bacteria 929
193 Ga0207670_10001964 3300025936 Bacteria 10785
194 Ga0207669_10046898 3300025937 Bacteria 2556
195 Ga0207669_10055483 3300025937 Bacteria 2399
196 Ga0207669_10105107 3300025937 Bacteria 1877
197 Ga0207704_10148019 3300025938 Bacteria 1653
198 Ga0207704_10377641 3300025938 Bacteria 1112
199 Ga0207691_10023121 3300025940 Bacteria 5853
200 Ga0207691_10025604 3300025940 Bacteria 5538
201 Ga0207711_10046402 3300025941 Bacteria 3712
202 Ga0207711_10408519 3300025941 Bacteria 1262
203 Ga0207689_10019841 3300025942 Bacteria 5663
204 Ga0207689_10055543 3300025942 Bacteria 3259
205 Ga0207679_10004681 3300025945 Bacteria 8525
206 Ga0207651_10015140 3300025960 Bacteria 4473
207 Ga0207651_10156827 3300025960 Bacteria 1779
208 Ga0207712_10020356 3300025961 Bacteria 4344
209 Ga0207668_10064074 3300025972 Bacteria 2596
210 Ga0207668_10361795 3300025972 Bacteria 1216
211 Ga0207640_10593130 3300025981 Bacteria 937
212 Ga0207658_10161665 3300025986 Bacteria 1836
213 Ga0207703_10035711 3300026035 Bacteria 3950
214 Ga0207678_10180069 3300026067 Bacteria 1805
215 Ga0207678_10716130 3300026067 Bacteria 881
216 Ga0207708_10041313 3300026075 Bacteria 3516
217 Ga0207708_10089434 3300026075 Bacteria 2373
218 Ga0207641_10028002 3300026088 Bacteria 4654
219 Ga0207641_10040789 3300026088 Bacteria 3888
220 Ga0207641_10365644 3300026088 Bacteria 1378
221 Ga0207648_10007387 3300026089 Bacteria 10816
222 Ga0207648_10168971 3300026089 Bacteria 1933
223 Ga0207676_10002725 3300026095 Bacteria 12574
224 Ga0207674_10005370 3300026116 Bacteria 15244
225 Ga0207675_100000683 3300026118 Bacteria 33381
226 Ga0207675_100018814 3300026118 Bacteria 6445
227 Ga0207675_100312603 3300026118 Bacteria 1532
228 Ga0207675_100735611 3300026118 Bacteria 997
229 Ga0207683_10011665 3300026121 Bacteria 7501
230 Ga0207683_10070626 3300026121 Bacteria 3085
231 Ga0207683_10088588 3300026121 Bacteria 2754
232 Ga0207698_10720066 3300026142 Bacteria 994
233 Ga0207428_10010223 3300027907 Bacteria 8388
234 Ga0207428_10101026 3300027907 Bacteria 2229
235 Ga0207428_10145304 3300027907 Bacteria 1808
236 Ga0268265_10002582 3300028380 Bacteria 13517
237 Ga0268265_10071930 3300028380 Bacteria 2696
238 Ga0268264_10260490 3300028381 Bacteria 1615
239 Ga0307515_10511136 3300028794 Bacteria 811
240 Ga0307511_10000543 3300030521 Bacteria 40443
241 Ga0307513_10011790 3300031456 Bacteria 10835
242 Ga0307513_10017326 3300031456 Bacteria 8640
243 Ga0307513_10282257 3300031456 Bacteria 1437
244 Ga0307408_100073063 3300031548 Bacteria 2540
245 Ga0307408_100089886 3300031548 Bacteria 2316
246 Ga0307408_100108461 3300031548 Bacteria 2128
247 Ga0307408_100536705 3300031548 Bacteria 1030
248 Ga0316576_10235215 3300031727 Bacteria 1377
249 Ga0316578_10307993 3300031728 Bacteria 946
250 Ga0307405_10010449 3300031731 Bacteria 4812
251 Ga0307405_10330639 3300031731 Bacteria 1168
252 Ga0307405_10340268 3300031731 Bacteria 1153
253 Ga0307405_10702683 3300031731 Bacteria 837
254 Ga0307405_10868668 3300031731 Bacteria 761
255 Ga0307413_10004612 3300031824 Bacteria 6022
256 Ga0307413_10102801 3300031824 Bacteria 1893
257 Ga0307410_10046372 3300031852 Bacteria 2899
258 Ga0307406_10045937 3300031901 Bacteria 2745
