F427717

General Info

Members Datasets Scaffolds Average Seq Length
377 250 754 297

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10225401|Ga0207670_102254011
Length 330
Sequence MIDRLPATPERGPLGSVGDILVGTASWTDKTLLESGWYPASADTPQARLEFYAGQFPLVEVDSTYYAPPSERTTALWAQRTPPGFTFNIKAFSLLTGHPTKPSALPKDLRPEEAGKNLYPKDLPAQAYEDVWSRFLSALDPLVETGKLGVILFQFPPWFTIRRSNKQYVQEVAKRCSPLRVAVEFRHESWFDGEDNTEETLEFLRRNNLPYVAVDMPQGHKSSIPPVLAATADLAVVRFHGHSEKWTSKDIYEKFGYRYSTKELEGWAPKLLDLASQASQVNVLMNNCYSDYAQRNAASTCPTVAAAAPIRPPIPAPAMRSGSSPTTAPM

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
210 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
211 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
212 2501939600 Micromonospora sp. L5 Isolate Unclassified
213 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
214 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
215 2619618881 Frankia sp. ACN1ag Isolate Unclassified
216 2619619003 Frankia sp. CpI1-P Isolate Nodule
217 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
218 2626541554 Frankia sp. AvcI.1 Isolate Nodule
219 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
220 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
221 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
222 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
223 2855683550 Micromonospora sp. RP3T Isolate Unclassified
224 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
225 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
226 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
227 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
228 2858868258 Micromonospora sp. MH33 Isolate Unclassified
229 2858882152 Micromonospora noduli MED15 Isolate Nodule
230 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
231 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
232 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
233 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
234 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
235 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
236 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
237 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
238 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
239 2891562705 Microbispora tritici MT50 Isolate Unclassified
240 2902582711 Micromonospora sp. AP08 Isolate Unclassified
241 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
242 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
243 649633069 Micromonospora sp. L5 Isolate Unclassified
244 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
245 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
246 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
247 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
248 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
249 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
250 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.27
Metatranscriptomes 2.39
Isolates 10.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 2.12
Rhizoplane 6.63
Rhizosphere 79.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10225401 3300025936 Bacteria 1437
2 JGI24741J21665_1015743 3300001915 Bacteria 1245
3 JGI24737J22298_10068814 3300001990 Bacteria 1058
4 JGI24751J29686_10023042 3300002459 Bacteria 1291
5 JGI25406J46586_10002462 3300003203 Bacteria 8752
6 JGI25406J46586_10015586 3300003203 Bacteria 3201
7 JGI25406J46586_10025823 3300003203 Bacteria 2273
8 rootH1_10029623 3300003316 Bacteria 4665
9 Ga0070658_10027427 3300005327 Bacteria 4570
10 Ga0070676_10160461 3300005328 Bacteria 1447
11 Ga0070683_100002574 3300005329 Bacteria 14500
12 Ga0070670_100088587 3300005331 Bacteria 2660
13 Ga0068869_100004370 3300005334 Bacteria 8777
14 Ga0068869_100009096 3300005334 Bacteria 6436
15 Ga0070666_10168078 3300005335 Bacteria 1535
