F427760

General Info

Members Datasets Scaffolds Average Seq Length
377 220 754 217

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0897653|Ga0436363_0897653_3207_3932
Length 241
Sequence MCSGSIGSWCASQRRKLPRDSSVVLKPAQGERRTLPGPAGSLEALIEAPAAELSGAPAAFGVICHPHPLYGGTLDNKVVWTLARAFQQLGAPTIRFNFRGIGASTGTHDEGRGEVADALAVIAHGRQRWPQAALWLGGFSFGGVVALRAAATAGPACLVTIAPGITKSDVSAVPRPACPWLIVQGEADDVVPAQLVTAWAHRLSPAPELLILPGAGHYFHGRINELRDTLVEFMRRTFPAP

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 2.12
Rhizosphere 90.98
Stem 0
Stem Tuber 0
Unclassified 3.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0897653 3300039450 Bacteria 13404
2 MBSR1b_contig_3086517 2162886012 Bacteria 964
3 JGI25406J46586_10023747 3300003203 Bacteria 2418
4 rootH2_10280612 3300003320 Bacteria 1520
5 rootH1_10100436 3300003323 Bacteria 4854
6 rootH1_10147354 3300003323 Bacteria 3389
7 Ga0065707_10282668 3300005295 Bacteria 1044
8 Ga0070676_10034172 3300005328 Bacteria 2919
9 Ga0070690_100053533 3300005330 Bacteria 2582
10 Ga0070670_100092080 3300005331 Bacteria 2607
11 Ga0070670_100094572 3300005331 Bacteria 2570
12 Ga0070670_100147247 3300005331 Bacteria 2037
13 Ga0070670_100219676 3300005331 Bacteria 1653
14 Ga0070670_100546505 3300005331 Bacteria 1033
15 Ga0070677_10114803 3300005333 Bacteria 1207
16 Ga0068869_100011511 3300005334 Bacteria 5804
17 Ga0068869_100358841 3300005334 Bacteria 1190
18 Ga0070666_10023384 3300005335 Bacteria 4024
19 Ga0070680_100045816 3300005336 Bacteria 3556
20 Ga0070680_100242299 3300005336 Bacteria 1524
21 Ga0070680_100253091 3300005336 Bacteria 1489
22 Ga0070680_100333449 3300005336 Bacteria 1288
23 Ga0070680_100348520 3300005336 Bacteria 1259
24 Ga0068868_100708575 3300005338 Unclassified 901
25 Ga0070689_100020093 3300005340 Bacteria 4951
26 Ga0070691_10178944 3300005341 Bacteria 1103
27 Ga0070687_100030578 3300005343 Bacteria 2633
28 Ga0070661_100059403 3300005344 Bacteria 2804
29 Ga0070668_100021870 3300005347 Bacteria 4832
30 Ga0070668_100137238 3300005347 Bacteria 1968
31 Ga0070669_100004721 3300005353 Bacteria 9825
32 Ga0070669_100182873 3300005353 Bacteria 1641
33 Ga0070673_100005604 3300005364 Bacteria 8051
34 Ga0070673_100920111 3300005364 Bacteria 812
35 Ga0070688_100009862 3300005365 Bacteria 5248
36 Ga0070659_100165492 3300005366 Bacteria 1809
37 Ga0070667_100104745 3300005367 Bacteria 2447
38 Ga0070709_10004031 3300005434 Bacteria 7921
39 Ga0070714_100002614 3300005435 Bacteria 13276
40 Ga0070714_100376890 3300005435 Bacteria 1337
41 Ga0070713_100000785 3300005436 Bacteria 20266
42 Ga0070713_100397907 3300005436 Bacteria 1286
43 Ga0070711_100098235 3300005439 Bacteria 2125
44 Ga0070705_100004345 3300005440 Bacteria 6900
45 Ga0070700_100041713 3300005441 Bacteria 2814
46 Ga0070694_100060859 3300005444 Bacteria 2576
47 Ga0070663_100505373 3300005455 Bacteria 1004
48 Ga0070663_100788402 3300005455 Unclassified 814
49 Ga0070678_100199670 3300005456 Bacteria 1650
50 Ga0070662_100066357 3300005457 Bacteria 2647
51 Ga0070662_100146911 3300005457 Bacteria 1832
52 Ga0070681_10014349 3300005458 Bacteria 7885
53 Ga0070681_10071327 3300005458 Bacteria 3438
54 Ga0070681_10114809 3300005458 Bacteria 2631
55 Ga0070681_10135664 3300005458 Bacteria 2392
56 Ga0070681_10160183 3300005458 Bacteria 2174
57 Ga0070681_10194867 3300005458 Bacteria 1945
58 Ga0068867_100041242 3300005459 Bacteria 3372
59 Ga0068867_100099743 3300005459 Bacteria 2216
60 Ga0068867_100185660 3300005459 Bacteria 1656
61 Ga0070685_10035057 3300005466 Bacteria 2830
62 Ga0070699_100197859 3300005518 Bacteria 1787
63 Ga0070679_100007018 3300005530 Bacteria 10506
