F427714

General Info

Members Datasets Scaffolds Average Seq Length
377 256 357 155

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10354678|Ga0207660_103546782
Length 189
Sequence MLGRFILVTSALFLPLTGSVFLSVSNPRDNTMSQLSHFDESGASRMVDVGGKAETERIARASAVVRMQPETLALIRDRKLSKGDVVEVARLAGIMAAKKTADLIPLCHPLPLTSVTLDFAFADPDCLRIEATAKLFGRTGVEMEALTAVSVAALTVYDMCKAADRGMTIEQVRLEEKSGGKSGHWQNAE

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
5 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
6 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
7 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
8 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
11 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
12 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
13 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
14 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
15 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
16 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
17 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
240 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
255 8052494512 Pseudomonas putida LD6 Isolate Unclassified
256 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 0
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 4.24
Nodule 0.53
Rhizoplane 6.9
Rhizosphere 80.64
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1016040 3300001915 Bacteria 1228
2 JGI24740J21852_10012950 3300001979 Bacteria 3130
3 JGI24739J22299_10058635 3300001989 Bacteria 1222
4 JGI24735J21928_10005786 3300002067 Bacteria 4090
5 JGI24738J21930_10034945 3300002075 Bacteria 1024
6 JGI25159J45721_1041222 3300002987 Bacteria 673
7 JGI25151J46595_10000330 3300003187 Bacteria 51252
8 JGI25151J46595_10000531 3300003187 Bacteria 35418
9 Ga0055536_1038527 3300003781 Bacteria 1157
10 Ga0055540_1017426 3300003792 Bacteria 2006
11 Ga0070658_10052972 3300005327 Bacteria 3292
12 Ga0070658_11354617 3300005327 Bacteria 618
13 Ga0070676_10000855 3300005328 Bacteria 15051
14 Ga0070676_10141209 3300005328 Bacteria 1533
15 Ga0070683_100113743 3300005329 Bacteria 2554
16 Ga0070670_100013816 3300005331 Bacteria 6922
17 Ga0068869_100000031 3300005334 Bacteria 60884
18 Ga0070666_10305794 3300005335 Bacteria 1133
19 Ga0070680_100016789 3300005336 Bacteria 5760
20 Ga0070680_100020130 3300005336 Bacteria 5293
21 Ga0068868_100000060 3300005338 Bacteria 61952
22 Ga0068868_100113920 3300005338 Unclassified 2199
23 Ga0068868_100712243 3300005338 Bacteria 899
24 Ga0070689_100619409 3300005340 Bacteria 939
25 Ga0070661_100005232 3300005344 Bacteria 8935
26 Ga0070668_100601083 3300005347 Bacteria 962
27 Ga0070668_101654684 3300005347 Bacteria 587
28 Ga0070669_100034317 3300005353 Bacteria 3673
29 Ga0070669_100117575 3300005353 Bacteria 2024
30 Ga0070669_100200104 3300005353 Bacteria 1571
31 Ga0070669_100787498 3300005353 Bacteria 808
32 Ga0070671_100678996 3300005355 Bacteria 893
33 Ga0070674_100358806 3300005356 Bacteria 1179
34 Ga0070673_100000009 3300005364 Bacteria 155005
35 Ga0070659_100013699 3300005366 Bacteria 6044
36 Ga0070667_100000142 3300005367 Bacteria 90696
37 Ga0070667_100140698 3300005367 Bacteria 2113
38 Ga0070709_10307602 3300005434 Bacteria 1159
39 Ga0070714_100752414 3300005435 Bacteria 942
40 Ga0070710_10551281 3300005437 Bacteria 796
41 Ga0070694_100123810 3300005444 Bacteria 1859
42 Ga0070708_100744150 3300005445 Bacteria 922
43 Ga0070663_100031007 3300005455 Bacteria 3670
44 Ga0070681_10098554 3300005458 Bacteria 2869
45 Ga0070681_10304691 3300005458 Bacteria 1503
46 Ga0068867_100000165 3300005459 Bacteria 42939
47 Ga0068867_100023459 3300005459 Bacteria 4416
48 Ga0070707_100182488 3300005468 Bacteria 2046
49 Ga0070707_100612673 3300005468 Bacteria 1051
50 Ga0070698_100339046 3300005471 Bacteria 1435
51 Ga0070698_100674495 3300005471 Bacteria 975
52 Ga0070699_100101989 3300005518 Bacteria 2516
53 Ga0070679_100019300 3300005530 Bacteria 6625
54 Ga0070679_100130216 3300005530 Bacteria 2497
55 Ga0070684_101502638 3300005535 Bacteria 635
56 Ga0068853_100020735 3300005539 Bacteria 5466
57 Ga0068853_100570843 3300005539 Bacteria 1073
58 Ga0068853_100607866 3300005539 Bacteria 1039
59 Ga0070672_100452413 3300005543 Bacteria 1106
60 Ga0070686_101126167 3300005544 Bacteria 649
61 Ga0070665_100017201 3300005548 Bacteria 7255
62 Ga0068855_100000371 3300005563 Bacteria 55533
63 Ga0068855_100029826 3300005563 Bacteria 6522
64 Ga0068855_100100483 3300005563 Bacteria 3330
65 Ga0068857_100187763 3300005577 Bacteria 1882
66 Ga0068854_100082323 3300005578 Bacteria 2379
67 Ga0068854_100257885 3300005578 Bacteria 1395
68 Ga0068852_100009398 3300005616 Bacteria 7261
69 Ga0068852_101305828 3300005616 Bacteria 747
70 Ga0068859_100002067 3300005617 Bacteria 20487
71 Ga0068864_100114460 3300005618 Bacteria 2405
72 Ga0068864_100259442 3300005618 Bacteria 1616
73 Ga0068864_101242682 3300005618 Bacteria 744
74 Ga0068863_100005764 3300005841 Bacteria 12154
75 Ga0068863_100116515 3300005841 Unclassified 2546
76 Ga0068863_100204992 3300005841 Bacteria 1898
77 Ga0068858_100001528 3300005842 Bacteria 23768
78 Ga0068858_100006118 3300005842 Bacteria 11739
79 Ga0068858_100060394 3300005842 Bacteria 3504
80 Ga0068860_100000160 3300005843 Bacteria 110266
81 Ga0068860_100114117 3300005843 Unclassified 2583
82 Ga0068862_100001362 3300005844 Bacteria 22694