16 Ga0070680_100022235 3300005336 Bacteria 5047
17 Ga0070680_100032732 3300005336 Bacteria 4185
18 Ga0070682_100039619 3300005337 Bacteria 2896
19 Ga0068868_100143751 3300005338 Bacteria 1960
20 Ga0070660_100171853 3300005339 Bacteria 1750
21 Ga0070691_10010608 3300005341 Bacteria 4208
22 Ga0070661_100005677 3300005344 Bacteria 8594
23 Ga0070661_100028707 3300005344 Bacteria 4014
24 Ga0070661_100053544 3300005344 Bacteria 2954
25 Ga0070661_100261158 3300005344 Bacteria 1339
26 Ga0070692_10070841 3300005345 Bacteria 1857
27 Ga0070692_10089512 3300005345 Bacteria 1670
28 Ga0070668_100001879 3300005347 Bacteria 15351
29 Ga0070669_100104201 3300005353 Bacteria 2144
30 Ga0070675_100002025 3300005354 Bacteria 15037
31 Ga0070675_100013424 3300005354 Bacteria 6438
32 Ga0070671_100003873 3300005355 Bacteria 11765
33 Ga0070673_100248465 3300005364 Bacteria 1550
34 Ga0070659_100299574 3300005366 Bacteria 1340
35 Ga0070667_100283103 3300005367 Bacteria 1489
36 Ga0070709_10012586 3300005434 Bacteria 4738
37 Ga0070714_100048987 3300005435 Bacteria 3596
38 Ga0070713_100013780 3300005436 Bacteria 5981
39 Ga0070713_100059392 3300005436 Bacteria 3194
40 Ga0070710_10011804 3300005437 Bacteria 4327
41 Ga0070701_10054579 3300005438 Bacteria 2084
42 Ga0070711_100064662 3300005439 Bacteria 2556
43 Ga0070663_100015311 3300005455 Bacteria 4947
44 Ga0070678_100055471 3300005456 Bacteria 2893
45 Ga0070678_100060750 3300005456 Bacteria 2783
46 Ga0070681_10058425 3300005458 Bacteria 3836
47 Ga0070685_10080370 3300005466 Bacteria 1953
48 Ga0070706_100297858 3300005467 Bacteria 1505
49 Ga0070679_100013135 3300005530 Bacteria 7928
50 Ga0070679_100082848 3300005530 Bacteria 3197
51 Ga0070684_100003717 3300005535 Bacteria 11511
52 Ga0070684_100005426 3300005535 Bacteria 9767
53 Ga0070684_100132492 3300005535 Bacteria 2249
54 Ga0068853_100154846 3300005539 Bacteria 2065
55 Ga0070693_100016004 3300005547 Bacteria 3874
56 Ga0070693_100071498 3300005547 Bacteria 2045
57 Ga0070665_100028356 3300005548 Bacteria 5640
58 Ga0068855_100807174 3300005563 Bacteria 997
59 Ga0070664_100013195 3300005564 Bacteria 6727
60 Ga0070664_100056281 3300005564 Bacteria 3342
61 Ga0070664_100134691 3300005564 Bacteria 2171
62 Ga0070664_100156915 3300005564 Bacteria 2011
63 Ga0068857_100054518 3300005577 Bacteria 3548
64 Ga0068857_100069355 3300005577 Bacteria 3140
65 Ga0068854_100315697 3300005578 Bacteria 1269
66 Ga0068856_100032532 3300005614 Bacteria 5106
67 Ga0070702_100021420 3300005615 Bacteria 3401
68 Ga0070702_100022554 3300005615 Bacteria 3331
69 Ga0068859_100009167 3300005617 Bacteria 9995
70 Ga0068859_100107115 3300005617 Bacteria 2855
71 Ga0068864_100018767 3300005618 Bacteria 5780
72 Ga0068864_100350067 3300005618 Bacteria 1393
73 Ga0068864_100401349 3300005618 Bacteria 1303
74 Ga0068864_100654730 3300005618 Bacteria 1023
75 Ga0068861_100102553 3300005719 Bacteria 2278
76 Ga0068851_10013796 3300005834 Bacteria 3826
77 Ga0068870_10000450 3300005840 Bacteria 15558
78 Ga0068863_100022628 3300005841 Bacteria 6002
79 Ga0068863_100026592 3300005841 Bacteria 5518
80 Ga0068863_100319535 3300005841 Bacteria 1508
81 Ga0068858_100002543 3300005842 Bacteria 18390
82 Ga0068858_100076210 3300005842 Bacteria 3115
83 Ga0068860_100039879 3300005843 Bacteria 4490
84 Ga0081455_10000721 3300005937 Bacteria 42889
85 Ga0081538_10047016 3300005981 Bacteria 2652
86 Ga0081540_1004205 3300005983 Bacteria 11062
87 Ga0081540_1063839 3300005983 Bacteria 1741
88 Ga0081540_1104681 3300005983 Bacteria 1210
89 Ga0081539_10000135 3300005985 Bacteria 172789
90 Ga0081539_10001164 3300005985 Bacteria 47583
91 Ga0081539_10003347 3300005985 Bacteria 19904
92 Ga0081539_10005868 3300005985 Bacteria 12167
93 Ga0070717_10349357 3300006028 Bacteria 1322
94 Ga0075432_10023094 3300006058 Bacteria 2130
95 Ga0075367_10216944 3300006178 Bacteria 1197