64 Ga0070679_100032202 3300005530 Bacteria 5184
65 Ga0070679_100063117 3300005530 Bacteria 3693
66 Ga0070679_100173262 3300005530 Bacteria 2130
67 Ga0070679_100241024 3300005530 Bacteria 1765
68 Ga0070679_100248774 3300005530 Bacteria 1734
69 Ga0070679_100525684 3300005530 Bacteria 1127
70 Ga0070679_100579949 3300005530 Bacteria 1065
71 Ga0070684_100256207 3300005535 Bacteria 1600
72 Ga0070672_100044373 3300005543 Bacteria 3433
73 Ga0070672_100092886 3300005543 Bacteria 2437
74 Ga0070672_100120397 3300005543 Bacteria 2148
75 Ga0070686_100002222 3300005544 Bacteria 10716
76 Ga0070695_100014757 3300005545 Bacteria 4712
77 Ga0070665_100091570 3300005548 Bacteria 3045
78 Ga0070704_100091308 3300005549 Bacteria 2270
79 Ga0070704_100551257 3300005549 Bacteria 1007
80 Ga0068855_100079572 3300005563 Bacteria 3801
81 Ga0068855_100085306 3300005563 Bacteria 3654
82 Ga0068855_100111681 3300005563 Bacteria 3138
83 Ga0070664_100003477 3300005564 Bacteria 12711
84 Ga0070664_100101226 3300005564 Bacteria 2506
85 Ga0068857_100010786 3300005577 Bacteria 7952
86 Ga0068857_100063547 3300005577 Bacteria 3282
87 Ga0068857_100156615 3300005577 Bacteria 2066
88 Ga0068857_100292273 3300005577 Bacteria 1501
89 Ga0068854_100030395 3300005578 Bacteria 3747
90 Ga0068854_100432628 3300005578 Bacteria 1095
91 Ga0068856_100303105 3300005614 Bacteria 1615
92 Ga0070702_100003058 3300005615 Bacteria 7402
93 Ga0068859_100062538 3300005617 Bacteria 3753
94 Ga0068859_100305796 3300005617 Bacteria 1683
95 Ga0068859_100442825 3300005617 Bacteria 1395
96 Ga0068859_101036540 3300005617 Bacteria 901
97 Ga0068864_100007007 3300005618 Bacteria 9248
98 Ga0068861_100005481 3300005719 Bacteria 8600
99 Ga0068861_100022491 3300005719 Bacteria 4544
100 Ga0068861_100422108 3300005719 Bacteria 1188
101 Ga0068870_10098097 3300005840 Bacteria 1650
102 Ga0068860_100378419 3300005843 Bacteria 1397
103 Ga0068862_100004813 3300005844 Bacteria 11366
104 Ga0068862_100064990 3300005844 Bacteria 3142
105 Ga0068862_100171020 3300005844 Bacteria 1945
106 Ga0068862_100187736 3300005844 Bacteria 1858
107 Ga0068862_100278952 3300005844 Bacteria 1531
108 Ga0081455_10001360 3300005937 Bacteria 30237
109 Ga0081539_10000011 3300005985 Bacteria 461887
110 Ga0097621_100101364 3300006237 Bacteria 2423
111 Ga0097621_100510854 3300006237 Bacteria 1089
112 Ga0075428_100009437 3300006844 Bacteria 10829
113 Ga0075428_100017375 3300006844 Bacteria 7950
114 Ga0075428_100027181 3300006844 Bacteria 6335
115 Ga0075428_100463554 3300006844 Bacteria 1357
116 Ga0075430_100010215 3300006846 Bacteria 7950
117 Ga0075430_100068863 3300006846 Bacteria 2969
118 Ga0075431_100004738 3300006847 Bacteria 13373
119 Ga0075431_100014838 3300006847 Bacteria 7888
120 Ga0075431_100067070 3300006847 Bacteria 3705
121 Ga0075431_100160300 3300006847 Bacteria 2313
122 Ga0075431_100740276 3300006847 Bacteria 959
123 Ga0075433_10613557 3300006852 Bacteria 955
124 Ga0075434_100571162 3300006871 Bacteria 1150
125 Ga0075429_100000699 3300006880 Bacteria 26170
126 Ga0075429_100010821 3300006880 Bacteria 7889
127 Ga0075429_100185576 3300006880 Bacteria 1822
128 Ga0068865_100040654 3300006881 Bacteria 3162
129 Ga0068865_100312965 3300006881 Bacteria 1260
130 Ga0068865_100552575 3300006881 Bacteria 967
131 Ga0097620_100062538 3300006931 Bacteria 3753
132 Ga0097620_100305810 3300006931 Bacteria 1683
133 Ga0097620_100442820 3300006931 Bacteria 1395
134 Ga0097620_101036515 3300006931 Bacteria 901
135 Ga0099794_10006522 3300007265 Bacteria 4734
136 Ga0099795_10001328 3300007788 Bacteria 5284
137 Ga0105240_10108121 3300009093 Bacteria 3370