83 Ga0068862_100475513 3300005844 Bacteria 1182
84 Ga0075364_10714516 3300006051 Bacteria 684
85 Ga0075428_100000815 3300006844 Bacteria 32626
86 Ga0075428_100004847 3300006844 Bacteria 14927
87 Ga0075428_101287929 3300006844 Bacteria 769
88 Ga0075434_101143099 3300006871 Bacteria 791
89 Ga0068865_100000014 3300006881 Bacteria 138727
90 Ga0068865_100273298 3300006881 Bacteria 1342
91 Ga0097620_100002067 3300006931 Bacteria 20487
92 Ga0099823_1000030 3300006944 Bacteria 69064
93 Ga0105245_10000160 3300009098 Bacteria 63445
94 Ga0105245_10137775 3300009098 Bacteria 2295
95 Ga0105247_10000078 3300009101 Bacteria 110404
96 Ga0114129_10875563 3300009147 Bacteria 1140
97 Ga0105243_10000070 3300009148 Bacteria 120851
98 Ga0105243_10359700 3300009148 Bacteria 1339
99 Ga0105242_10000722 3300009176 Bacteria 25846
100 Ga0105242_10215079 3300009176 Bacteria 1715
101 Ga0105242_10720380 3300009176 Bacteria 978
102 Ga0105248_10000082 3300009177 Bacteria 110759
103 Ga0105248_10145455 3300009177 Bacteria 2675
104 Ga0105248_10367990 3300009177 Bacteria 1618
105 Ga0105248_12326517 3300009177 Bacteria 610
106 Ga0105237_10052631 3300009545 Bacteria 4086
107 Ga0105237_10457375 3300009545 Bacteria 1282
108 Ga0105238_10031321 3300009551 Bacteria 5413
109 Ga0105249_10000031 3300009553 Bacteria 220006
110 Ga0105249_10037759 3300009553 Bacteria 4383
111 Ga0105148_100031 3300009978 Bacteria 20228
112 Ga0105246_10000434 3300011119 Bacteria 22337
113 Ga0105246_10388458 3300011119 Bacteria 1155
114 Ga0157373_10107935 3300013100 Bacteria 1957
115 Ga0157373_10619749 3300013100 Bacteria 788
116 Ga0157371_10011585 3300013102 Bacteria 6778
117 Ga0157370_10000680 3300013104 Bacteria 42288
118 Ga0157369_10026651 3300013105 Bacteria 6409
119 Ga0157369_10268908 3300013105 Bacteria 1777
120 Ga0157374_10000542 3300013296 Bacteria 33699
121 Ga0157378_10000624 3300013297 Bacteria 33307
122 Ga0157378_10063161 3300013297 Bacteria 3308
123 Ga0163162_10087147 3300013306 Bacteria 3200
124 Ga0163162_10379232 3300013306 Bacteria 1547
125 Ga0163162_10556240 3300013306 Bacteria 1275
126 Ga0157372_10704233 3300013307 Bacteria 1175
127 Ga0157372_10866275 3300013307 Bacteria 1048
128 Ga0157375_10001639 3300013308 Bacteria 19250
129 Ga0157375_10097994 3300013308 Bacteria 3007
130 Ga0157375_11075087 3300013308 Bacteria 941
131 Ga0163163_10104560 3300014325 Bacteria 2857
132 Ga0163163_11334694 3300014325 Bacteria 779
133 Ga0157380_10013963 3300014326 Bacteria 5864
134 Ga0157377_10029968 3300014745 Bacteria 2943
135 Ga0157377_10387795 3300014745 Bacteria 948
136 Ga0157379_10061020 3300014968 Unclassified 3372
137 Ga0157379_10633858 3300014968 Bacteria 1000
138 Ga0157376_10000096 3300014969 Bacteria 65482
139 Ga0157376_11684676 3300014969 Bacteria 669
140 Ga0213871_10071423 3300021441 Bacteria 981
141 Ga0209130_1000771 3300025284 Bacteria 27646
142 Ga0209676_1001035 3300025292 Bacteria 32260
143 Ga0209676_1051830 3300025292 Bacteria 1074
144 Ga0209025_1000327 3300025294 Bacteria 106055
145 Ga0209758_1002694 3300025297 Bacteria 17512
146 Ga0207426_1000080 3300025302 Bacteria 304917
147 Ga0207655_1001035 3300025728 Bacteria 28075
148 Ga0207655_1002809 3300025728 Bacteria 13501
149 Ga0207713_1024390 3300025735 Bacteria 2822
150 Ga0207713_1037789 3300025735 Bacteria 2055
151 Ga0207692_10428648 3300025898 Bacteria 829
152 Ga0207710_10000022 3300025900 Bacteria 335632
153 Ga0207647_10001970 3300025904 Bacteria 15680
154 Ga0207647_10068302 3300025904 Bacteria 2152
155 Ga0207645_10002952 3300025907 Bacteria 13131
156 Ga0207705_10003472 3300025909 Bacteria 11988
157 Ga0207707_10221387 3300025912 Bacteria 1647
158 Ga0207707_10287311 3300025912 Bacteria 1423
159 Ga0207671_10268633 3300025914 Bacteria 1343
160 Ga0207660_10011899 3300025917 Bacteria 5676
161 Ga0207660_10354678 3300025917 Bacteria 1176
162 Ga0207657_10015781 3300025919 Bacteria 7300
163 Ga0207649_10016372 3300025920 Bacteria 4179
164 Ga0207649_10518793 3300025920 Bacteria 908
165 Ga0207652_10021398 3300025921 Bacteria 5338
166 Ga0207646_10249314 3300025922 Bacteria 1604
167 Ga0207646_10756820 3300025922 Bacteria 867
168 Ga0207681_10101376 3300025923 Bacteria 2077
169 Ga0207681_10295039 3300025923 Bacteria 1281
170 Ga0207681_10325938 3300025923 Bacteria 1223
171 Ga0207681_10818242 3300025923 Bacteria 778
172 Ga0207694_10492025 3300025924 Bacteria 1026
173 Ga0207650_10015123 3300025925 Bacteria 5370
174 Ga0207687_10125926 3300025927 Bacteria 1923
175 Ga0207664_10077747 3300025929 Bacteria 2690
176 Ga0207664_10339727 3300025929 Bacteria 1327
177 Ga0207690_10233824 3300025932 Bacteria 1412
178 Ga0207686_10000489 3300025934 Bacteria 26020
179 Ga0207709_10000066 3300025935 Bacteria 189194
180 Ga0207709_10237366 3300025935 Bacteria 1324
181 Ga0207670_10185219 3300025936 Bacteria 1571
182 Ga0207669_10280089 3300025937 Bacteria 1257
183 Ga0207704_10000002 3300025938 Bacteria 303025
184 Ga0207704_10000007 3300025938 Bacteria 211230
185 Ga0207704_11451955 3300025938 Bacteria 588
186 Ga0207711_10000984 3300025941 Bacteria 27321
187 Ga0207711_10655268 3300025941 Bacteria 979
188 Ga0207711_11061084 3300025941 Bacteria 750
189 Ga0207689_10000060 3300025942 Bacteria 85326
190 Ga0207661_10353358 3300025944 Bacteria 1326
191 Ga0207667_10000017 3300025949 Bacteria 390654
192 Ga0207667_10066813 3300025949 Bacteria 3747
193 Ga0207651_10000004 3300025960 Bacteria 290191