96 Ga0097621_100225396 3300006237 Bacteria 1635
97 Ga0068871_100077201 3300006358 Bacteria 2752
98 Ga0075428_100000147 3300006844 Bacteria 63737
99 Ga0075428_100000533 3300006844 Bacteria 38803
100 Ga0075428_100035578 3300006844 Bacteria 5489
101 Ga0075428_100145906 3300006844 Bacteria 2572
102 Ga0075428_100148479 3300006844 Bacteria 2547
103 Ga0075430_100005714 3300006846 Bacteria 10492
104 Ga0075430_100010909 3300006846 Bacteria 7697
105 Ga0075430_100092667 3300006846 Bacteria 2526
106 Ga0075431_100010340 3300006847 Bacteria 9375
107 Ga0075431_100027105 3300006847 Bacteria 5878
108 Ga0075433_10057125 3300006852 Bacteria 3410
109 Ga0075434_100052672 3300006871 Bacteria 4044
110 Ga0075429_100005074 3300006880 Bacteria 11323
111 Ga0075429_100133251 3300006880 Bacteria 2174
112 Ga0075436_100105251 3300006914 Bacteria 1967
113 Ga0097620_100009167 3300006931 Bacteria 9995
114 Ga0097620_100107113 3300006931 Bacteria 2855
115 Ga0075435_100028326 3300007076 Bacteria 4393
116 Ga0105251_10045964 3300009011 Bacteria 2103
117 Ga0111539_10019781 3300009094 Bacteria 8303
118 Ga0105245_10144180 3300009098 Bacteria 2246
119 Ga0105245_10204791 3300009098 Bacteria 1896
120 Ga0105247_10025995 3300009101 Bacteria 3534
121 Ga0105247_10079032 3300009101 Bacteria 2070
122 Ga0114129_10000058 3300009147 Bacteria 99035
123 Ga0114129_10059892 3300009147 Bacteria 5323
124 Ga0114129_10093000 3300009147 Bacteria 4178
125 Ga0114129_10276108 3300009147 Bacteria 2247
126 Ga0114129_10432108 3300009147 Bacteria 1730
127 Ga0114129_10520544 3300009147 Bacteria 1551
128 Ga0105243_10070379 3300009148 Bacteria 2825
129 Ga0105241_10226533 3300009174 Bacteria 1574
130 Ga0105248_10046413 3300009177 Bacteria 4869
131 Ga0105248_10110694 3300009177 Bacteria 3097
132 Ga0105248_10115625 3300009177 Bacteria 3025
133 Ga0105248_10187716 3300009177 Bacteria 2329
134 Ga0105237_10088097 3300009545 Bacteria 3094
135 Ga0105237_10378313 3300009545 Bacteria 1420
136 Ga0105238_10077816 3300009551 Bacteria 3308
137 Ga0105238_10137963 3300009551 Bacteria 2417
138 Ga0105249_10031315 3300009553 Bacteria 4810
139 Ga0157373_10076954 3300013100 Bacteria 2354
140 Ga0157371_10057686 3300013102 Bacteria 2754
141 Ga0157370_10071676 3300013104 Bacteria 3269
142 Ga0157370_10149466 3300013104 Bacteria 2174
143 Ga0157369_10044883 3300013105 Bacteria 4808
144 Ga0157374_10093066 3300013296 Bacteria 2877
145 Ga0157372_10030888 3300013307 Bacteria 5862
146 Ga0157372_10320905 3300013307 Bacteria 1803
147 Ga0157375_10172993 3300013308 Bacteria 2308
148 Ga0163163_10011981 3300014325 Bacteria 7890
149 Ga0163163_10089562 3300014325 Bacteria 3089
150 Ga0163163_10310314 3300014325 Bacteria 1630
151 Ga0157377_10001591 3300014745 Bacteria 9873
152 Ga0157379_10001751 3300014968 Bacteria 17946
153 Ga0157379_10040516 3300014968 Bacteria 4157
154 Ga0157379_10246814 3300014968 Bacteria 1620
155 Ga0157379_10301680 3300014968 Bacteria 1460
156 Ga0157376_10784086 3300014969 Bacteria 965
157 Ga0197907_11227458 3300020069 Bacteria 1057
158 Ga0206356_10835916 3300020070 Bacteria 2405
159 Ga0206356_10861627 3300020070 Bacteria 2050
160 Ga0206349_1534814 3300020075 Bacteria 987
161 Ga0206351_10828910 3300020077 Bacteria 1759
162 Ga0206354_10361108 3300020081 Bacteria 2253
163 Ga0206353_10810143 3300020082 Bacteria 1590
164 Ga0206353_10816148 3300020082 Bacteria 3838
165 Ga0224712_10009815 3300022467 Bacteria 2901
166 Ga0207692_10063666 3300025898 Bacteria 1917
167 Ga0207710_10000076 3300025900 Bacteria 145523
168 Ga0207710_10129478 3300025900 Bacteria 1211
169 Ga0207688_10014240 3300025901 Bacteria 4328
170 Ga0207688_10076692 3300025901 Bacteria 1904
171 Ga0207680_10194208 3300025903 Bacteria 1380
172 Ga0207647_10049220 3300025904 Bacteria 2615
173 Ga0207699_10142206 3300025906 Bacteria 1578
174 Ga0207645_10053862 3300025907 Bacteria 2570
175 Ga0207643_10015411 3300025908 Bacteria 4162