138 Ga0105240_10172487 3300009093 Bacteria 2560
139 Ga0105240_10431235 3300009093 Bacteria 1479
140 Ga0111539_10007057 3300009094 Bacteria 14411
141 Ga0111539_10013424 3300009094 Bacteria 10240
142 Ga0111539_10062929 3300009094 Bacteria 4391
143 Ga0111539_10111233 3300009094 Bacteria 3214
144 Ga0111539_10126854 3300009094 Bacteria 2989
145 Ga0111539_10421621 3300009094 Bacteria 1554
146 Ga0114129_10001637 3300009147 Bacteria 30420
147 Ga0105243_10545149 3300009148 Bacteria 1107
148 Ga0105242_10656605 3300009176 Bacteria 1021
149 Ga0105248_10000870 3300009177 Bacteria 33867
150 Ga0105237_10406337 3300009545 Bacteria 1366
151 Ga0105238_10073350 3300009551 Bacteria 3418
152 Ga0105238_10162302 3300009551 Bacteria 2210
153 Ga0105249_10096300 3300009553 Bacteria 2776
154 Ga0105249_10152016 3300009553 Bacteria 2229
155 Ga0099796_10049381 3300010159 Bacteria 1455
156 Ga0157370_10061538 3300013104 Bacteria 3562
157 Ga0157370_10502583 3300013104 Bacteria 1113
158 Ga0157369_10025532 3300013105 Bacteria 6558
159 Ga0157369_10189821 3300013105 Bacteria 2159
160 Ga0157378_10098790 3300013297 Bacteria 2662
161 Ga0163162_10074745 3300013306 Bacteria 3448
162 Ga0157375_10082669 3300013308 Bacteria 3254
163 Ga0163163_10018961 3300014325 Bacteria 6453
164 Ga0163163_10066266 3300014325 Bacteria 3586
165 Ga0157380_10032629 3300014326 Bacteria 4008
166 Ga0157380_10310797 3300014326 Bacteria 1456
167 Ga0157380_10379603 3300014326 Bacteria 1333
168 Ga0157380_10687922 3300014326 Bacteria 1026
169 Ga0157377_10002082 3300014745 Bacteria 8789
170 Ga0157376_10195548 3300014969 Bacteria 1857
171 Ga0206356_11616701 3300020070 Bacteria 1263
172 Ga0224712_10007734 3300022467 Bacteria 3146
173 Ga0207699_10007338 3300025906 Bacteria 5388
174 Ga0207645_10000594 3300025907 Bacteria 30011
175 Ga0207643_10025715 3300025908 Bacteria 3255
176 Ga0207707_10000441 3300025912 Bacteria 43147
177 Ga0207707_10007227 3300025912 Bacteria 9664
178 Ga0207707_10048057 3300025912 Bacteria 3717
179 Ga0207707_10055815 3300025912 Bacteria 3436
180 Ga0207707_10150188 3300025912 Bacteria 2037
181 Ga0207707_10218270 3300025912 Bacteria 1660
182 Ga0207707_10230905 3300025912 Bacteria 1610
183 Ga0207695_10023207 3300025913 Bacteria 7019
184 Ga0207695_10207258 3300025913 Bacteria 1873
185 Ga0207693_10070612 3300025915 Bacteria 2733
186 Ga0207663_10341648 3300025916 Bacteria 1131
187 Ga0207660_10003900 3300025917 Bacteria 9723
188 Ga0207660_10162701 3300025917 Bacteria 1723
189 Ga0207660_10198222 3300025917 Bacteria 1567
190 Ga0207662_10013548 3300025918 Bacteria 4561
191 Ga0207649_10097402 3300025920 Bacteria 1940
192 Ga0207652_10080883 3300025921 Bacteria 2841
193 Ga0207652_10096803 3300025921 Bacteria 2600
194 Ga0207652_10109612 3300025921 Unclassified 2448
195 Ga0207652_10499385 3300025921 Bacteria 1095
196 Ga0207681_10066916 3300025923 Bacteria 2488
197 Ga0207681_10196326 3300025923 Bacteria 1547
198 Ga0207681_10358200 3300025923 Bacteria 1169
199 Ga0207694_10005968 3300025924 Bacteria 9333
200 Ga0207650_10187497 3300025925 Bacteria 1651
201 Ga0207700_10009407 3300025928 Bacteria 6101
202 Ga0207700_10353112 3300025928 Bacteria 1281
203 Ga0207664_10025090 3300025929 Bacteria 4484
204 Ga0207664_10428312 3300025929 Bacteria 1179
205 Ga0207690_10190208 3300025932 Bacteria 1552
206 Ga0207706_10006292 3300025933 Bacteria 11030
207 Ga0207706_10013037 3300025933 Bacteria 7565
208 Ga0207706_10126921 3300025933 Bacteria 2243
209 Ga0207706_10411324 3300025933 Bacteria 1172
210 Ga0207704_10103934 3300025938 Bacteria 1901
211 Ga0207704_10340704 3300025938 Bacteria 1164
212 Ga0207665_10016607 3300025939 Bacteria 4837