194 Ga0207712_10000029 3300025961 Bacteria 220014
195 Ga0207712_10006048 3300025961 Bacteria 7634
196 Ga0207668_10258027 3300025972 Bacteria 1419
197 Ga0207668_11189722 3300025972 Bacteria 685
198 Ga0207640_10163689 3300025981 Bacteria 1649
199 Ga0207640_10241461 3300025981 Bacteria 1396
200 Ga0207658_10000113 3300025986 Bacteria 88960
201 Ga0207677_10000231 3300026023 Bacteria 43615
202 Ga0207677_10325967 3300026023 Unclassified 1278
203 Ga0207703_10000123 3300026035 Bacteria 92590
204 Ga0207703_10003514 3300026035 Bacteria 13110
205 Ga0207703_10042840 3300026035 Bacteria 3631
206 Ga0207703_10806090 3300026035 Bacteria 896
207 Ga0207639_10006160 3300026041 Bacteria 8142
208 Ga0207639_10408736 3300026041 Bacteria 1224
209 Ga0207639_10469231 3300026041 Bacteria 1145
210 Ga0207639_10745608 3300026041 Bacteria 910
211 Ga0207678_10039513 3300026067 Bacteria 4095
212 Ga0207702_10034476 3300026078 Bacteria 4232
213 Ga0207702_10173139 3300026078 Unclassified 1981
214 Ga0207702_10217185 3300026078 Bacteria 1780
215 Ga0207641_10003451 3300026088 Bacteria 13997
216 Ga0207641_10013855 3300026088 Bacteria 6613
217 Ga0207641_10207687 3300026088 Bacteria 1809
218 Ga0207641_10391273 3300026088 Bacteria 1333
219 Ga0207648_10000003 3300026089 Bacteria 289983
220 Ga0207676_10070176 3300026095 Bacteria 2809
221 Ga0207676_11149662 3300026095 Bacteria 768
222 Ga0207674_10480619 3300026116 Bacteria 1201
223 Ga0207698_10007002 3300026142 Bacteria 7060
224 Ga0207698_10361360 3300026142 Bacteria 1375
225 Ga0209389_1000002 3300027296 Bacteria 333932
226 Ga0209371_1012891 3300027312 Bacteria 2387
227 Ga0268266_10010567 3300028379 Bacteria 8056
228 Ga0268265_10000040 3300028380 Bacteria 194156
229 Ga0268265_10449509 3300028380 Bacteria 1203
230 Ga0268264_10000017 3300028381 Bacteria 498037
231 Ga0268264_10310654 3300028381 Bacteria 1487
232 Ga0307515_10000222 3300028794 Bacteria 140902
233 Ga0265338_10589050 3300028800 Bacteria 775
234 Ga0268256_1014115 3300030500 Bacteria 2387
235 Ga0265331_10025728 3300031250 Bacteria 2967
236 Ga0265327_10015600 3300031251 Bacteria 4891
237 Ga0307513_10003042 3300031456 Bacteria 22874
238 Ga0307408_100000020 3300031548 Bacteria 340408
239 Ga0307514_10000772 3300031649 Bacteria 53243
240 Ga0316576_10000003 3300031727 Bacteria 66659
241 Ga0316576_10370094 3300031727 Unclassified 1065
242 Ga0316578_10043086 3300031728 Bacteria 2620
243 Ga0307406_10504085 3300031901 Bacteria 982
244 Ga0307412_10209330 3300031911 Bacteria 1487
245 Ga0307414_10153525 3300032004 Bacteria 1820
246 Ga0307414_10280019 3300032004 Bacteria 1401
247 Ga0307510_10245693 3300033180 Bacteria 1281
248 Ga0316574_0320051 3300035398 Bacteria 985
249 Ga0316574_0482515 3300035398 Bacteria 774
250 Ga0373931_0064347 3300035691 Bacteria 1985
251 Ga0395899_0496597 3300037312 Bacteria 792
252 Ga0395898_0617067 3300037466 Bacteria 1027
253 Ga0395905_0001436 3300037471 Bacteria 28673
254 Ga0436364_0574645 3300037853 Bacteria 2921
255 Ga0436364_0936821 3300037853 Bacteria 991
256 Ga0436364_1123088 3300037853 Bacteria 548
257 Ga0395901_0077545 3300038443 Bacteria 3468
258 Ga0395901_0275921 3300038443 Bacteria 1748
259 Ga0395901_0443392 3300038443 Bacteria 1329
260 Ga0436365_0426365 3300039437 Bacteria 527
261 Ga0436360_0189330 3300039438 Bacteria 572
262 Ga0436360_1010877 3300039438 Bacteria 3070
263 Ga0436363_1379968 3300039450 Bacteria 2136
264 Ga0439461_0059605 3300041410 Bacteria 864
265 Ga0451791_1862452 3300041451 Bacteria 1132
266 Ga0451793_1172650 3300041452 Bacteria 1189
267 Ga0451845_0117564 3300041501 Bacteria 1098
268 Ga0439431_0040638 3300041997 Bacteria 1183
269 Ga0450907_019272 3300042146 Bacteria 1144
270 Ga0439446_0003711 3300042156 Bacteria 3815
271 Ga0439434_0090929 3300042435 Bacteria 976
272 Ga0439464_0003376 3300042439 Bacteria 4023
273 Ga0466986_0095819 3300044650 Bacteria 2049
274 Ga0466966_0816707 3300044684 Bacteria 562
275 Ga0451576_0463297 3300045051 Bacteria 1331
276 Ga0466967_0033277 3300045976 Bacteria 4362
277 Ga0466967_0056944 3300045976 Bacteria 3449
278 Ga0466967_0280857 3300045976 Bacteria 1598
279 Ga0466967_0287944 3300045976 Bacteria 1577
280 Ga0495592_0442770 3300046454 Bacteria 815
281 Ga0495606_0235854 3300046507 Bacteria 1022
282 Ga0495610_0039792 3300046512 Bacteria 2374
283 Ga0495616_0002023 3300046513 Bacteria 13637
284 Ga0495637_0081806 3300046520 Bacteria 1286
285 Ga0495648_0004713 3300046524 Bacteria 11557
286 Ga0495648_0125866 3300046524 Bacteria 1370
287 Ga0495654_0070815 3300046530 Bacteria 1653
288 Ga0495633_0013121 3300046558 Bacteria 4379
289 Ga0495668_0053940 3300046616 Bacteria 2222
290 Ga0495611_0074190 3300046648 Bacteria 1558
291 Ga0495672_0003710 3300047320 Bacteria 12885
292 Ga0495672_0140530 3300047320 Bacteria 1262
293 Ga0495676_0004193 3300047321 Bacteria 13167
294 Ga0495676_0101897 3300047321 Bacteria 2122
295 Ga0495673_0018590 3300047469 Bacteria 3499
296 Ga0496100_0002259 3300048903 Bacteria 9734
297 Ga0496101_0002865 3300048904 Bacteria 10603
298 Ga0496101_0083999 3300048904 Bacteria 2357
299 Ga0496102_0000197 3300048905 Bacteria 81788
300 Ga0496103_0000567 3300048906 Bacteria 29330
301 Ga0496104_0007503 3300048907 Bacteria 9645
302 Ga0496105_0001822 3300048908 Bacteria 15267
303 Ga0496106_0002657 3300048909 Bacteria 13303
304 Ga0496107_0007236 3300048910 Bacteria 7647