176 Ga0207705_10009030 3300025909 Bacteria 7263
177 Ga0207705_10059187 3300025909 Bacteria 2764
178 Ga0207707_10048597 3300025912 Bacteria 3695
179 Ga0207707_10050128 3300025912 Bacteria 3638
180 Ga0207695_10248404 3300025913 Bacteria 1679
181 Ga0207693_10055913 3300025915 Bacteria 3095
182 Ga0207663_10426958 3300025916 Bacteria 1018
183 Ga0207660_10032459 3300025917 Bacteria 3604
184 Ga0207657_10083013 3300025919 Bacteria 2688
185 Ga0207649_10058592 3300025920 Bacteria 2412
186 Ga0207649_10097436 3300025920 Bacteria 1939
187 Ga0207681_10297892 3300025923 Bacteria 1275
188 Ga0207650_10061167 3300025925 Bacteria 2811
189 Ga0207659_10028687 3300025926 Bacteria 3784
190 Ga0207687_10054657 3300025927 Bacteria 2794
191 Ga0207700_10043196 3300025928 Bacteria 3309
192 Ga0207700_10315075 3300025928 Bacteria 1354
193 Ga0207706_10167111 3300025933 Bacteria 1933
194 Ga0207709_10170785 3300025935 Bacteria 1526
195 Ga0207670_10072118 3300025936 Bacteria 2390
196 Ga0207691_10105615 3300025940 Bacteria 2509
197 Ga0207711_10049757 3300025941 Bacteria 3588
198 Ga0207711_10068854 3300025941 Bacteria 3066
199 Ga0207711_10161513 3300025941 Bacteria 2028
200 Ga0207689_10002160 3300025942 Bacteria 18498
201 Ga0207689_10041076 3300025942 Bacteria 3827
202 Ga0207661_10002508 3300025944 Bacteria 12631
203 Ga0207661_10002954 3300025944 Bacteria 11757
204 Ga0207679_10007215 3300025945 Bacteria 7042
205 Ga0207679_10008299 3300025945 Bacteria 6616
206 Ga0207679_10133294 3300025945 Bacteria 1996
207 Ga0207712_10080127 3300025961 Bacteria 2374
208 Ga0207640_10412609 3300025981 Bacteria 1103
209 Ga0207677_10003427 3300026023 Bacteria 8402
210 Ga0207703_10000058 3300026035 Bacteria 138087
211 Ga0207703_10057884 3300026035 Bacteria 3161
212 Ga0207703_10100790 3300026035 Bacteria 2447
213 Ga0207678_10005958 3300026067 Bacteria 10854
214 Ga0207678_10030283 3300026067 Bacteria 4725
215 Ga0207702_10032750 3300026078 Bacteria 4337
216 Ga0207702_10037737 3300026078 Bacteria 4045
217 Ga0207641_10059807 3300026088 Bacteria 3246
218 Ga0207641_10317829 3300026088 Bacteria 1476
219 Ga0207676_10000890 3300026095 Bacteria 23196
220 Ga0207676_10029336 3300026095 Bacteria 4117
221 Ga0207676_10074296 3300026095 Bacteria 2738
222 Ga0207676_10243024 3300026095 Bacteria 1616
223 Ga0207676_10318048 3300026095 Bacteria 1428
224 Ga0207674_10019710 3300026116 Bacteria 7302
225 Ga0207675_100142361 3300026118 Bacteria 2278
226 Ga0207675_100210666 3300026118 Bacteria 1869
227 Ga0207683_10004848 3300026121 Bacteria 11586
228 Ga0207698_10290381 3300026142 Bacteria 1517
229 Ga0268266_10284777 3300028379 Bacteria 1538
230 Ga0268265_10032127 3300028380 Bacteria 3799
231 Ga0307517_10100820 3300028786 Bacteria 2278
232 Ga0307515_10001375 3300028794 Bacteria 55075
233 Ga0307515_10061725 3300028794 Bacteria 5308
234 Ga0307513_10077781 3300031456 Bacteria 3434
235 Ga0307508_10124238 3300031616 Bacteria 2183
236 Ga0307508_10159714 3300031616 Bacteria 1858
237 Ga0307514_10169637 3300031649 Bacteria 1428
238 Ga0307516_10101590 3300031730 Bacteria 2691
239 Ga0307405_10003190 3300031731 Bacteria 7467
240 Ga0307405_10032890 3300031731 Bacteria 3070
241 Ga0307413_10179048 3300031824 Bacteria 1509
242 Ga0307518_10043700 3300031838 Bacteria 3262
243 Ga0307410_10046776 3300031852 Bacteria 2888
244 Ga0307406_10002237 3300031901 Bacteria 10537
245 Ga0307406_10247777 3300031901 Bacteria 1340
246 Ga0307412_10355118 3300031911 Bacteria 1178
247 Ga0307409_100001041 3300031995 Bacteria 13015
248 Ga0307409_100563997 3300031995 Bacteria 1120
249 Ga0307416_100000812 3300032002 Bacteria 16411
250 Ga0307415_100000084 3300032126 Bacteria 38884
251 Ga0307415_100051398 3300032126 Bacteria 2797
252 Ga0307415_100077387 3300032126 Bacteria 2362
253 Ga0307415_100248251 3300032126 Bacteria 1444
254 Ga0307415_100466351 3300032126 Bacteria 1096