213 Ga0207691_10006318 3300025940 Bacteria 11440
214 Ga0207691_10033905 3300025940 Bacteria 4752
215 Ga0207691_10488641 3300025940 Unclassified 1046
216 Ga0207711_10068859 3300025941 Bacteria 3066
217 Ga0207689_10003302 3300025942 Bacteria 14765
218 Ga0207689_10065571 3300025942 Bacteria 2987
219 Ga0207689_10138300 3300025942 Bacteria 2006
220 Ga0207679_10018399 3300025945 Bacteria 4680
221 Ga0207667_10011339 3300025949 Bacteria 10365
222 Ga0207667_10078088 3300025949 Bacteria 3432
223 Ga0207651_10279845 3300025960 Bacteria 1378
224 Ga0207651_10315348 3300025960 Bacteria 1305
225 Ga0207712_10066300 3300025961 Bacteria 2580
226 Ga0207668_10753257 3300025972 Bacteria 859
227 Ga0207658_10766586 3300025986 Unclassified 874
228 Ga0207703_10986315 3300026035 Unclassified 808
229 Ga0207708_10037985 3300026075 Bacteria 3668
230 Ga0207702_10361458 3300026078 Bacteria 1391
231 Ga0207648_10001676 3300026089 Bacteria 24261
232 Ga0207648_10013135 3300026089 Bacteria 7718
233 Ga0207648_10283130 3300026089 Bacteria 1483
234 Ga0207648_10611647 3300026089 Bacteria 1005
235 Ga0207674_10010520 3300026116 Bacteria 10472
236 Ga0207674_10027597 3300026116 Bacteria 6003
237 Ga0207674_10148021 3300026116 Bacteria 2306
238 Ga0207675_100001477 3300026118 Bacteria 23607
239 Ga0207675_100037552 3300026118 Bacteria 4518
240 Ga0207675_100117906 3300026118 Bacteria 2510
241 Ga0207683_10026982 3300026121 Bacteria 4963
242 Ga0209970_1013868 3300027614 Bacteria 1338
243 Ga0209998_10001697 3300027717 Bacteria 5259
244 Ga0207428_10003041 3300027907 Bacteria 16508
245 Ga0207428_10018460 3300027907 Bacteria 5957
246 Ga0207428_10019483 3300027907 Bacteria 5784
247 Ga0268266_10058049 3300028379 Bacteria 3332
248 Ga0268266_10359351 3300028379 Bacteria 1370
249 Ga0268265_10001962 3300028380 Bacteria 16315
250 Ga0268265_10139364 3300028380 Bacteria 2028
251 Ga0268265_10317891 3300028380 Bacteria 1409
252 Ga0268265_10442065 3300028380 Bacteria 1212
253 Ga0307515_10093224 3300028794 Bacteria 3737
254 Ga0307515_10122767 3300028794 Bacteria 2926
255 Ga0307515_10201795 3300028794 Bacteria 1862
256 Ga0307509_10024847 3300031507 Bacteria 6703
257 Ga0307408_100013062 3300031548 Bacteria 5510
258 Ga0307408_100066542 3300031548 Bacteria 2647
259 Ga0307408_100142746 3300031548 Bacteria 1881
260 Ga0307408_100215787 3300031548 Bacteria 1562
261 Ga0316576_10000657 3300031727 Bacteria 16768
262 Ga0316576_10005571 3300031727 Bacteria 7715
263 Ga0316576_10542827 3300031727 Unclassified 852
264 Ga0316578_10001912 3300031728 Bacteria 8806
265 Ga0307516_10406749 3300031730 Unclassified 1020
266 Ga0316577_10002581 3300031733 Bacteria 8996
267 Ga0307410_10239319 3300031852 Bacteria 1406
268 Ga0307406_10264424 3300031901 Bacteria 1303
269 Ga0307412_10218920 3300031911 Bacteria 1458
270 Ga0307412_10469907 3300031911 Bacteria 1040
271 Ga0307409_101289151 3300031995 Unclassified 755
272 Ga0307416_100034744 3300032002 Bacteria 3841
273 Ga0307411_10027538 3300032005 Bacteria 3441
274 Ga0307411_10098141 3300032005 Bacteria 2064
275 Ga0307411_10197944 3300032005 Bacteria 1540
276 Ga0316580_10003884 3300032139 Bacteria 4290
277 Ga0373923_0186642 3300035111 Bacteria 954
278 Ga0373955_0157568 3300035172 Bacteria 1338
279 Ga0316574_0000459 3300035398 Bacteria 16421
280 Ga0316574_0004170 3300035398 Bacteria 7533
281 Ga0316574_0048741 3300035398 Bacteria 2632
282 Ga0316574_0092826 3300035398 Bacteria 1927
283 Ga0373937_0005628 3300036401 Bacteria 10759
284 Ga0373937_0052625 3300036401 Bacteria 3734
285 Ga0316582_0043601 3300036647 Bacteria 2815
286 Ga0395898_0004561 3300037466 Bacteria 15117
287 Ga0395898_0442976 3300037466 Bacteria 1237