259 Ga0307406_10537713 3300031901 Bacteria 954
260 Ga0307406_10563077 3300031901 Bacteria 934
261 Ga0307412_10064435 3300031911 Bacteria 2476
262 Ga0307412_10076784 3300031911 Bacteria 2296
263 Ga0307409_100002125 3300031995 Bacteria 10207
264 Ga0307416_100100433 3300032002 Bacteria 2516
265 Ga0307416_100181105 3300032002 Bacteria 1975
266 Ga0307416_100293734 3300032002 Bacteria 1610
267 Ga0307416_100844991 3300032002 Bacteria 1013
268 Ga0307416_101616684 3300032002 Bacteria 753
269 Ga0307414_10163143 3300032004 Bacteria 1773
270 Ga0307411_10000804 3300032005 Bacteria 11713
271 Ga0307411_10016912 3300032005 Bacteria 4139
272 Ga0307411_10347210 3300032005 Bacteria 1208
273 Ga0373942_0017161 3300035207 Bacteria 1783
274 Ga0400487_08378 3300039110 Bacteria 58495
275 Ga0436365_0932342 3300039437 Bacteria 579
276 Ga0436363_0284814 3300039450 Bacteria 5081
277 Ga0451789_1018317 3300041443 Bacteria 570
278 Ga0451807_0901279 3300041486 Bacteria 2744
279 Ga0439431_0146662 3300041997 Bacteria 669
280 Ga0451576_0932618 3300045051 Bacteria 911
281 Ga0495638_0038984 3300046460 Bacteria 3018
282 Ga0495638_0060464 3300046460 Bacteria 2343
283 Ga0495616_0140180 3300046513 Bacteria 1101
284 Ga0495620_0048078 3300046515 Bacteria 1833
285 Ga0495632_0021982 3300046519 Bacteria 3428
286 Ga0495644_0136003 3300046523 Bacteria 938
287 Ga0495597_0230884 3300046542 Bacteria 732
288 Ga0495656_0026742 3300046615 Bacteria 2300
289 Ga0495625_0017762 3300046660 Bacteria 5563
290 Ga0495625_0037516 3300046660 Bacteria 3556
291 Ga0495649_0021390 3300046694 Bacteria 3624
292 Ga0495649_0162377 3300046694 Bacteria 1171
293 Ga0496104_0213191 3300048907 Bacteria 1843
294 Ga0496106_0025691 3300048909 Bacteria 4385
295 Ga0496108_0071420 3300048911 Bacteria 2929
296 Ga0496110_0005170 3300048913 Bacteria 10205
297 Ga0496111_0181700 3300048914 Bacteria 1563
298 Ga0496112_0054000 3300048915 Bacteria 3947
299 Ga0496114_0106471 3300048917 Bacteria 2399
300 Ga0496114_0330646 3300048917 Bacteria 1347
301 Ga0501031_0014032 3300049568 Bacteria 5214
302 Ga0501031_0438721 3300049568 Bacteria 844
303 Ga0501031_0830605 3300049568 Bacteria 592
304 Ga0501032_0171347 3300049569 Bacteria 1423
305 Ga0501033_0202297 3300049570 Bacteria 1418
306 Ga0501034_0048919 3300049571 Bacteria 4267
307 Ga0501036_0037512 3300049572 Bacteria 4099
308 Ga0501037_0012704 3300049573 Bacteria 6202
309 Ga0501038_0067354 3300049574 Bacteria 3046
310 Ga0501039_0018766 3300049575 Bacteria 5308
311 Ga0501039_0217123 3300049575 Bacteria 1504
312 Ga0501040_0351867 3300049576 Bacteria 1055
313 Ga0501041_0209673 3300049577 Bacteria 1222
314 Ga0501041_0662309 3300049577 Bacteria 667
315 Ga0501042_0146767 3300049578 Bacteria 1701
316 Ga0501042_0217307 3300049578 Bacteria 1379
317 Ga0501042_0302208 3300049578 Bacteria 1156
318 Ga0501043_0318863 3300049579 Bacteria 1185
319 Ga0501047_0005287 3300049581 Bacteria 12131
320 Ga0501067_0035476 3300049583 Bacteria 2769
321 Ga0501068_0048395 3300049584 Bacteria 2567
322 Ga0501068_0262002 3300049584 Bacteria 1103
323 Ga0501069_0172411 3300049585 Bacteria 1248
324 Ga0501069_0412038 3300049585 Bacteria 800
325 Ga0501070_0009566 3300049586 Bacteria 8187