305 Ga0496107_0036714 3300048910 Bacteria 3515
306 Ga0496107_1289381 3300048910 Bacteria 523
307 Ga0496108_0052549 3300048911 Bacteria 3415
308 Ga0496108_0349766 3300048911 Unclassified 1290
309 Ga0496109_0008620 3300048912 Bacteria 8681
310 Ga0496109_0454783 3300048912 Bacteria 1209
311 Ga0496109_0562024 3300048912 Bacteria 1076
312 Ga0496110_0049896 3300048913 Bacteria 3673
313 Ga0496112_1364067 3300048915 Bacteria 624
314 Ga0496113_0520733 3300048916 Bacteria 954
315 Ga0496114_0000312 3300048917 Bacteria 35518
316 Ga0496115_0000958 3300048918 Bacteria 20936
317 Ga0496116_0014596 3300048919 Bacteria 6262
318 Ga0496116_0232442 3300048919 Bacteria 934
319 Ga0496117_0000160 3300048920 Bacteria 141709
320 Ga0496118_0000391 3300048921 Bacteria 74169
321 Ga0496119_0095494 3300048922 Bacteria 1679
322 Ga0496121_0009366 3300048924 Bacteria 11279
323 Ga0496124_0091082 3300048927 Bacteria 2485
324 Ga0496125_0127219 3300048928 Bacteria 1802
325 Ga0496126_0003942 3300048929 Bacteria 18162
326 Ga0501032_0281258 3300049569 Bacteria 1077
327 Ga0501037_0112942 3300049573 Bacteria 1956
328 Ga0501041_0870933 3300049577 Bacteria 578
329 Ga0501048_0189686 3300049582 Bacteria 1457
330 Ga0501073_0446635 3300049589 Bacteria 894
331 Ga0501074_0128004 3300049590 Bacteria 1817
332 Ga0501075_0374846 3300049591 Unclassified 1085
333 Ga0501076_0238412 3300049592 Bacteria 1488
334 Ga0501076_0722924 3300049592 Bacteria 822
335 Ga0501077_0248859 3300049593 Bacteria 1130
336 Ga0501077_0575793 3300049593 Bacteria 723
337 Ga0501223_000084 3300049663 Bacteria 28507
338 Ga0501225_0000044 3300049705 Bacteria 41695
339 Ga0501225_0011814 3300049705 Bacteria 2455
340 Ga0501079_1430912 3300049741 Bacteria 544
341 Ga0501081_0526146 3300049743 Unclassified 882
342 Ga0501081_0598233 3300049743 Bacteria 826
343 Ga0501081_1096280 3300049743 Bacteria 602
344 Ga0501083_0702654 3300049744 Bacteria 658
345 Ga0501044_0256035 3300049823 Bacteria 1690
346 Ga0501044_0834587 3300049823 Bacteria 799
347 Ga0501044_0895177 3300049823 Bacteria 763
348 Ga0501045_1354686 3300049824 Bacteria 517
349 nmdc:mga00v17_255546_c1 3300050491 Bacteria 1136
350 nmdc:mga05p37_863123_c1 3300050507 Bacteria 981
351 nmdc:mga0n895_1060959_c1 3300050512 Bacteria 789
352 Ga0495619_0018759 3300053085 Bacteria 4392
353 Ga0500643_000216 3300053087 Bacteria 54230
354 Ga0500646_0072397 3300053090 Bacteria 1036
355 Ga0500620_089817 3300053155 Bacteria 1070
356 Ga0530510_0252030 3300061734 Bacteria 1316
357 Ga0530510_1040223 3300061734 Bacteria 627

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10875563 Ga0114129_108755631 123
2 3300050507 nmdc:mga05p37_863123_c1 nmdc:mga05p37_863123_c1_46_435 123
3 3300032004 Ga0307414_10153525 Ga0307414_101535252 132
4 3300009098 Ga0105245_10137775 Ga0105245_101377754 135
5 3300009176 Ga0105242_10215079 Ga0105242_102150793 135
6 3300009177 Ga0105248_10145455 Ga0105248_101454554 135
7 3300009545 Ga0105237_10052631 Ga0105237_100526313 135
8 3300011119 Ga0105246_10388458 Ga0105246_103884582 135
9 3300013306 Ga0163162_10556240 Ga0163162_105562402 135
10 3300013307 Ga0157372_10866275 Ga0157372_108662752 135
11 3300013308 Ga0157375_10097994 Ga0157375_100979943 135
12 3300014745 Ga0157377_10387795 Ga0157377_103877952 135
13 3300014968 Ga0157379_10061020 Ga0157379_100610204 135
14 3300046513 Ga0495616_0002023 Ga0495616_0002023_7288_7794 136
15 3300005353 Ga0070669_100034317 Ga0070669_1000343174 137
16 3300005367 Ga0070667_100000142 Ga0070667_10000014291 137
17 3300005444 Ga0070694_100123810 Ga0070694_1001238102 137
18 3300005471 Ga0070698_100674495 Ga0070698_1006744951 137
19 3300005548 Ga0070665_100017201 Ga0070665_1000172014 137
20 3300005617 Ga0068859_100002067 Ga0068859_10000206712 137
21 3300005618 Ga0068864_100114460 Ga0068864_1001144604 137
22 3300005841 Ga0068863_100005764 Ga0068863_10000576412 137
23 3300005842 Ga0068858_100060394 Ga0068858_1000603944 137
24 3300005843 Ga0068860_100000160 Ga0068860_10000016015 137
25 3300005844 Ga0068862_100001362 Ga0068862_10000136215 137
26 3300006871 Ga0075434_101143099 Ga0075434_1011430992 137
27 3300006931 Ga0097620_100002067 Ga0097620_10000206712 137
28 3300009101 Ga0105247_10000078 Ga0105247_1000007815 137
29 3300009177 Ga0105248_10000082 Ga0105248_1000008215 137
30 3300009177 Ga0105248_10367990 Ga0105248_103679903 137
31 3300009553 Ga0105249_10000031 Ga0105249_10000031104 137
32 3300014325 Ga0163163_10104560 Ga0163163_101045603 137
33 3300025900 Ga0207710_10000022 Ga0207710_1000002261 137
34 3300025923 Ga0207681_10818242 Ga0207681_108182422 137
35 3300025941 Ga0207711_10000984 Ga0207711_1000098428 137
36 3300025941 Ga0207711_11061084 Ga0207711_110610842 137
37 3300025961 Ga0207712_10000029 Ga0207712_10000029104 137
38 3300025986 Ga0207658_10000113 Ga0207658_1000011388 137
39 3300026035 Ga0207703_10042840 Ga0207703_100428403 137
40 3300026088 Ga0207641_10003451 Ga0207641_1000345112 137
41 3300028379 Ga0268266_10010567 Ga0268266_100105673 137
42 3300028380 Ga0268265_10000040 Ga0268265_1000004087 137
43 3300028381 Ga0268264_10000017 Ga0268264_10000017266 137
44 3300046507 Ga0495606_0235854 Ga0495606_0235854_414_842 137
45 3300046524 Ga0495648_0004713 Ga0495648_0004713_8268_8696 137
46 3300046530 Ga0495654_0070815 Ga0495654_0070815_626_1054 137
47 3300046558 Ga0495633_0013121 Ga0495633_0013121_2754_3266 137
