F427714
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 377 | 256 | 357 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_10354678|Ga0207660_103546782 |
| Length | 189 |
| Sequence | MLGRFILVTSALFLPLTGSVFLSVSNPRDNTMSQLSHFDESGASRMVDVGGKAETERIARASAVVRMQPETLALIRDRKLSKGDVVEVARLAGIMAAKKTADLIPLCHPLPLTSVTLDFAFADPDCLRIEATAKLFGRTGVEMEALTAVSVAALTVYDMCKAADRGMTIEQVRLEEKSGGKSGHWQNAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 2 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 3 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 4 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 5 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 6 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 7 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 8 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 9 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 10 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 11 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 12 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 13 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 14 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 15 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 16 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 17 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 18 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 181 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 182 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 185 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 186 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 187 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 188 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 189 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 190 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 210 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 251 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 252 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 254 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 255 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 256 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.69 |
| Metatranscriptomes | 0 |
| Isolates | 5.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.53 |
| Bulb | 0 |
| Endosphere | 4.24 |
| Nodule | 0.53 |
| Rhizoplane | 6.9 |
| Rhizosphere | 80.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1016040 | 3300001915 | Bacteria | 1228 |
| 2 | JGI24740J21852_10012950 | 3300001979 | Bacteria | 3130 |
| 3 | JGI24739J22299_10058635 | 3300001989 | Bacteria | 1222 |
| 4 | JGI24735J21928_10005786 | 3300002067 | Bacteria | 4090 |
| 5 | JGI24738J21930_10034945 | 3300002075 | Bacteria | 1024 |
| 6 | JGI25159J45721_1041222 | 3300002987 | Bacteria | 673 |
| 7 | JGI25151J46595_10000330 | 3300003187 | Bacteria | 51252 |
| 8 | JGI25151J46595_10000531 | 3300003187 | Bacteria | 35418 |
| 9 | Ga0055536_1038527 | 3300003781 | Bacteria | 1157 |
| 10 | Ga0055540_1017426 | 3300003792 | Bacteria | 2006 |
| 11 | Ga0070658_10052972 | 3300005327 | Bacteria | 3292 |
| 12 | Ga0070658_11354617 | 3300005327 | Bacteria | 618 |