326 Ga0501071_0003687 3300049587 Bacteria 9610
327 Ga0501071_0010718 3300049587 Bacteria 6147
328 Ga0501071_0266630 3300049587 Bacteria 1294
329 Ga0501072_0032752 3300049588 Bacteria 4070
330 Ga0501073_0002891 3300049589 Bacteria 12872
331 Ga0501073_0013714 3300049589 Bacteria 5895
332 Ga0501073_0817375 3300049589 Bacteria 642
333 Ga0501074_0004190 3300049590 Bacteria 10303
334 Ga0501074_0053060 3300049590 Bacteria 2926
335 Ga0501075_0016139 3300049591 Bacteria 5375
336 Ga0501076_0007281 3300049592 Bacteria 8051
337 Ga0501076_0203298 3300049592 Bacteria 1618
338 Ga0501076_0882333 3300049592 Bacteria 738
339 Ga0501077_0211581 3300049593 Bacteria 1232
340 Ga0501077_0836869 3300049593 Bacteria 592
341 Ga0501257_052927 3300049686 Bacteria 1015
342 Ga0501079_0108927 3300049741 Bacteria 2151
343 Ga0501079_0626595 3300049741 Bacteria 847
344 Ga0501080_0013164 3300049742 Bacteria 7599
345 Ga0501080_0022417 3300049742 Bacteria 5850
346 Ga0501080_0217704 3300049742 Bacteria 1748
347 Ga0501081_0008773 3300049743 Bacteria 6571
348 Ga0501081_0012767 3300049743 Bacteria 5526
349 Ga0501081_0115887 3300049743 Bacteria 1904
350 Ga0501035_0007252 3300049822 Bacteria 10375
351 Ga0501035_0148365 3300049822 Bacteria 2036
352 Ga0501035_0872413 3300049822 Bacteria 714
353 Ga0501044_0006447 3300049823 Bacteria 12961
354 Ga0501045_0007821 3300049824 Bacteria 7437
355 Ga0501045_0260061 3300049824 Bacteria 1292
356 nmdc:mga05p37_106537_c1 3300050507 Bacteria 3449
357 nmdc:mga05p37_1076774_c1 3300050507 Bacteria 845
358 nmdc:mga05p37_205028_c1 3300050507 Bacteria 2386
359 nmdc:mga05p37_544902_c1 3300050507 Bacteria 1322
360 nmdc:mga05p37_5682_c1 3300050507 Bacteria 14661
361 nmdc:mga09592_5867_c1 3300050508 Bacteria 10023
362 nmdc:mga0qj67_13002_c1 3300050509 Bacteria 6282
363 nmdc:mga0qj67_154482_c1 3300050509 Bacteria 1862
364 nmdc:mga0qj67_3016_c1 3300050509 Bacteria 12101
365 nmdc:mga06r32_2496_c1 3300050510 Bacteria 16463
366 nmdc:mga06r32_37_c1 3300050510 Bacteria 80459
367 nmdc:mga06r32_623148_c1 3300050510 Bacteria 1048
368 nmdc:mga08y16_14600_c1 3300050511 Bacteria 8261
369 nmdc:mga08y16_50988_c1 3300050511 Bacteria 4330
370 nmdc:mga08y16_60553_c1 3300050511 Bacteria 3954
371 nmdc:mga08y16_649702_c1 3300050511 Bacteria 1059
372 nmdc:mga0n895_6578_c1 3300050512 Bacteria 9889
373 nmdc:mga0n895_665696_c1 3300050512 Bacteria 1039
374 nmdc:mga0a205_854_c1 3300050515 Bacteria 24881
375 Ga0500637_0010879 3300053178 Bacteria 4681
376 Ga0501084_0221287 3300054114 Bacteria 1597
377 Ga0501082_0025963 3300060353 Bacteria 5049
378 Ga0501069_0002158
379 MBSR1b_contig_7472051
380 JGI24742J22300_10018492
381 Ga0065707_10087200
382 Ga0070676_10332437
383 Ga0070690_100002107
384 Ga0070690_100174850
385 Ga0070670_100015962
386 Ga0070670_100300132
387 Ga0070677_10006442
388 Ga0070677_10192062
389 Ga0068869_100005500
390 Ga0068869_100432747
391 Ga0068869_101539205
392 Ga0070666_10108461
393 Ga0070680_100205232
394 Ga0070680_100639479
395 Ga0070680_101156374
396 Ga0070682_100053021
397 Ga0068868_100199912
398 Ga0070689_100059376
399 Ga0070689_100272688
400 Ga0070691_10147863
401 Ga0070687_100002248
402 Ga0070687_100077032
403 Ga0070661_100001590