255 Ga0307507_10079099 3300033179 Bacteria 2909
256 Ga0373951_0000465 3300035091 Bacteria 11703
257 Ga0373924_0078560 3300035410 Bacteria 1401
258 Ga0373935_0064322 3300035692 Bacteria 2352
259 Ga0395899_0010804 3300037312 Bacteria 7000
260 Ga0395900_0100085 3300037418 Bacteria 2977
261 Ga0395900_0157456 3300037418 Bacteria 2319
262 Ga0395898_0008830 3300037466 Bacteria 10619
263 Ga0395898_0009013 3300037466 Bacteria 10504
264 Ga0395905_0045287 3300037471 Bacteria 4126
265 Ga0395901_0034908 3300038443 Bacteria 5195
266 Ga0395901_0217155 3300038443 Bacteria 1999
267 Ga0451853_0267494 3300041512 Bacteria 2699
268 Ga0439448_0021955 3300042005 Bacteria 1980
269 Ga0439448_0025289 3300042005 Bacteria 1862
270 Ga0439458_0005197 3300042157 Bacteria 2932
271 Ga0466960_0023152 3300044901 Bacteria 2786
272 Ga0495629_0072023 3300046459 Bacteria 2412
273 Ga0495630_0183875 3300046517 Bacteria 1594
274 Ga0495581_0237823 3300047315 Bacteria 1065
275 Ga0496101_0439178 3300048904 Bacteria 1029
276 Ga0496102_0082331 3300048905 Bacteria 2968
277 Ga0496104_0052065 3300048907 Bacteria 3866
278 Ga0496104_0130162 3300048907 Bacteria 2417
279 Ga0496104_0158209 3300048907 Bacteria 2174
280 Ga0496105_0108621 3300048908 Bacteria 2290
281 Ga0496105_0127087 3300048908 Bacteria 2102
282 Ga0496107_0042512 3300048910 Bacteria 3264
283 Ga0496108_0000124 3300048911 Bacteria 76319
284 Ga0496108_0010141 3300048911 Bacteria 7645
285 Ga0496108_0012036 3300048911 Bacteria 7035
286 Ga0496108_0542395 3300048911 Bacteria 1015
287 Ga0496109_0019143 3300048912 Bacteria 6030
288 Ga0496110_0002620 3300048913 Bacteria 13539
289 Ga0496110_0004654 3300048913 Bacteria 10667
290 Ga0496110_0073415 3300048913 Bacteria 3036
291 Ga0496110_0311802 3300048913 Bacteria 1433
292 Ga0496111_0021368 3300048914 Bacteria 4518
293 Ga0496112_0006941 3300048915 Bacteria 9994
294 Ga0496112_0048100 3300048915 Bacteria 4182
295 Ga0496112_0078595 3300048915 Bacteria 3262
296 Ga0496112_0194322 3300048915 Bacteria 1990
297 Ga0496113_0002250 3300048916 Bacteria 11130
298 Ga0496113_0004128 3300048916 Bacteria 8858
299 Ga0496114_0342591 3300048917 Bacteria 1322
300 Ga0496119_0048608 3300048922 Bacteria 2629
301 Ga0496121_0004824 3300048924 Bacteria 17758
302 Ga0496126_0000036 3300048929 Bacteria 354901
303 Ga0501034_0439148 3300049571 Bacteria 1224
304 Ga0501037_0106160 3300049573 Bacteria 2024
305 Ga0501038_0072405 3300049574 Bacteria 2921
306 Ga0501046_0078748 3300049580 Bacteria 2549
307 Ga0501047_0143126 3300049581 Bacteria 2269
308 Ga0501047_0149218 3300049581 Bacteria 2214
309 Ga0501070_0208154 3300049586 Bacteria 1606
310 Ga0501080_0122434 3300049742 Bacteria 2410
311 Ga0501044_0059208 3300049823 Bacteria 3925
312 nmdc:mga05p37_19467_c1 3300050507 Bacteria 8211
313 nmdc:mga05p37_3210_c1 3300050507 Bacteria 19034
314 nmdc:mga05p37_440012_c1 3300050507 Bacteria 1512
315 nmdc:mga05p37_82809_c1 3300050507 Bacteria 3953
316 nmdc:mga09592_182405_c1 3300050508 Bacteria 1816
317 nmdc:mga09592_30_c2 3300050508 Bacteria 42688
318 nmdc:mga09592_36916_c1 3300050508 Bacteria 4095
319 nmdc:mga09592_46837_c1 3300050508 Bacteria 3643
320 nmdc:mga0qj67_108102_c1 3300050509 Bacteria 2244
321 nmdc:mga0qj67_1_c2 3300050509 Bacteria 129768
322 nmdc:mga0qj67_216633_c1 3300050509 Bacteria 1554
323 nmdc:mga0qj67_252617_c1 3300050509 Bacteria 1430
324 nmdc:mga0qj67_3825_c1 3300050509 Bacteria 10877
325 nmdc:mga06r32_141145_c1 3300050510 Bacteria 2385
326 nmdc:mga06r32_34_c2 3300050510 Bacteria 56571
327 nmdc:mga06r32_68462_c1 3300050510 Bacteria 3429
328 nmdc:mga08y16_101319_c1 3300050511 Bacteria 2998
329 nmdc:mga08y16_65458_c1 3300050511 Bacteria 3795
330 nmdc:mga0n895_11124_c1 3300050512 Bacteria 8008
331 nmdc:mga0n895_483505_c1 3300050512 Bacteria 1248
332 nmdc:mga0rr50_26660_c1 3300050513 Bacteria 4036
333 Ga0500646_0001271 3300053090 Bacteria 6756