| 13 | Ga0070676_10000855 | 3300005328 | Bacteria | 15051 |
| 14 | Ga0070676_10141209 | 3300005328 | Bacteria | 1533 |
| 15 | Ga0070683_100113743 | 3300005329 | Bacteria | 2554 |
| 16 | Ga0070670_100013816 | 3300005331 | Bacteria | 6922 |
| 17 | Ga0068869_100000031 | 3300005334 | Bacteria | 60884 |
| 18 | Ga0070666_10305794 | 3300005335 | Bacteria | 1133 |
| 19 | Ga0070680_100016789 | 3300005336 | Bacteria | 5760 |
| 20 | Ga0070680_100020130 | 3300005336 | Bacteria | 5293 |
| 21 | Ga0068868_100000060 | 3300005338 | Bacteria | 61952 |
| 22 | Ga0068868_100113920 | 3300005338 | Unclassified | 2199 |
| 23 | Ga0068868_100712243 | 3300005338 | Bacteria | 899 |
| 24 | Ga0070689_100619409 | 3300005340 | Bacteria | 939 |
| 25 | Ga0070661_100005232 | 3300005344 | Bacteria | 8935 |
| 26 | Ga0070668_100601083 | 3300005347 | Bacteria | 962 |
| 27 | Ga0070668_101654684 | 3300005347 | Bacteria | 587 |
| 28 | Ga0070669_100034317 | 3300005353 | Bacteria | 3673 |
| 29 | Ga0070669_100117575 | 3300005353 | Bacteria | 2024 |
| 30 | Ga0070669_100200104 | 3300005353 | Bacteria | 1571 |
| 31 | Ga0070669_100787498 | 3300005353 | Bacteria | 808 |
| 32 | Ga0070671_100678996 | 3300005355 | Bacteria | 893 |
| 33 | Ga0070674_100358806 | 3300005356 | Bacteria | 1179 |
| 34 | Ga0070673_100000009 | 3300005364 | Bacteria | 155005 |
| 35 | Ga0070659_100013699 | 3300005366 | Bacteria | 6044 |
| 36 | Ga0070667_100000142 | 3300005367 | Bacteria | 90696 |
| 37 | Ga0070667_100140698 | 3300005367 | Bacteria | 2113 |
| 38 | Ga0070709_10307602 | 3300005434 | Bacteria | 1159 |
| 39 | Ga0070714_100752414 | 3300005435 | Bacteria | 942 |
| 40 | Ga0070710_10551281 | 3300005437 | Bacteria | 796 |
| 41 | Ga0070694_100123810 | 3300005444 | Bacteria | 1859 |
| 42 | Ga0070708_100744150 | 3300005445 | Bacteria | 922 |
| 43 | Ga0070663_100031007 | 3300005455 | Bacteria | 3670 |
| 44 | Ga0070681_10098554 | 3300005458 | Bacteria | 2869 |
| 45 | Ga0070681_10304691 | 3300005458 | Bacteria | 1503 |
| 46 | Ga0068867_100000165 | 3300005459 | Bacteria | 42939 |
| 47 | Ga0068867_100023459 | 3300005459 | Bacteria | 4416 |
| 48 | Ga0070707_100182488 | 3300005468 | Bacteria | 2046 |
| 49 | Ga0070707_100612673 | 3300005468 | Bacteria | 1051 |
| 50 | Ga0070698_100339046 | 3300005471 | Bacteria | 1435 |
| 51 | Ga0070698_100674495 | 3300005471 | Bacteria | 975 |
| 52 | Ga0070699_100101989 | 3300005518 | Bacteria | 2516 |
| 53 | Ga0070679_100019300 | 3300005530 | Bacteria | 6625 |
| 54 | Ga0070679_100130216 | 3300005530 | Bacteria | 2497 |
| 55 | Ga0070684_101502638 | 3300005535 | Bacteria | 635 |
| 56 | Ga0068853_100020735 | 3300005539 | Bacteria | 5466 |
| 57 | Ga0068853_100570843 | 3300005539 | Bacteria | 1073 |
| 58 | Ga0068853_100607866 | 3300005539 | Bacteria | 1039 |
| 59 | Ga0070672_100452413 | 3300005543 | Bacteria | 1106 |
| 60 | Ga0070686_101126167 | 3300005544 | Bacteria | 649 |
| 61 | Ga0070665_100017201 | 3300005548 | Bacteria | 7255 |
| 62 | Ga0068855_100000371 | 3300005563 | Bacteria | 55533 |
| 63 | Ga0068855_100029826 | 3300005563 | Bacteria | 6522 |
| 64 | Ga0068855_100100483 | 3300005563 | Bacteria | 3330 |
| 65 | Ga0068857_100187763 | 3300005577 | Bacteria | 1882 |