404 Ga0070668_100017108
405 Ga0070668_100622593
406 Ga0070669_100035096
407 Ga0070675_100003567
408 Ga0070675_100014091
409 Ga0070675_100059698
410 Ga0070675_100499659
411 Ga0070671_100145012
412 Ga0070674_100061867
413 Ga0070674_100238158
414 Ga0070674_100343280
415 Ga0070674_100454527
416 Ga0070674_100689518
417 Ga0070673_100003858
418 Ga0070673_100067928
419 Ga0070673_100186231
420 Ga0070688_100007326
421 Ga0070688_100086668
422 Ga0070688_100188027
423 Ga0070659_100187786
424 Ga0070667_100027185
425 Ga0070701_10006492
426 Ga0070701_10049954
427 Ga0070705_100040338
428 Ga0070700_100036658
429 Ga0070700_100097364
430 Ga0070694_100793813
431 Ga0070663_100684832
432 Ga0070678_100035001
433 Ga0070678_100144339
434 Ga0070662_100014306
435 Ga0070662_100077753
436 Ga0068867_100057541
437 Ga0070685_10002190
438 Ga0070685_10099586
439 Ga0070684_100001081
440 Ga0068853_100552521
441 Ga0070672_100017055
442 Ga0070672_100193424
443 Ga0070686_100002681
444 Ga0070695_100654194
445 Ga0070693_100693183
446 Ga0070665_100056768
447 Ga0070665_100238306
448 Ga0070665_100477040
449 Ga0070704_100099774
450 Ga0070664_100004278
451 Ga0070664_100782876
452 Ga0068857_100006531
453 Ga0068857_100075565
454 Ga0070702_100477935
455 Ga0068859_100000702
456 Ga0068859_100398107
457 Ga0068864_100000596
458 Ga0068866_10398641
459 Ga0068861_100000608
460 Ga0068861_100011557
461 Ga0068861_100173304
462 Ga0068870_10001252
463 Ga0068870_10036775
464 Ga0068870_10066000
465 Ga0068870_10624686
466 Ga0068863_100001379
467 Ga0068863_100074904
468 Ga0068858_100052136
469 Ga0068858_100565699
470 Ga0068860_100332130
471 Ga0068862_100024576
472 Ga0068862_101363405
473 Ga0081455_10009435
474 Ga0097621_100028926
475 Ga0097621_100029604
476 Ga0097621_100107984
477 Ga0097621_100149944
478 Ga0068871_100059311
479 Ga0068871_100088671
480 Ga0068871_100132980
481 Ga0075428_100003877
482 Ga0075428_100007584
483 Ga0075428_100017320
484 Ga0075428_100018181
485 Ga0075428_100204026
486 Ga0075430_100006753
487 Ga0075430_100016559
488 Ga0075430_100166569
489 Ga0075431_100000328
490 Ga0075431_100019168
491 Ga0075431_100094931
492 Ga0075431_100771702
493 Ga0075434_100000678
494 Ga0075434_100171475
495 Ga0075429_100007799
496 Ga0075429_100038515
497 Ga0075429_100415740
498 Ga0075429_100425484
499 Ga0068865_100008985
500 Ga0068865_100111072
501 Ga0097620_100000702
502 Ga0097620_100398087
503 Ga0075435_100204945
504 Ga0111539_10003512
505 Ga0111539_10020186
506 Ga0111539_10108266
507 Ga0111539_10296905
508 Ga0111539_10390945
509 Ga0114129_10012746
510 Ga0114129_10050295
511 Ga0114129_10365715
512 Ga0114129_10777175
513 Ga0105243_10855222
514 Ga0105248_10051288
515 Ga0105248_10308341
516 Ga0105249_10016587
517 Ga0105249_10037388
518 Ga0105246_10186517
519 Ga0157371_10206732
520 Ga0157378_10171428
521 Ga0163162_10046968
522 Ga0163162_10128386
523 Ga0157372_10092306
524 Ga0157375_10004588
525 Ga0157375_10694787
526 Ga0157375_11143160
527 Ga0163163_10002427
528 Ga0157380_10007721
529 Ga0157380_10030144
530 Ga0157380_10075579
531 Ga0157380_11083001
532 Ga0157380_11205494
533 Ga0157377_10026547
534 Ga0157379_10179461
535 Ga0157379_10229374
536 Ga0157376_10161724