48 3300046616 Ga0495668_0053940 Ga0495668_0053940_102_530 137
49 3300047320 Ga0495672_0140530 Ga0495672_0140530_603_1031 137
50 3300047469 Ga0495673_0018590 Ga0495673_0018590_1542_1970 137
51 3300048903 Ga0496100_0002259 Ga0496100_0002259_3747_4178 137
52 3300048904 Ga0496101_0002865 Ga0496101_0002865_7406_7837 137
53 3300048905 Ga0496102_0000197 Ga0496102_0000197_55734_56165 137
54 3300048906 Ga0496103_0000567 Ga0496103_0000567_838_1269 137
55 3300048910 Ga0496107_0036714 Ga0496107_0036714_2694_3125 137
56 3300048910 Ga0496107_1289381 Ga0496107_1289381_60_488 137
57 3300048912 Ga0496109_0562024 Ga0496109_0562024_10_438 137
58 3300048919 Ga0496116_0014596 Ga0496116_0014596_3117_3548 137
59 3300048920 Ga0496117_0000160 Ga0496117_0000160_68403_68834 137
60 3300048921 Ga0496118_0000391 Ga0496118_0000391_25496_25927 137
61 3300048922 Ga0496119_0095494 Ga0496119_0095494_452_880 137
62 3300048924 Ga0496121_0009366 Ga0496121_0009366_5075_5506 137
63 3300048927 Ga0496124_0091082 Ga0496124_0091082_547_978 137
64 3300048928 Ga0496125_0127219 Ga0496125_0127219_1142_1573 137
65 3300048929 Ga0496126_0003942 Ga0496126_0003942_4987_5418 137
66 3300049592 Ga0501076_0238412 Ga0501076_0238412_947_1387 137
67 3300049593 Ga0501077_0248859 Ga0501077_0248859_443_883 137
68 3300049741 Ga0501079_1430912 Ga0501079_1430912_68_523 137
69 3300049743 Ga0501081_0526146 Ga0501081_0526146_388_828 137
70 3300049824 Ga0501045_1354686 Ga0501045_1354686_12_446 137
71 3300053090 Ga0500646_0072397 Ga0500646_0072397_295_723 137
72 3300053155 Ga0500620_089817 Ga0500620_089817_469_897 137
73 3300045051 Ga0451576_0463297 Ga0451576_0463297_526_963 139
74 3300047320 Ga0495672_0003710 Ga0495672_0003710_8645_9112 139
75 3300047321 Ga0495676_0101897 Ga0495676_0101897_65_502 139
76 3300049743 Ga0501081_0598233 Ga0501081_0598233_245_742 139
77 3300049743 Ga0501081_1096280 Ga0501081_1096280_21_473 139
78 3300061734 Ga0530510_1040223 Ga0530510_1040223_90_587 139
79 iso_pu_bacteria 2510065053 2510284794 145
80 iso_pu_bacteria 2510065055 2510295104 145
81 iso_pu_bacteria 2510065058 2510312172 145
82 iso_pu_bacteria 2600254954 2600443412 145
83 iso_pu_bacteria 2600255389 2602009133 145
84 iso_pu_bacteria 2823421272 2823425024 145
85 iso_pu_bacteria 2917832318 2917834221 145
86 iso_pu_bacteria 2919125081 2919127777 145
87 iso_pu_bacteria 2931396565 2931399422 145
88 iso_pu_bacteria 2974298342 2974298623 145
89 iso_pu_bacteria 2984499530 2984500868 145
90 iso_pu_bacteria 2984504281 2984505688 145
91 iso_pu_bacteria 3007252601 3007256026 145
92 iso_pu_bacteria 8034962539 8034962997 145
93 iso_pu_bacteria 8052494512 8052495527 145
94 iso_pu_bacteria 8056172158 8056176174 145
95 3300049582 Ga0501048_0189686 Ga0501048_0189686_701_1174 146
96 3300049593 Ga0501077_0575793 Ga0501077_0575793_98_589 146
97 3300005327 Ga0070658_11354617 Ga0070658_113546171 147
98 3300005336 Ga0070680_100020130 Ga0070680_1000201303 147
99 3300005367 Ga0070667_100140698 Ga0070667_1001406983 147
100 3300005530 Ga0070679_100130216 Ga0070679_1001302162 147
101 3300005563 Ga0068855_100100483 Ga0068855_1001004832 147
102 3300013104 Ga0157370_10000680 Ga0157370_1000068020 147
103 3300013105 Ga0157369_10026651 Ga0157369_100266513 147
104 3300013307 Ga0157372_10704233 Ga0157372_107042332 147
105 3300025929 Ga0207664_10077747 Ga0207664_100777473 147
106 3300037312 Ga0395899_0496597 Ga0395899_0496597_295_756 147
107 3300037466 Ga0395898_0617067 Ga0395898_0617067_126_587 147
108 3300037853 Ga0436364_0574645 Ga0436364_0574645_1312_1773 147
109 3300038443 Ga0395901_0443392 Ga0395901_0443392_827_1288 147
110 3300044650 Ga0466986_0095819 Ga0466986_0095819_1511_1987 147
111 3300049823 Ga0501044_0256035 Ga0501044_0256035_222_704 147
112 3300026078 Ga0207702_10173139 Ga0207702_101731392 148
113 3300003781 Ga0055536_1038527 Ga0055536_10385272 149
114 3300005338 Ga0068868_100113920 Ga0068868_1001139201 149
115 3300005340 Ga0070689_100619409 Ga0070689_1006194092 149
116 3300005459 Ga0068867_100023459 Ga0068867_1000234593 149
117 3300005841 Ga0068863_100116515 Ga0068863_1001165152 149
118 3300005842 Ga0068858_100006118 Ga0068858_10000611814 149
119 3300005843 Ga0068860_100114117 Ga0068860_1001141172 149
120 3300005844 Ga0068862_100475513 Ga0068862_1004755131 149
121 3300006881 Ga0068865_100273298 Ga0068865_1002732983 149
122 3300006944 Ga0099823_1000030 Ga0099823_10000303 149
123 3300013100 Ga0157373_10619749 Ga0157373_106197492 149
124 3300013102 Ga0157371_10011585 Ga0157371_100115856 149
125 3300013297 Ga0157378_10063161 Ga0157378_100631612 149
126 3300025292 Ga0209676_1001035 Ga0209676_10010354 149
127 3300025292 Ga0209676_1051830 Ga0209676_10518302 149
128 3300025728 Ga0207655_1001035 Ga0207655_100103523 149
129 3300025728 Ga0207655_1002809 Ga0207655_10028096 149
130 3300025735 Ga0207713_1024390 Ga0207713_10243902 149
131 3300025735 Ga0207713_1037789 Ga0207713_10377892 149
132 3300025904 Ga0207647_10001970 Ga0207647_1000197012 149
133 3300025914 Ga0207671_10268633 Ga0207671_102686332 149
134 3300025927 Ga0207687_10125926 Ga0207687_101259262 149
135 3300025936 Ga0207670_10185219 Ga0207670_101852193 149
136 3300025938 Ga0207704_11451955 Ga0207704_114519551 149
137 3300025941 Ga0207711_10655268 Ga0207711_106552682 149
138 3300026023 Ga0207677_10325967 Ga0207677_103259672 149
139 3300026035 Ga0207703_10003514 Ga0207703_100035145 149