288 Ga0395898_0775907 3300037466 Bacteria 899
289 Ga0436365_0930532 3300039437 Bacteria 1180
290 Ga0436365_1238297 3300039437 Bacteria 5296
291 Ga0436360_0112539 3300039438 Unclassified 753
292 Ga0436360_0726516 3300039438 Bacteria 2293
293 Ga0436361_0321811 3300039447 Bacteria 2383
294 Ga0451793_1339490 3300041452 Bacteria 944
295 Ga0439448_0110381 3300042005 Bacteria 939
296 Ga0450920_049558 3300042122 Bacteria 842
297 Ga0450923_008285 3300042125 Bacteria 1785
298 Ga0439459_0039760 3300042438 Bacteria 995
299 Ga0466969_0001869 3300044656 Bacteria 11261
300 Ga0466966_0003811 3300044684 Bacteria 9951
301 Ga0466966_0213719 3300044684 Bacteria 1165
302 Ga0466961_0027035 3300044693 Bacteria 3688
303 Ga0466963_0173643 3300044694 Bacteria 1503
304 Ga0466964_0001657 3300044706 Bacteria 7696
305 Ga0466971_0001237 3300044719 Bacteria 10623
306 Ga0466968_0329624 3300044735 Bacteria 739
307 Ga0466970_0000381 3300044765 Bacteria 21528
308 Ga0466959_0009351 3300045049 Bacteria 6966
309 Ga0466959_0014297 3300045049 Bacteria 5761
310 Ga0466958_0257274 3300045836 Bacteria 1117
311 Ga0495603_0060600 3300046455 Bacteria 2236
312 Ga0495629_0291597 3300046459 Bacteria 1118
313 Ga0495638_0010352 3300046460 Bacteria 6486
314 Ga0495650_0005119 3300046471 Bacteria 8660
315 Ga0495580_0034806 3300046472 Bacteria 3624
316 Ga0495580_0059519 3300046472 Bacteria 2684
317 Ga0495618_0314007 3300046514 Bacteria 972
318 Ga0495644_0006171 3300046523 Bacteria 4660
319 Ga0495663_0076429 3300046525 Bacteria 1073
320 Ga0495666_0296044 3300046526 Bacteria 732
321 Ga0495586_0029994 3300046535 Bacteria 2912
322 Ga0495587_0141990 3300046536 Bacteria 1370
323 Ga0495621_0000570 3300046539 Bacteria 9180
324 Ga0495625_0251979 3300046660 Bacteria 1146
325 Ga0495647_0000261 3300046681 Bacteria 14540
326 Ga0495658_0051806 3300046683 Bacteria 2326
327 Ga0495658_0153103 3300046683 Bacteria 1417
328 Ga0495671_0137040 3300046692 Bacteria 1193
329 Ga0495600_0343277 3300046809 Bacteria 936
330 Ga0495660_0209394 3300046810 Bacteria 926
331 Ga0495602_0084656 3300048088 Bacteria 2652
332 Ga0496102_0158774 3300048905 Bacteria 2126
333 Ga0496103_0379696 3300048906 Bacteria 908
334 Ga0496109_0022267 3300048912 Bacteria 5613
335 Ga0496111_0693690 3300048914 Unclassified 741
336 Ga0496112_0119902 3300048915 Bacteria 2601
337 Ga0496113_0114277 3300048916 Bacteria 2105
338 Ga0496113_0136603 3300048916 Unclassified 1927
339 Ga0496116_0000019 3300048919 Bacteria 533227
340 Ga0496118_0017727 3300048921 Bacteria 6464
341 Ga0496121_0000018 3300048924 Bacteria 542045
342 Ga0501072_0086741 3300049588 Bacteria 2484
343 Ga0501075_0170675 3300049591 Bacteria 1660
344 nmdc:mga05p37_4265_c1 3300050507 Bacteria 16707
345 nmdc:mga09592_27296_c1 3300050508 Bacteria 4737
346 nmdc:mga09592_393_c1 3300050508 Bacteria 32017
347 nmdc:mga0qj67_35949_c1 3300050509 Bacteria 3874
348 nmdc:mga0qj67_42444_c1 3300050509 Bacteria 3580
349 nmdc:mga0qj67_9915_c1 3300050509 Bacteria 7104
350 nmdc:mga06r32_15532_c1 3300050510 Bacteria 6915
351 nmdc:mga06r32_191910_c1 3300050510 Bacteria 2030
352 nmdc:mga06r32_441084_c1 3300050510 Bacteria 1282
353 nmdc:mga06r32_498753_c1 3300050510 Bacteria 1194
354 nmdc:mga06r32_6228_c1 3300050510 Bacteria 10710
355 nmdc:mga06r32_701_c1 3300050510 Bacteria 29233
356 nmdc:mga08y16_2141_c1 3300050511 Bacteria 20252
357 nmdc:mga08y16_47949_c2 3300050511 Bacteria 3462
358 nmdc:mga08y16_7121_c1 3300050511 Bacteria 11737
359 nmdc:mga08y16_825328_c1 3300050511 Unclassified 918
360 nmdc:mga08y16_99990_c1 3300050511 Bacteria 3020
361 nmdc:mga0n895_816514_c1 3300050512 Bacteria 922