| 66 | Ga0068854_100082323 | 3300005578 | Bacteria | 2379 |
| 67 | Ga0068854_100257885 | 3300005578 | Bacteria | 1395 |
| 68 | Ga0068852_100009398 | 3300005616 | Bacteria | 7261 |
| 69 | Ga0068852_101305828 | 3300005616 | Bacteria | 747 |
| 70 | Ga0068859_100002067 | 3300005617 | Bacteria | 20487 |
| 71 | Ga0068864_100114460 | 3300005618 | Bacteria | 2405 |
| 72 | Ga0068864_100259442 | 3300005618 | Bacteria | 1616 |
| 73 | Ga0068864_101242682 | 3300005618 | Bacteria | 744 |
| 74 | Ga0068863_100005764 | 3300005841 | Bacteria | 12154 |
| 75 | Ga0068863_100116515 | 3300005841 | Unclassified | 2546 |
| 76 | Ga0068863_100204992 | 3300005841 | Bacteria | 1898 |
| 77 | Ga0068858_100001528 | 3300005842 | Bacteria | 23768 |
| 78 | Ga0068858_100006118 | 3300005842 | Bacteria | 11739 |
| 79 | Ga0068858_100060394 | 3300005842 | Bacteria | 3504 |
| 80 | Ga0068860_100000160 | 3300005843 | Bacteria | 110266 |
| 81 | Ga0068860_100114117 | 3300005843 | Unclassified | 2583 |
| 82 | Ga0068862_100001362 | 3300005844 | Bacteria | 22694 |
| 83 | Ga0068862_100475513 | 3300005844 | Bacteria | 1182 |
| 84 | Ga0075364_10714516 | 3300006051 | Bacteria | 684 |
| 85 | Ga0075428_100000815 | 3300006844 | Bacteria | 32626 |
| 86 | Ga0075428_100004847 | 3300006844 | Bacteria | 14927 |
| 87 | Ga0075428_101287929 | 3300006844 | Bacteria | 769 |
| 88 | Ga0075434_101143099 | 3300006871 | Bacteria | 791 |
| 89 | Ga0068865_100000014 | 3300006881 | Bacteria | 138727 |
| 90 | Ga0068865_100273298 | 3300006881 | Bacteria | 1342 |
| 91 | Ga0097620_100002067 | 3300006931 | Bacteria | 20487 |
| 92 | Ga0099823_1000030 | 3300006944 | Bacteria | 69064 |
| 93 | Ga0105245_10000160 | 3300009098 | Bacteria | 63445 |
| 94 | Ga0105245_10137775 | 3300009098 | Bacteria | 2295 |
| 95 | Ga0105247_10000078 | 3300009101 | Bacteria | 110404 |
| 96 | Ga0114129_10875563 | 3300009147 | Bacteria | 1140 |
| 97 | Ga0105243_10000070 | 3300009148 | Bacteria | 120851 |
| 98 | Ga0105243_10359700 | 3300009148 | Bacteria | 1339 |
| 99 | Ga0105242_10000722 | 3300009176 | Bacteria | 25846 |
| 100 | Ga0105242_10215079 | 3300009176 | Bacteria | 1715 |
| 101 | Ga0105242_10720380 | 3300009176 | Bacteria | 978 |
| 102 | Ga0105248_10000082 | 3300009177 | Bacteria | 110759 |
| 103 | Ga0105248_10145455 | 3300009177 | Bacteria | 2675 |
| 104 | Ga0105248_10367990 | 3300009177 | Bacteria | 1618 |
| 105 | Ga0105248_12326517 | 3300009177 | Bacteria | 610 |
| 106 | Ga0105237_10052631 | 3300009545 | Bacteria | 4086 |
| 107 | Ga0105237_10457375 | 3300009545 | Bacteria | 1282 |
| 108 | Ga0105238_10031321 | 3300009551 | Bacteria | 5413 |
| 109 | Ga0105249_10000031 | 3300009553 | Bacteria | 220006 |
| 110 | Ga0105249_10037759 | 3300009553 | Bacteria | 4383 |
| 111 | Ga0105148_100031 | 3300009978 | Bacteria | 20228 |
| 112 | Ga0105246_10000434 | 3300011119 | Bacteria | 22337 |
| 113 | Ga0105246_10388458 | 3300011119 | Bacteria | 1155 |
| 114 | Ga0157373_10107935 | 3300013100 | Bacteria | 1957 |
| 115 | Ga0157373_10619749 | 3300013100 | Bacteria | 788 |
| 116 | Ga0157371_10011585 | 3300013102 | Bacteria | 6778 |
| 117 | Ga0157370_10000680 | 3300013104 | Bacteria | 42288 |
| 118 | Ga0157369_10026651 | 3300013105 | Bacteria | 6409 |