140 3300026078 Ga0207702_10217185 Ga0207702_102171853 149
141 3300026088 Ga0207641_10013855 Ga0207641_100138556 149
142 3300027296 Ga0209389_1000002 Ga0209389_1000002109 149
143 3300027312 Ga0209371_1012891 Ga0209371_10128912 149
144 3300028380 Ga0268265_10449509 Ga0268265_104495092 149
145 3300028381 Ga0268264_10310654 Ga0268264_103106542 149
146 3300030500 Ga0268256_1014115 Ga0268256_10141152 149
147 3300032004 Ga0307414_10280019 Ga0307414_102800193 149
148 3300042439 Ga0439464_0003376 Ga0439464_0003376_38_556 149
149 3300045976 Ga0466967_0056944 Ga0466967_0056944_101_577 149
150 3300046520 Ga0495637_0081806 Ga0495637_0081806_732_1205 149
151 3300047321 Ga0495676_0004193 Ga0495676_0004193_2690_3163 149
152 iso_pu_bacteria 2821443989 2821447889 149
153 iso_pu_bacteria 2902837492 2902843041 149
154 3300005355 Ga0070671_100678996 Ga0070671_1006789962 150
155 3300005841 Ga0068863_100204992 Ga0068863_1002049922 150
156 3300005842 Ga0068858_100001528 Ga0068858_10000152810 150
157 3300006051 Ga0075364_10714516 Ga0075364_107145162 150
158 3300006844 Ga0075428_100000815 Ga0075428_10000081510 150
159 3300013306 Ga0163162_10087147 Ga0163162_100871472 150
160 3300013306 Ga0163162_10379232 Ga0163162_103792323 150
161 3300026035 Ga0207703_10000123 Ga0207703_1000012365 150
162 3300026088 Ga0207641_10207687 Ga0207641_102076872 150
163 3300039437 Ga0436365_0426365 Ga0436365_0426365_41_514 150
164 3300039450 Ga0436363_1379968 Ga0436363_1379968_1453_1920 150
165 3300046524 Ga0495648_0125866 Ga0495648_0125866_176_643 150
166 3300050491 nmdc:mga00v17_255546_c1 nmdc:mga00v17_255546_c1_25_495 150
167 3300050512 nmdc:mga0n895_1060959_c1 nmdc:mga0n895_1060959_c1_254_724 150
168 3300053087 Ga0500643_000216 Ga0500643_000216_14911_15384 150
169 iso_pu_bacteria 2844533157 2844540412 150
170 3300003792 Ga0055540_1017426 Ga0055540_10174263 151
171 3300005328 Ga0070676_10000855 Ga0070676_1000085515 151
172 3300005328 Ga0070676_10141209 Ga0070676_101412092 151
173 3300005331 Ga0070670_100013816 Ga0070670_1000138165 151
174 3300005334 Ga0068869_100000031 Ga0068869_10000003134 151
175 3300005335 Ga0070666_10305794 Ga0070666_103057941 151
176 3300005338 Ga0068868_100000060 Ga0068868_10000006029 151
177 3300005338 Ga0068868_100712243 Ga0068868_1007122432 151
178 3300005347 Ga0070668_101654684 Ga0070668_1016546841 151
179 3300005353 Ga0070669_100200104 Ga0070669_1002001042 151
180 3300005356 Ga0070674_100358806 Ga0070674_1003588062 151
181 3300005364 Ga0070673_100000009 Ga0070673_10000000929 151
182 3300005435 Ga0070714_100752414 Ga0070714_1007524142 151
183 3300005445 Ga0070708_100744150 Ga0070708_1007441502 151
184 3300005459 Ga0068867_100000165 Ga0068867_10000016510 151
185 3300005544 Ga0070686_101126167 Ga0070686_1011261672 151
186 3300005563 Ga0068855_100000371 Ga0068855_10000037129 151
187 3300005578 Ga0068854_100082323 Ga0068854_1000823232 151
188 3300005616 Ga0068852_101305828 Ga0068852_1013058282 151
189 3300005618 Ga0068864_100259442 Ga0068864_1002594422 151
190 3300006844 Ga0075428_100004847 Ga0075428_10000484715 151
191 3300006844 Ga0075428_101287929 Ga0075428_1012879292 151
192 3300006881 Ga0068865_100000014 Ga0068865_100000014114 151
193 3300009098 Ga0105245_10000160 Ga0105245_1000016037 151
194 3300009148 Ga0105243_10000070 Ga0105243_1000007093 151
195 3300009148 Ga0105243_10359700 Ga0105243_103597002 151
196 3300009176 Ga0105242_10000722 Ga0105242_1000072223 151
197 3300009176 Ga0105242_10720380 Ga0105242_107203802 151
198 3300009177 Ga0105248_12326517 Ga0105248_123265172 151
199 3300009553 Ga0105249_10037759 Ga0105249_100377593 151
200 3300009978 Ga0105148_100031 Ga0105148_1000315 151
201 3300011119 Ga0105246_10000434 Ga0105246_1000043410 151
202 3300013296 Ga0157374_10000542 Ga0157374_100005428 151
203 3300013297 Ga0157378_10000624 Ga0157378_100006248 151
204 3300013308 Ga0157375_10001639 Ga0157375_100016398 151
205 3300013308 Ga0157375_11075087 Ga0157375_110750871 151
206 3300014326 Ga0157380_10013963 Ga0157380_100139632 151
207 3300014745 Ga0157377_10029968 Ga0157377_100299682 151
208 3300014968 Ga0157379_10633858 Ga0157379_106338582 151
209 3300014969 Ga0157376_10000096 Ga0157376_1000009629 151
210 3300014969 Ga0157376_11684676 Ga0157376_116846761 151
211 3300025907 Ga0207645_10002952 Ga0207645_1000295211 151
212 3300025917 Ga0207660_10354678 Ga0207660_103546782 151
213 3300025922 Ga0207646_10756820 Ga0207646_107568202 151
214 3300025923 Ga0207681_10295039 Ga0207681_102950392 151
215 3300025925 Ga0207650_10015123 Ga0207650_100151236 151
216 3300025929 Ga0207664_10339727 Ga0207664_103397272 151
217 3300025934 Ga0207686_10000489 Ga0207686_1000048923 151
218 3300025935 Ga0207709_10000066 Ga0207709_100000667 151
219 3300025935 Ga0207709_10237366 Ga0207709_102373662 151
220 3300025937 Ga0207669_10280089 Ga0207669_102800892 151
221 3300025938 Ga0207704_10000002 Ga0207704_10000002191 151
222 3300025938 Ga0207704_10000007 Ga0207704_10000007191 151
223 3300025942 Ga0207689_10000060 Ga0207689_1000006058 151
224 3300025949 Ga0207667_10000017 Ga0207667_10000017317 151
225 3300025960 Ga0207651_10000004 Ga0207651_10000004260 151
226 3300025961 Ga0207712_10006048 Ga0207712_100060485 151
227 3300025972 Ga0207668_11189722 Ga0207668_111897222 151
228 3300025981 Ga0207640_10163689 Ga0207640_101636892 151
229 3300026023 Ga0207677_10000231 Ga0207677_1000023141 151