334 Ga0500583_0025364 3300053092 Bacteria 2531
335 Ga0500583_0089650 3300053092 Bacteria 1496
336 Ga0500654_101206 3300053099 Bacteria 1229
337 Ga0500579_060546 3300053143 Bacteria 2251
338 Ga0500588_0000204 3300053146 Bacteria 8329
339 2501944057 2501939600 Bacteria 6907073
340 2515851519 2515154155 Bacteria 7985436
341 2579854688 2579778521 Bacteria 7624758
342 2619857542 2619618881 Bacteria 7521104
343 2620350734 2619619003 Bacteria 7619552
344 2623587697 2622736626 Bacteria 7181580
345 2626636743 2626541554 Bacteria 7741902
346 2676484352 2675903059 Bacteria 8644972
347 2731906699 2731639228 Bacteria 4187555
348 2855673435 2855670206 Bacteria 7120389
349 2855680865 2855676851 Bacteria 7063653
350 2855683633 2855683550 Bacteria 7134265
351 2856745186 2856741275 Bacteria 8096094
352 2856861727 2856858025 Bacteria 7255264
353 2857292475 2857288857 Bacteria 7189066
354 2858851557 2858848962 Bacteria 6963058
355 2858873345 2858868258 Bacteria 7683772
356 2858887430 2858882152 Bacteria 7230291
357 2858892549 2858888857 Bacteria 7060307
358 2858897210 2858895516 Bacteria 7378898
359 2858906450 2858902515 Bacteria 7086037
360 2869050853 2869048445 Bacteria 6875584
361 2869064302 2869061728 Bacteria 7112407
362 2869075292 2869068681 Bacteria 7205615
363 2880500869 2880495981 Bacteria 7340502
364 2891397234 2891395885 Bacteria 9251614
365 2891561467 2891554331 Bacteria 8812224
366 2891568902 2891562705 Bacteria 8039471
367 2902586989 2902582711 Bacteria 6187705
368 2929229382 2929226422 Bacteria 7248583
369 2996221840 2996221748 Bacteria 6799777
370 649812329 649633069 Bacteria 6962533
371 8003833061 8003830390 Bacteria 6541657
372 8003861445 8003856774 Bacteria 7675274
373 8003877820 8003870546 Bacteria 7396674
374 8054706276 8054704163 Bacteria 7247792
375 8054732632 8054727385 Bacteria 7558670
376 8054737856 8054734606 Bacteria 6947278
377 8055417683 8055412473 Bacteria 6257500
378 Ga0207670_10225401
379 JGI24741J21665_1015743
380 JGI24737J22298_10068814
381 JGI24751J29686_10023042
382 JGI25406J46586_10002462
383 JGI25406J46586_10015586
384 JGI25406J46586_10025823
385 rootH1_10029623
386 Ga0070658_10027427
387 Ga0070676_10160461
388 Ga0070683_100002574
389 Ga0070670_100088587
390 Ga0068869_100004370
391 Ga0068869_100009096
392 Ga0070666_10168078
393 Ga0070680_100022235
394 Ga0070680_100032732
395 Ga0070682_100039619
396 Ga0068868_100143751
397 Ga0070660_100171853
398 Ga0070691_10010608
399 Ga0070661_100005677
400 Ga0070661_100028707
401 Ga0070661_100053544
402 Ga0070661_100261158
403 Ga0070692_10070841
404 Ga0070692_10089512
405 Ga0070668_100001879
406 Ga0070669_100104201
407 Ga0070675_100002025
408 Ga0070675_100013424
409 Ga0070671_100003873
410 Ga0070673_100248465
411 Ga0070659_100299574
412 Ga0070667_100283103
413 Ga0070709_10012586
414 Ga0070714_100048987
415 Ga0070713_100013780
416 Ga0070713_100059392
417 Ga0070710_10011804
418 Ga0070701_10054579
419 Ga0070711_100064662
420 Ga0070663_100015311
421 Ga0070678_100055471
422 Ga0070678_100060750
423 Ga0070681_10058425
424 Ga0070685_10080370
425 Ga0070706_100297858
426 Ga0070679_100013135
427 Ga0070679_100082848
428 Ga0070684_100003717
429 Ga0070684_100005426
430 Ga0070684_100132492
431 Ga0068853_100154846
432 Ga0070693_100016004
433 Ga0070693_100071498
434 Ga0070665_100028356
435 Ga0068855_100807174
436 Ga0070664_100013195
437 Ga0070664_100056281
438 Ga0070664_100134691
439 Ga0070664_100156915
440 Ga0068857_100054518
441 Ga0068857_100069355
442 Ga0068854_100315697
443 Ga0068856_100032532
444 Ga0070702_100021420
445 Ga0070702_100022554
446 Ga0068859_100009167
447 Ga0068859_100107115
448 Ga0068864_100018767
449 Ga0068864_100350067
450 Ga0068864_100401349
451 Ga0068864_100654730
452 Ga0068861_100102553
453 Ga0068851_10013796
454 Ga0068870_10000450
455 Ga0068863_100022628
456 Ga0068863_100026592
457 Ga0068863_100319535