537 Ga0163161_10238559
538 Ga0163161_10438824
539 Ga0207673_1027799
540 Ga0207682_10006561
541 Ga0207682_10028404
542 Ga0207642_10036398
543 Ga0207642_10066167
544 Ga0207642_10218534
545 Ga0207688_10012729
546 Ga0207680_10015048
547 Ga0207645_10048632
548 Ga0207643_10005567
549 Ga0207643_10008552
550 Ga0207643_10054199
551 Ga0207643_10152752
552 Ga0207660_10051361
553 Ga0207660_10677584
554 Ga0207662_10007519
555 Ga0207662_10062042
556 Ga0207662_10094209
557 Ga0207681_10008092
558 Ga0207681_10493532
559 Ga0207650_10030172
560 Ga0207659_10017753
561 Ga0207659_10094410
562 Ga0207644_10118096
563 Ga0207644_10161957
564 Ga0207644_10805005
565 Ga0207690_10215525
566 Ga0207706_10006506
567 Ga0207706_10031342
568 Ga0207686_10035764
569 Ga0207709_10522334
570 Ga0207670_10001964
571 Ga0207669_10046898
572 Ga0207669_10055483
573 Ga0207669_10105107
574 Ga0207704_10148019
575 Ga0207704_10377641
576 Ga0207691_10023121
577 Ga0207691_10025604
578 Ga0207711_10046402
579 Ga0207711_10408519
580 Ga0207689_10019841
581 Ga0207689_10055543
582 Ga0207679_10004681
583 Ga0207651_10015140
584 Ga0207651_10156827
585 Ga0207712_10020356
586 Ga0207668_10064074
587 Ga0207668_10361795
588 Ga0207640_10593130
589 Ga0207658_10161665
590 Ga0207703_10035711
591 Ga0207678_10180069
592 Ga0207678_10716130
593 Ga0207708_10041313
594 Ga0207708_10089434
595 Ga0207641_10028002
596 Ga0207641_10040789
597 Ga0207641_10365644
598 Ga0207648_10007387
599 Ga0207648_10168971
600 Ga0207676_10002725
601 Ga0207674_10005370
602 Ga0207675_100000683
603 Ga0207675_100018814
604 Ga0207675_100312603
605 Ga0207675_100735611
606 Ga0207683_10011665
607 Ga0207683_10070626
608 Ga0207683_10088588
609 Ga0207698_10720066
610 Ga0207428_10010223
611 Ga0207428_10101026
612 Ga0207428_10145304
613 Ga0268265_10002582
614 Ga0268265_10071930
615 Ga0268264_10260490
616 Ga0307515_10511136
617 Ga0307511_10000543
618 Ga0307513_10011790
619 Ga0307513_10017326
620 Ga0307513_10282257
621 Ga0307408_100073063
622 Ga0307408_100089886
623 Ga0307408_100108461
624 Ga0307408_100536705
625 Ga0316576_10235215
626 Ga0316578_10307993
627 Ga0307405_10010449
628 Ga0307405_10330639
629 Ga0307405_10340268
630 Ga0307405_10702683
631 Ga0307405_10868668
632 Ga0307413_10004612
633 Ga0307413_10102801
634 Ga0307410_10046372
635 Ga0307406_10045937
636 Ga0307406_10537713
637 Ga0307406_10563077
638 Ga0307412_10064435
639 Ga0307412_10076784
640 Ga0307409_100002125
641 Ga0307416_100100433
642 Ga0307416_100181105
643 Ga0307416_100293734
644 Ga0307416_100844991
645 Ga0307416_101616684
646 Ga0307414_10163143
647 Ga0307411_10000804
648 Ga0307411_10016912
649 Ga0307411_10347210
650 Ga0373942_0017161
651 Ga0400487_08378
652 Ga0436365_0932342
653 Ga0436363_0284814
654 Ga0451789_1018317
655 Ga0451807_0901279
656 Ga0439431_0146662
657 Ga0451576_0932618
658 Ga0495638_0038984
659 Ga0495638_0060464
660 Ga0495616_0140180
661 Ga0495620_0048078
662 Ga0495632_0021982
663 Ga0495644_0136003
664 Ga0495597_0230884
665 Ga0495656_0026742
666 Ga0495625_0017762
667 Ga0495625_0037516
668 Ga0495649_0021390
669 Ga0495649_0162377
670 Ga0496104_0213191
671 Ga0496106_0025691
672 Ga0496108_0071420
673 Ga0496110_0005170
674 Ga0496111_0181700
675 Ga0496112_0054000