230 3300026035 Ga0207703_10806090 Ga0207703_108060902 151
231 3300026041 Ga0207639_10006160 Ga0207639_100061606 151
232 3300026088 Ga0207641_10391273 Ga0207641_103912732 151
233 3300026089 Ga0207648_10000003 Ga0207648_1000000329 151
234 3300026095 Ga0207676_10070176 Ga0207676_100701763 151
235 3300026142 Ga0207698_10361360 Ga0207698_103613602 151
236 3300028800 Ga0265338_10589050 Ga0265338_105890502 151
237 3300031548 Ga0307408_100000020 Ga0307408_10000002063 151
238 3300031727 Ga0316576_10000003 Ga0316576_1000000353 151
239 3300031728 Ga0316578_10043086 Ga0316578_100430862 151
240 3300037853 Ga0436364_0936821 Ga0436364_0936821_150_623 151
241 3300037853 Ga0436364_1123088 Ga0436364_1123088_49_525 151
242 3300039438 Ga0436360_0189330 Ga0436360_0189330_51_527 151
243 3300041410 Ga0439461_0059605 Ga0439461_0059605_183_728 151
244 3300041451 Ga0451791_1862452 Ga0451791_1862452_451_927 151
245 3300041452 Ga0451793_1172650 Ga0451793_1172650_468_938 151
246 3300041501 Ga0451845_0117564 Ga0451845_0117564_303_773 151
247 3300042156 Ga0439446_0003711 Ga0439446_0003711_3108_3653 151
248 3300042435 Ga0439434_0090929 Ga0439434_0090929_139_684 151
249 3300044684 Ga0466966_0816707 Ga0466966_0816707_35_517 151
250 3300046454 Ga0495592_0442770 Ga0495592_0442770_234_710 151
251 3300046648 Ga0495611_0074190 Ga0495611_0074190_910_1392 151
252 3300048904 Ga0496101_0083999 Ga0496101_0083999_1671_2147 151
253 3300048907 Ga0496104_0007503 Ga0496104_0007503_4909_5385 151
254 3300048908 Ga0496105_0001822 Ga0496105_0001822_11575_12051 151
255 3300048909 Ga0496106_0002657 Ga0496106_0002657_12113_12589 151
256 3300048910 Ga0496107_0007236 Ga0496107_0007236_7084_7560 151
257 3300048911 Ga0496108_0052549 Ga0496108_0052549_594_1067 151
258 3300048911 Ga0496108_0349766 Ga0496108_0349766_788_1267 151
259 3300048912 Ga0496109_0454783 Ga0496109_0454783_464_934 151
260 3300048913 Ga0496110_0049896 Ga0496110_0049896_291_761 151
261 3300048916 Ga0496113_0520733 Ga0496113_0520733_466_936 151
262 3300048917 Ga0496114_0000312 Ga0496114_0000312_16414_16890 151
263 3300048918 Ga0496115_0000958 Ga0496115_0000958_20398_20874 151
264 3300048919 Ga0496116_0232442 Ga0496116_0232442_386_856 151
265 3300049569 Ga0501032_0281258 Ga0501032_0281258_402_890 151
266 3300049577 Ga0501041_0870933 Ga0501041_0870933_41_532 151
267 3300049591 Ga0501075_0374846 Ga0501075_0374846_382_873 151
268 3300049592 Ga0501076_0722924 Ga0501076_0722924_52_540 151
269 3300049663 Ga0501223_000084 Ga0501223_000084_23602_24072 151
270 3300049705 Ga0501225_0000044 Ga0501225_0000044_19117_19587 151
271 3300049705 Ga0501225_0011814 Ga0501225_0011814_1839_2309 151
272 3300049823 Ga0501044_0895177 Ga0501044_0895177_129_623 151
273 3300053085 Ga0495619_0018759 Ga0495619_0018759_969_1445 151
274 3300061734 Ga0530510_0252030 Ga0530510_0252030_61_552 151
275 3300005539 Ga0068853_100607866 Ga0068853_1006078662 152
276 3300009545 Ga0105237_10457375 Ga0105237_104573752 152
277 3300021441 Ga0213871_10071423 Ga0213871_100714232 152
278 3300026041 Ga0207639_10469231 Ga0207639_104692312 152
279 3300039438 Ga0436360_1010877 Ga0436360_1010877_1597_2070 152
280 3300049744 Ga0501083_0702654 Ga0501083_0702654_60_539 152
281 iso_pu_bacteria 2932422444 2932422530 152
282 3300001915 JGI24741J21665_1016040 JGI24741J21665_10160402 153
283 3300001979 JGI24740J21852_10012950 JGI24740J21852_100129503 153
284 3300001989 JGI24739J22299_10058635 JGI24739J22299_100586351 153
285 3300002067 JGI24735J21928_10005786 JGI24735J21928_100057865 153
286 3300002075 JGI24738J21930_10034945 JGI24738J21930_100349452 153
287 3300002987 JGI25159J45721_1041222 JGI25159J45721_10412221 153
288 3300003187 JGI25151J46595_10000330 JGI25151J46595_1000033046 153
289 3300003187 JGI25151J46595_10000531 JGI25151J46595_1000053127 153
290 3300005327 Ga0070658_10052972 Ga0070658_100529722 153
291 3300005329 Ga0070683_100113743 Ga0070683_1001137432 153
292 3300005336 Ga0070680_100016789 Ga0070680_1000167895 153
293 3300005344 Ga0070661_100005232 Ga0070661_1000052325 153
294 3300005347 Ga0070668_100601083 Ga0070668_1006010831 153
295 3300005353 Ga0070669_100117575 Ga0070669_1001175753 153
296 3300005353 Ga0070669_100787498 Ga0070669_1007874982 153
297 3300005366 Ga0070659_100013699 Ga0070659_1000136992 153
298 3300005434 Ga0070709_10307602 Ga0070709_103076022 153
299 3300005437 Ga0070710_10551281 Ga0070710_105512812 153
300 3300005455 Ga0070663_100031007 Ga0070663_1000310072 153
301 3300005458 Ga0070681_10098554 Ga0070681_100985542 153
302 3300005458 Ga0070681_10304691 Ga0070681_103046911 153
303 3300005468 Ga0070707_100182488 Ga0070707_1001824882 153
304 3300005468 Ga0070707_100612673 Ga0070707_1006126732 153
305 3300005471 Ga0070698_100339046 Ga0070698_1003390461 153
306 3300005518 Ga0070699_100101989 Ga0070699_1001019892 153
307 3300005530 Ga0070679_100019300 Ga0070679_1000193006 153
308 3300005535 Ga0070684_101502638 Ga0070684_1015026381 153
309 3300005539 Ga0068853_100020735 Ga0068853_1000207353 153
310 3300005539 Ga0068853_100570843 Ga0068853_1005708432 153
311 3300005543 Ga0070672_100452413 Ga0070672_1004524133 153
312 3300005563 Ga0068855_100029826 Ga0068855_1000298268 153
313 3300005577 Ga0068857_100187763 Ga0068857_1001877633 153
314 3300005578 Ga0068854_100257885 Ga0068854_1002578852 153
315 3300005616 Ga0068852_100009398 Ga0068852_1000093988 153