458 Ga0068858_100002543
459 Ga0068858_100076210
460 Ga0068860_100039879
461 Ga0081455_10000721
462 Ga0081538_10047016
463 Ga0081540_1004205
464 Ga0081540_1063839
465 Ga0081540_1104681
466 Ga0081539_10000135
467 Ga0081539_10001164
468 Ga0081539_10003347
469 Ga0081539_10005868
470 Ga0070717_10349357
471 Ga0075432_10023094
472 Ga0075367_10216944
473 Ga0097621_100225396
474 Ga0068871_100077201
475 Ga0075428_100000147
476 Ga0075428_100000533
477 Ga0075428_100035578
478 Ga0075428_100145906
479 Ga0075428_100148479
480 Ga0075430_100005714
481 Ga0075430_100010909
482 Ga0075430_100092667
483 Ga0075431_100010340
484 Ga0075431_100027105
485 Ga0075433_10057125
486 Ga0075434_100052672
487 Ga0075429_100005074
488 Ga0075429_100133251
489 Ga0075436_100105251
490 Ga0097620_100009167
491 Ga0097620_100107113
492 Ga0075435_100028326
493 Ga0105251_10045964
494 Ga0111539_10019781
495 Ga0105245_10144180
496 Ga0105245_10204791
497 Ga0105247_10025995
498 Ga0105247_10079032
499 Ga0114129_10000058
500 Ga0114129_10059892
501 Ga0114129_10093000
502 Ga0114129_10276108
503 Ga0114129_10432108
504 Ga0114129_10520544
505 Ga0105243_10070379
506 Ga0105241_10226533
507 Ga0105248_10046413
508 Ga0105248_10110694
509 Ga0105248_10115625
510 Ga0105248_10187716
511 Ga0105237_10088097
512 Ga0105237_10378313
513 Ga0105238_10077816
514 Ga0105238_10137963
515 Ga0105249_10031315
516 Ga0157373_10076954
517 Ga0157371_10057686
518 Ga0157370_10071676
519 Ga0157370_10149466
520 Ga0157369_10044883
521 Ga0157374_10093066
522 Ga0157372_10030888
523 Ga0157372_10320905
524 Ga0157375_10172993
525 Ga0163163_10011981
526 Ga0163163_10089562
527 Ga0163163_10310314
528 Ga0157377_10001591
529 Ga0157379_10001751
530 Ga0157379_10040516
531 Ga0157379_10246814
532 Ga0157379_10301680
533 Ga0157376_10784086
534 Ga0197907_11227458
535 Ga0206356_10835916
536 Ga0206356_10861627
537 Ga0206349_1534814
538 Ga0206351_10828910
539 Ga0206354_10361108
540 Ga0206353_10810143
541 Ga0206353_10816148
542 Ga0224712_10009815
543 Ga0207692_10063666
544 Ga0207710_10000076
545 Ga0207710_10129478
546 Ga0207688_10014240
547 Ga0207688_10076692
548 Ga0207680_10194208
549 Ga0207647_10049220
550 Ga0207699_10142206
551 Ga0207645_10053862
552 Ga0207643_10015411
553 Ga0207705_10009030
554 Ga0207705_10059187
555 Ga0207707_10048597
556 Ga0207707_10050128
557 Ga0207695_10248404
558 Ga0207693_10055913
559 Ga0207663_10426958
560 Ga0207660_10032459
561 Ga0207657_10083013
562 Ga0207649_10058592
563 Ga0207649_10097436
564 Ga0207681_10297892
565 Ga0207650_10061167
566 Ga0207659_10028687
567 Ga0207687_10054657
568 Ga0207700_10043196
569 Ga0207700_10315075
570 Ga0207706_10167111
571 Ga0207709_10170785
572 Ga0207670_10072118
573 Ga0207691_10105615
574 Ga0207711_10049757
575 Ga0207711_10068854
576 Ga0207711_10161513
577 Ga0207689_10002160
578 Ga0207689_10041076
579 Ga0207661_10002508
580 Ga0207661_10002954
581 Ga0207679_10007215
582 Ga0207679_10008299
583 Ga0207679_10133294
584 Ga0207712_10080127
585 Ga0207640_10412609
586 Ga0207677_10003427
587 Ga0207703_10000058
588 Ga0207703_10057884
589 Ga0207703_10100790
590 Ga0207678_10005958
591 Ga0207678_10030283
592 Ga0207702_10032750
593 Ga0207702_10037737
594 Ga0207641_10059807
595 Ga0207641_10317829
596 Ga0207676_10000890
597 Ga0207676_10029336
598 Ga0207676_10074296
599 Ga0207676_10243024
600 Ga0207676_10318048
601 Ga0207674_10019710
602 Ga0207675_100142361
603 Ga0207675_100210666
604 Ga0207683_10004848
605 Ga0207698_10290381
606 Ga0268266_10284777
607 Ga0268265_10032127
608 Ga0307517_10100820
609 Ga0307515_10001375
610 Ga0307515_10061725
611 Ga0307513_10077781
612 Ga0307508_10124238
613 Ga0307508_10159714
614 Ga0307514_10169637
615 Ga0307516_10101590
616 Ga0307405_10003190
617 Ga0307405_10032890
618 Ga0307413_10179048
619 Ga0307518_10043700
620 Ga0307410_10046776
621 Ga0307406_10002237
622 Ga0307406_10247777
623 Ga0307412_10355118