676 Ga0496114_0106471
677 Ga0496114_0330646
678 Ga0501031_0014032
679 Ga0501031_0438721
680 Ga0501031_0830605
681 Ga0501032_0171347
682 Ga0501033_0202297
683 Ga0501034_0048919
684 Ga0501036_0037512
685 Ga0501037_0012704
686 Ga0501038_0067354
687 Ga0501039_0018766
688 Ga0501039_0217123
689 Ga0501040_0351867
690 Ga0501041_0209673
691 Ga0501041_0662309
692 Ga0501042_0146767
693 Ga0501042_0217307
694 Ga0501042_0302208
695 Ga0501043_0318863
696 Ga0501047_0005287
697 Ga0501067_0035476
698 Ga0501068_0048395
699 Ga0501068_0262002
700 Ga0501069_0172411
701 Ga0501069_0412038
702 Ga0501070_0009566
703 Ga0501071_0003687
704 Ga0501071_0010718
705 Ga0501071_0266630
706 Ga0501072_0032752
707 Ga0501073_0002891
708 Ga0501073_0013714
709 Ga0501073_0817375
710 Ga0501074_0004190
711 Ga0501074_0053060
712 Ga0501075_0016139
713 Ga0501076_0007281
714 Ga0501076_0203298
715 Ga0501076_0882333
716 Ga0501077_0211581
717 Ga0501077_0836869
718 Ga0501257_052927
719 Ga0501079_0108927
720 Ga0501079_0626595
721 Ga0501080_0013164
722 Ga0501080_0022417
723 Ga0501080_0217704
724 Ga0501081_0008773
725 Ga0501081_0012767
726 Ga0501081_0115887
727 Ga0501035_0007252
728 Ga0501035_0148365
729 Ga0501035_0872413
730 Ga0501044_0006447
731 Ga0501045_0007821
732 Ga0501045_0260061
733 nmdc:mga05p37_106537_c1
734 nmdc:mga05p37_1076774_c1
735 nmdc:mga05p37_205028_c1
736 nmdc:mga05p37_544902_c1
737 nmdc:mga05p37_5682_c1
738 nmdc:mga09592_5867_c1
739 nmdc:mga0qj67_13002_c1
740 nmdc:mga0qj67_154482_c1
741 nmdc:mga0qj67_3016_c1
742 nmdc:mga06r32_2496_c1
743 nmdc:mga06r32_37_c1
744 nmdc:mga06r32_623148_c1
745 nmdc:mga08y16_14600_c1
746 nmdc:mga08y16_50988_c1
747 nmdc:mga08y16_60553_c1
748 nmdc:mga08y16_649702_c1
749 nmdc:mga0n895_6578_c1
750 nmdc:mga0n895_665696_c1
751 nmdc:mga0a205_854_c1
752 Ga0500637_0010879
753 Ga0501084_0221287
754 Ga0501082_0025963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

18

208

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9678 3 193
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9532 3 193
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9434 1 195
2pyu-assembly1.cif.gz_A-2 structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp 0.9413 1 194
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9297 1 195
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9762 1 195 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9617 1 195 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9554 2 194 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.927 1 195 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9174 2 194 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A534CFJ8-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9904 44 196 GO:0005829
GO:0009117
GO:0009143
GO:0047429
AF-A4SR93-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9897 2 196 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A6C8GIH7-F1-model_v4 Nucleoside 5-triphosphatase RdgB 0.9888 61 195 GO:0005829
GO:0009117
GO:0009143
GO:0047429
AF-A0A4Q6E102-F1-model_v4 deleted 0.9886 44 195
AF-T0ZHJ5-F1-model_v4 Non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family 0.9881 62 197 GO:0005829
GO:0009143
GO:0047429

Map