362 nmdc:mga0a205_180648_c1 3300050515 Bacteria 2004
363 Ga0500644_0205128 3300053088 Bacteria 817
364 Ga0500583_0257963 3300053092 Bacteria 859
365 Ga0500641_0162240 3300053096 Bacteria 964
366 Ga0500556_0000128 3300053104 Bacteria 65099
367 Ga0500556_0056899 3300053104 Bacteria 1430
368 Ga0500617_026127 3300053124 Bacteria 2596
369 Ga0500642_0031247 3300053130 Bacteria 2223
370 Ga0500658_0007105 3300053134 Bacteria 4140
371 Ga0500588_0002033 3300053146 Bacteria 4020
372 Ga0500616_0000182 3300053153 Bacteria 103375
373 Ga0500616_0099288 3300053153 Bacteria 1426
374 Ga0500627_0088471 3300053158 Bacteria 1385
375 Ga0590071_022652 3300059421 Bacteria 1483
376 Ga0590077_059442 3300059426 Unclassified 866
377 Ga0466962_0000405 3300061719 Bacteria 18653
378 Ga0436363_0897653
379 MBSR1b_contig_3086517
380 JGI25406J46586_10023747
381 rootH2_10280612
382 rootH1_10100436
383 rootH1_10147354
384 Ga0065707_10282668
385 Ga0070676_10034172
386 Ga0070690_100053533
387 Ga0070670_100092080
388 Ga0070670_100094572
389 Ga0070670_100147247
390 Ga0070670_100219676
391 Ga0070670_100546505
392 Ga0070677_10114803
393 Ga0068869_100011511
394 Ga0068869_100358841
395 Ga0070666_10023384
396 Ga0070680_100045816
397 Ga0070680_100242299
398 Ga0070680_100253091
399 Ga0070680_100333449
400 Ga0070680_100348520
401 Ga0068868_100708575
402 Ga0070689_100020093
403 Ga0070691_10178944
404 Ga0070687_100030578
405 Ga0070661_100059403
406 Ga0070668_100021870
407 Ga0070668_100137238
408 Ga0070669_100004721
409 Ga0070669_100182873
410 Ga0070673_100005604
411 Ga0070673_100920111
412 Ga0070688_100009862
413 Ga0070659_100165492
414 Ga0070667_100104745
415 Ga0070709_10004031
416 Ga0070714_100002614
417 Ga0070714_100376890
418 Ga0070713_100000785
419 Ga0070713_100397907
420 Ga0070711_100098235
421 Ga0070705_100004345
422 Ga0070700_100041713
423 Ga0070694_100060859
424 Ga0070663_100505373
425 Ga0070663_100788402
426 Ga0070678_100199670
427 Ga0070662_100066357
428 Ga0070662_100146911
429 Ga0070681_10014349
430 Ga0070681_10071327
431 Ga0070681_10114809
432 Ga0070681_10135664
433 Ga0070681_10160183
434 Ga0070681_10194867
435 Ga0068867_100041242
436 Ga0068867_100099743
437 Ga0068867_100185660
438 Ga0070685_10035057
439 Ga0070699_100197859
440 Ga0070679_100007018
441 Ga0070679_100032202
442 Ga0070679_100063117
443 Ga0070679_100173262
444 Ga0070679_100241024
445 Ga0070679_100248774
446 Ga0070679_100525684
447 Ga0070679_100579949
448 Ga0070684_100256207
449 Ga0070672_100044373
450 Ga0070672_100092886
451 Ga0070672_100120397
452 Ga0070686_100002222
453 Ga0070695_100014757
454 Ga0070665_100091570
455 Ga0070704_100091308
456 Ga0070704_100551257
457 Ga0068855_100079572
458 Ga0068855_100085306
459 Ga0068855_100111681
460 Ga0070664_100003477
461 Ga0070664_100101226
462 Ga0068857_100010786
463 Ga0068857_100063547
464 Ga0068857_100156615
465 Ga0068857_100292273
466 Ga0068854_100030395
467 Ga0068854_100432628
468 Ga0068856_100303105
469 Ga0070702_100003058
470 Ga0068859_100062538
471 Ga0068859_100305796
472 Ga0068859_100442825
473 Ga0068859_101036540
474 Ga0068864_100007007
475 Ga0068861_100005481
476 Ga0068861_100022491
477 Ga0068861_100422108
478 Ga0068870_10098097
479 Ga0068860_100378419
480 Ga0068862_100004813
481 Ga0068862_100064990
482 Ga0068862_100171020
483 Ga0068862_100187736
484 Ga0068862_100278952
485 Ga0081455_10001360
486 Ga0081539_10000011
487 Ga0097621_100101364
488 Ga0097621_100510854
489 Ga0075428_100009437
490 Ga0075428_100017375
491 Ga0075428_100027181
492 Ga0075428_100463554
493 Ga0075430_100010215
494 Ga0075430_100068863
495 Ga0075431_100004738
496 Ga0075431_100014838
497 Ga0075431_100067070