624 Ga0307409_100001041
625 Ga0307409_100563997
626 Ga0307416_100000812
627 Ga0307415_100000084
628 Ga0307415_100051398
629 Ga0307415_100077387
630 Ga0307415_100248251
631 Ga0307415_100466351
632 Ga0307507_10079099
633 Ga0373951_0000465
634 Ga0373924_0078560
635 Ga0373935_0064322
636 Ga0395899_0010804
637 Ga0395900_0100085
638 Ga0395900_0157456
639 Ga0395898_0008830
640 Ga0395898_0009013
641 Ga0395905_0045287
642 Ga0395901_0034908
643 Ga0395901_0217155
644 Ga0451853_0267494
645 Ga0439448_0021955
646 Ga0439448_0025289
647 Ga0439458_0005197
648 Ga0466960_0023152
649 Ga0495629_0072023
650 Ga0495630_0183875
651 Ga0495581_0237823
652 Ga0496101_0439178
653 Ga0496102_0082331
654 Ga0496104_0052065
655 Ga0496104_0130162
656 Ga0496104_0158209
657 Ga0496105_0108621
658 Ga0496105_0127087
659 Ga0496107_0042512
660 Ga0496108_0000124
661 Ga0496108_0010141
662 Ga0496108_0012036
663 Ga0496108_0542395
664 Ga0496109_0019143
665 Ga0496110_0002620
666 Ga0496110_0004654
667 Ga0496110_0073415
668 Ga0496110_0311802
669 Ga0496111_0021368
670 Ga0496112_0006941
671 Ga0496112_0048100
672 Ga0496112_0078595
673 Ga0496112_0194322
674 Ga0496113_0002250
675 Ga0496113_0004128
676 Ga0496114_0342591
677 Ga0496119_0048608
678 Ga0496121_0004824
679 Ga0496126_0000036
680 Ga0501034_0439148
681 Ga0501037_0106160
682 Ga0501038_0072405
683 Ga0501046_0078748
684 Ga0501047_0143126
685 Ga0501047_0149218
686 Ga0501070_0208154
687 Ga0501080_0122434
688 Ga0501044_0059208
689 nmdc:mga05p37_19467_c1
690 nmdc:mga05p37_3210_c1
691 nmdc:mga05p37_440012_c1
692 nmdc:mga05p37_82809_c1
693 nmdc:mga09592_182405_c1
694 nmdc:mga09592_30_c2
695 nmdc:mga09592_36916_c1
696 nmdc:mga09592_46837_c1
697 nmdc:mga0qj67_108102_c1
698 nmdc:mga0qj67_1_c2
699 nmdc:mga0qj67_216633_c1
700 nmdc:mga0qj67_252617_c1
701 nmdc:mga0qj67_3825_c1
702 nmdc:mga06r32_141145_c1
703 nmdc:mga06r32_34_c2
704 nmdc:mga06r32_68462_c1
705 nmdc:mga08y16_101319_c1
706 nmdc:mga08y16_65458_c1
707 nmdc:mga0n895_11124_c1
708 nmdc:mga0n895_483505_c1
709 nmdc:mga0rr50_26660_c1
710 Ga0500646_0001271
711 Ga0500583_0025364
712 Ga0500583_0089650
713 Ga0500654_101206
714 Ga0500579_060546
715 Ga0500588_0000204
716 2501944057
717 2515851519
718 2579854688
719 2619857542
720 2620350734
721 2623587697
722 2626636743
723 2676484352
724 2731906699
725 2855673435
726 2855680865
727 2855683633
728 2856745186
729 2856861727
730 2857292475
731 2858851557
732 2858873345
733 2858887430
734 2858892549
735 2858897210
736 2858906450
737 2869050853
738 2869064302
739 2869075292
740 2880500869
741 2891397234
742 2891561467
743 2891568902
744 2902586989
745 2929229382
746 2996221840
747 649812329
748 8003833061
749 8003861445
750 8003877820
751 8054706276
752 8054732632
753 8054737856
754 8055417683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

38

300

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.8949 1 288
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8809 4 288
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.878 1 288
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8772 3 288
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8677 3 288
ID Description Score Start End Superfamily
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8994 4 288 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8772 3 288 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8727 1 288 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8688 3 286 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8677 3 288 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A5D0Q604-F1-model_v4 deleted 0.9885 1 297
AF-A0A7V8WK98-F1-model_v4 DUF72 domain-containing protein 0.9859 1 225
AF-A0A543CSD5-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9852 1 291
AF-A0A6I5U6B5-F1-model_v4 deleted 0.9841 1 288
AF-A0A5D0UMW8-F1-model_v4 DUF72 domain-containing protein 0.9829 118 288

Map