316 3300005618 Ga0068864_101242682 Ga0068864_1012426822 153
317 3300009551 Ga0105238_10031321 Ga0105238_100313211 153
318 3300013100 Ga0157373_10107935 Ga0157373_101079353 153
319 3300013105 Ga0157369_10268908 Ga0157369_102689082 153
320 3300014325 Ga0163163_11334694 Ga0163163_113346942 153
321 3300025284 Ga0209130_1000771 Ga0209130_100077115 153
322 3300025294 Ga0209025_1000327 Ga0209025_100032754 153
323 3300025297 Ga0209758_1002694 Ga0209758_100269420 153
324 3300025302 Ga0207426_1000080 Ga0207426_1000080114 153
325 3300025898 Ga0207692_10428648 Ga0207692_104286482 153
326 3300025904 Ga0207647_10068302 Ga0207647_100683022 153
327 3300025909 Ga0207705_10003472 Ga0207705_100034725 153
328 3300025912 Ga0207707_10221387 Ga0207707_102213873 153
329 3300025912 Ga0207707_10287311 Ga0207707_102873112 153
330 3300025917 Ga0207660_10011899 Ga0207660_100118998 153
331 3300025919 Ga0207657_10015781 Ga0207657_100157818 153
332 3300025920 Ga0207649_10016372 Ga0207649_100163723 153
333 3300025920 Ga0207649_10518793 Ga0207649_105187932 153
334 3300025921 Ga0207652_10021398 Ga0207652_100213985 153
335 3300025922 Ga0207646_10249314 Ga0207646_102493142 153
336 3300025923 Ga0207681_10101376 Ga0207681_101013763 153
337 3300025923 Ga0207681_10325938 Ga0207681_103259382 153
338 3300025924 Ga0207694_10492025 Ga0207694_104920252 153
339 3300025932 Ga0207690_10233824 Ga0207690_102338242 153
340 3300025944 Ga0207661_10353358 Ga0207661_103533582 153
341 3300025949 Ga0207667_10066813 Ga0207667_100668132 153
342 3300025972 Ga0207668_10258027 Ga0207668_102580272 153
343 3300025981 Ga0207640_10241461 Ga0207640_102414612 153
344 3300026041 Ga0207639_10408736 Ga0207639_104087361 153
345 3300026041 Ga0207639_10745608 Ga0207639_107456082 153
346 3300026067 Ga0207678_10039513 Ga0207678_100395136 153
347 3300026078 Ga0207702_10034476 Ga0207702_100344763 153
348 3300026095 Ga0207676_11149662 Ga0207676_111496622 153
349 3300026116 Ga0207674_10480619 Ga0207674_104806192 153
350 3300026142 Ga0207698_10007002 Ga0207698_100070026 153
351 3300028794 Ga0307515_10000222 Ga0307515_10000222111 153
352 3300031250 Ga0265331_10025728 Ga0265331_100257283 153
353 3300031251 Ga0265327_10015600 Ga0265327_100156006 153
354 3300031456 Ga0307513_10003042 Ga0307513_1000304212 153
355 3300031649 Ga0307514_10000772 Ga0307514_1000077243 153
356 3300031727 Ga0316576_10370094 Ga0316576_103700942 153
357 3300031901 Ga0307406_10504085 Ga0307406_105040851 153
358 3300031911 Ga0307412_10209330 Ga0307412_102093302 153
359 3300033180 Ga0307510_10245693 Ga0307510_102456932 153
360 3300035398 Ga0316574_0320051 Ga0316574_0320051_17_505 153
361 3300035398 Ga0316574_0482515 Ga0316574_0482515_106_594 153
362 3300035691 Ga0373931_0064347 Ga0373931_0064347_1449_1925 153
363 3300037471 Ga0395905_0001436 Ga0395905_0001436_18240_18722 153
364 3300038443 Ga0395901_0077545 Ga0395901_0077545_2750_3259 153
365 3300038443 Ga0395901_0275921 Ga0395901_0275921_1183_1677 153
366 3300041997 Ga0439431_0040638 Ga0439431_0040638_505_987 153
367 3300042146 Ga0450907_019272 Ga0450907_019272_456_938 153
368 3300045976 Ga0466967_0033277 Ga0466967_0033277_394_870 153
369 3300045976 Ga0466967_0280857 Ga0466967_0280857_650_1144 153
370 3300045976 Ga0466967_0287944 Ga0466967_0287944_195_671 153
371 3300046512 Ga0495610_0039792 Ga0495610_0039792_854_1336 153
372 3300048912 Ga0496109_0008620 Ga0496109_0008620_2520_3131 153
373 3300048915 Ga0496112_1364067 Ga0496112_1364067_40_516 153
374 3300049573 Ga0501037_0112942 Ga0501037_0112942_11_532 153
375 3300049589 Ga0501073_0446635 Ga0501073_0446635_45_521 153
376 3300049590 Ga0501074_0128004 Ga0501074_0128004_424_900 153
377 3300049823 Ga0501044_0834587 Ga0501044_0834587_60_554 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

46

180

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.9542 11 143
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.9504 5 146
3jqj-assembly1.cif.gz_B crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 0.9491 11 152
3jqk-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) 0.9327 12 152
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9268 15 152
ID Description Score Start End Superfamily
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9644 3 153 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9542 11 143 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9461 3 153 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.94 2 153 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9282 2 153 3.30.70.640
ID Description Score Start End GO Terms
AF-C9RCT0-F1-model_v4 Molybdenum cofactor biosynthesis protein C 0.9735 11 152 GO:0006777
GO:0061799
AF-A0A535QPK6-F1-model_v4 Multifunctional fusion protein [Includes: DNA polymerase IV (Pol IV) (EC 2.7.7.7); Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C)] 0.9702 1 153 GO:0000287
GO:0003684
GO:0003887
GO:0005829
GO:0006261
GO:0006777
GO:0009432
GO:0042276
GO:0061799
AF-A0A059FIL4-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9691 15 151 GO:0006777
GO:0061798
GO:0061799
AF-A0A1F3CXQ4-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9686 14 152 GO:0006777
GO:0061799
AF-A0A847PBA7-F1-model_v4 Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C) 0.9682 4 153 GO:0005525
GO:0006777
GO:0061799

Feature Viewer

pLDDT pTM Quality
91.71 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map