498 Ga0075431_100160300
499 Ga0075431_100740276
500 Ga0075433_10613557
501 Ga0075434_100571162
502 Ga0075429_100000699
503 Ga0075429_100010821
504 Ga0075429_100185576
505 Ga0068865_100040654
506 Ga0068865_100312965
507 Ga0068865_100552575
508 Ga0097620_100062538
509 Ga0097620_100305810
510 Ga0097620_100442820
511 Ga0097620_101036515
512 Ga0099794_10006522
513 Ga0099795_10001328
514 Ga0105240_10108121
515 Ga0105240_10172487
516 Ga0105240_10431235
517 Ga0111539_10007057
518 Ga0111539_10013424
519 Ga0111539_10062929
520 Ga0111539_10111233
521 Ga0111539_10126854
522 Ga0111539_10421621
523 Ga0114129_10001637
524 Ga0105243_10545149
525 Ga0105242_10656605
526 Ga0105248_10000870
527 Ga0105237_10406337
528 Ga0105238_10073350
529 Ga0105238_10162302
530 Ga0105249_10096300
531 Ga0105249_10152016
532 Ga0099796_10049381
533 Ga0157370_10061538
534 Ga0157370_10502583
535 Ga0157369_10025532
536 Ga0157369_10189821
537 Ga0157378_10098790
538 Ga0163162_10074745
539 Ga0157375_10082669
540 Ga0163163_10018961
541 Ga0163163_10066266
542 Ga0157380_10032629
543 Ga0157380_10310797
544 Ga0157380_10379603
545 Ga0157380_10687922
546 Ga0157377_10002082
547 Ga0157376_10195548
548 Ga0206356_11616701
549 Ga0224712_10007734
550 Ga0207699_10007338
551 Ga0207645_10000594
552 Ga0207643_10025715
553 Ga0207707_10000441
554 Ga0207707_10007227
555 Ga0207707_10048057
556 Ga0207707_10055815
557 Ga0207707_10150188
558 Ga0207707_10218270
559 Ga0207707_10230905
560 Ga0207695_10023207
561 Ga0207695_10207258
562 Ga0207693_10070612
563 Ga0207663_10341648
564 Ga0207660_10003900
565 Ga0207660_10162701
566 Ga0207660_10198222
567 Ga0207662_10013548
568 Ga0207649_10097402
569 Ga0207652_10080883
570 Ga0207652_10096803
571 Ga0207652_10109612
572 Ga0207652_10499385
573 Ga0207681_10066916
574 Ga0207681_10196326
575 Ga0207681_10358200
576 Ga0207694_10005968
577 Ga0207650_10187497
578 Ga0207700_10009407
579 Ga0207700_10353112
580 Ga0207664_10025090
581 Ga0207664_10428312
582 Ga0207690_10190208
583 Ga0207706_10006292
584 Ga0207706_10013037
585 Ga0207706_10126921
586 Ga0207706_10411324
587 Ga0207704_10103934
588 Ga0207704_10340704
589 Ga0207665_10016607
590 Ga0207691_10006318
591 Ga0207691_10033905
592 Ga0207691_10488641
593 Ga0207711_10068859
594 Ga0207689_10003302
595 Ga0207689_10065571
596 Ga0207689_10138300
597 Ga0207679_10018399
598 Ga0207667_10011339
599 Ga0207667_10078088
600 Ga0207651_10279845
601 Ga0207651_10315348
602 Ga0207712_10066300
603 Ga0207668_10753257
604 Ga0207658_10766586
605 Ga0207703_10986315
606 Ga0207708_10037985
607 Ga0207702_10361458
608 Ga0207648_10001676
609 Ga0207648_10013135
610 Ga0207648_10283130
611 Ga0207648_10611647
612 Ga0207674_10010520
613 Ga0207674_10027597
614 Ga0207674_10148021
615 Ga0207675_100001477
616 Ga0207675_100037552
617 Ga0207675_100117906
618 Ga0207683_10026982
619 Ga0209970_1013868
620 Ga0209998_10001697
621 Ga0207428_10003041
622 Ga0207428_10018460
623 Ga0207428_10019483
624 Ga0268266_10058049
625 Ga0268266_10359351
626 Ga0268265_10001962
627 Ga0268265_10139364
628 Ga0268265_10317891
629 Ga0268265_10442065
630 Ga0307515_10093224
631 Ga0307515_10122767
632 Ga0307515_10201795
633 Ga0307509_10024847
634 Ga0307408_100013062
635 Ga0307408_100066542
636 Ga0307408_100142746
637 Ga0307408_100215787
638 Ga0316576_10000657
639 Ga0316576_10005571
640 Ga0316576_10542827
641 Ga0316578_10001912
642 Ga0307516_10406749
643 Ga0316577_10002581
644 Ga0307410_10239319
645 Ga0307406_10264424
646 Ga0307412_10218920
647 Ga0307412_10469907
648 Ga0307409_101289151
649 Ga0307416_100034744
650 Ga0307411_10027538
651 Ga0307411_10098141
652 Ga0307411_10197944
653 Ga0316580_10003884
654 Ga0373923_0186642
655 Ga0373955_0157568
656 Ga0316574_0000459
657 Ga0316574_0004170
658 Ga0316574_0048741
659 Ga0316574_0092826
660 Ga0373937_0005628
661 Ga0373937_0052625
662 Ga0316582_0043601
663 Ga0395898_0004561
664 Ga0395898_0442976
665 Ga0395898_0775907
666 Ga0436365_0930532
667 Ga0436365_1238297
668 Ga0436360_0112539
669 Ga0436360_0726516
670 Ga0436361_0321811
671 Ga0451793_1339490
672 Ga0439448_0110381
673 Ga0450920_049558
674 Ga0450923_008285
675 Ga0439459_0039760
676 Ga0466969_0001869
677 Ga0466966_0003811
678 Ga0466966_0213719
679 Ga0466961_0027035
680 Ga0466963_0173643
681 Ga0466964_0001657
682 Ga0466971_0001237
683 Ga0466968_0329624
684 Ga0466970_0000381
685 Ga0466959_0009351
686 Ga0466959_0014297
687 Ga0466958_0257274
688 Ga0495603_0060600
689 Ga0495629_0291597
690 Ga0495638_0010352
691 Ga0495650_0005119
692 Ga0495580_0034806
693 Ga0495580_0059519
694 Ga0495618_0314007
695 Ga0495644_0006171
696 Ga0495663_0076429
697 Ga0495666_0296044
698 Ga0495586_0029994
699 Ga0495587_0141990
700 Ga0495621_0000570
701 Ga0495625_0251979
702 Ga0495647_0000261
703 Ga0495658_0051806
704 Ga0495658_0153103
705 Ga0495671_0137040
706 Ga0495600_0343277
707 Ga0495660_0209394
708 Ga0495602_0084656
709 Ga0496102_0158774
710 Ga0496103_0379696
711 Ga0496109_0022267
712 Ga0496111_0693690
713 Ga0496112_0119902
714 Ga0496113_0114277
715 Ga0496113_0136603
716 Ga0496116_0000019
717 Ga0496118_0017727
718 Ga0496121_0000018
719 Ga0501072_0086741
720 Ga0501075_0170675
721 nmdc:mga05p37_4265_c1
722 nmdc:mga09592_27296_c1
723 nmdc:mga09592_393_c1
724 nmdc:mga0qj67_35949_c1
725 nmdc:mga0qj67_42444_c1
726 nmdc:mga0qj67_9915_c1
727 nmdc:mga06r32_15532_c1
728 nmdc:mga06r32_191910_c1
729 nmdc:mga06r32_441084_c1
730 nmdc:mga06r32_498753_c1
731 nmdc:mga06r32_6228_c1
732 nmdc:mga06r32_701_c1
733 nmdc:mga08y16_2141_c1
734 nmdc:mga08y16_47949_c2
735 nmdc:mga08y16_7121_c1
736 nmdc:mga08y16_825328_c1
737 nmdc:mga08y16_99990_c1
738 nmdc:mga0n895_816514_c1
739 nmdc:mga0a205_180648_c1
740 Ga0500644_0205128
741 Ga0500583_0257963
742 Ga0500641_0162240
743 Ga0500556_0000128
744 Ga0500556_0056899
745 Ga0500617_026127
746 Ga0500642_0031247
747 Ga0500658_0007105
748 Ga0500588_0002033
749 Ga0500616_0000182
750 Ga0500616_0099288
751 Ga0500627_0088471
752 Ga0590071_022652
753 Ga0590077_059442
754 Ga0466962_0000405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

71

178

0.9

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

62

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.955 9 213
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.9351 11 209
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.9225 11 218
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8916 11 209
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.8633 13 217
ID Description Score Start End Superfamily
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.955 9 213 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9351 11 209 3.40.50.1820
2i3dA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9091 11 218 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8916 11 209 3.40.50.1820
2i3dA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8846 11 218 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A841HNB1-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9775 1 214
AF-A0A7Y2N5N7-F1-model_v4 Alpha/beta fold hydrolase 0.9725 6 213 GO:0016787
AF-A0A3B1A9H5-F1-model_v4 Alpha/beta hydrolase 0.9694 11 210 GO:0016787
AF-A0A841HNB1-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9685 1 214
AF-T1BRS0-F1-model_v4 Alpha/beta hydrolase family protein 0.9643 112 213

Map