| 119 | Ga0157369_10268908 | 3300013105 | Bacteria | 1777 |
| 120 | Ga0157374_10000542 | 3300013296 | Bacteria | 33699 |
| 121 | Ga0157378_10000624 | 3300013297 | Bacteria | 33307 |
| 122 | Ga0157378_10063161 | 3300013297 | Bacteria | 3308 |
| 123 | Ga0163162_10087147 | 3300013306 | Bacteria | 3200 |
| 124 | Ga0163162_10379232 | 3300013306 | Bacteria | 1547 |
| 125 | Ga0163162_10556240 | 3300013306 | Bacteria | 1275 |
| 126 | Ga0157372_10704233 | 3300013307 | Bacteria | 1175 |
| 127 | Ga0157372_10866275 | 3300013307 | Bacteria | 1048 |
| 128 | Ga0157375_10001639 | 3300013308 | Bacteria | 19250 |
| 129 | Ga0157375_10097994 | 3300013308 | Bacteria | 3007 |
| 130 | Ga0157375_11075087 | 3300013308 | Bacteria | 941 |
| 131 | Ga0163163_10104560 | 3300014325 | Bacteria | 2857 |
| 132 | Ga0163163_11334694 | 3300014325 | Bacteria | 779 |
| 133 | Ga0157380_10013963 | 3300014326 | Bacteria | 5864 |
| 134 | Ga0157377_10029968 | 3300014745 | Bacteria | 2943 |
| 135 | Ga0157377_10387795 | 3300014745 | Bacteria | 948 |
| 136 | Ga0157379_10061020 | 3300014968 | Unclassified | 3372 |
| 137 | Ga0157379_10633858 | 3300014968 | Bacteria | 1000 |
| 138 | Ga0157376_10000096 | 3300014969 | Bacteria | 65482 |
| 139 | Ga0157376_11684676 | 3300014969 | Bacteria | 669 |
| 140 | Ga0213871_10071423 | 3300021441 | Bacteria | 981 |
| 141 | Ga0209130_1000771 | 3300025284 | Bacteria | 27646 |
| 142 | Ga0209676_1001035 | 3300025292 | Bacteria | 32260 |
| 143 | Ga0209676_1051830 | 3300025292 | Bacteria | 1074 |
| 144 | Ga0209025_1000327 | 3300025294 | Bacteria | 106055 |
| 145 | Ga0209758_1002694 | 3300025297 | Bacteria | 17512 |
| 146 | Ga0207426_1000080 | 3300025302 | Bacteria | 304917 |
| 147 | Ga0207655_1001035 | 3300025728 | Bacteria | 28075 |
| 148 | Ga0207655_1002809 | 3300025728 | Bacteria | 13501 |
| 149 | Ga0207713_1024390 | 3300025735 | Bacteria | 2822 |
| 150 | Ga0207713_1037789 | 3300025735 | Bacteria | 2055 |
| 151 | Ga0207692_10428648 | 3300025898 | Bacteria | 829 |
| 152 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 153 | Ga0207647_10001970 | 3300025904 | Bacteria | 15680 |
| 154 | Ga0207647_10068302 | 3300025904 | Bacteria | 2152 |
| 155 | Ga0207645_10002952 | 3300025907 | Bacteria | 13131 |
| 156 | Ga0207705_10003472 | 3300025909 | Bacteria | 11988 |
| 157 | Ga0207707_10221387 | 3300025912 | Bacteria | 1647 |
| 158 | Ga0207707_10287311 | 3300025912 | Bacteria | 1423 |
| 159 | Ga0207671_10268633 | 3300025914 | Bacteria | 1343 |
| 160 | Ga0207660_10011899 | 3300025917 | Bacteria | 5676 |
| 161 | Ga0207660_10354678 | 3300025917 | Bacteria | 1176 |
| 162 | Ga0207657_10015781 | 3300025919 | Bacteria | 7300 |
| 163 | Ga0207649_10016372 | 3300025920 | Bacteria | 4179 |
| 164 | Ga0207649_10518793 | 3300025920 | Bacteria | 908 |
| 165 | Ga0207652_10021398 | 3300025921 | Bacteria | 5338 |
| 166 | Ga0207646_10249314 | 3300025922 | Bacteria | 1604 |
| 167 | Ga0207646_10756820 | 3300025922 | Bacteria | 867 |
| 168 | Ga0207681_10101376 | 3300025923 | Bacteria | 2077 |
| 169 | Ga0207681_10295039 | 3300025923 | Bacteria | 1281 |
| 170 | Ga0207681_10325938 | 3300025923 | Bacteria | 1223 |
| 171 | Ga0207681_10818242 | 3300025923 | Bacteria | 778 |
| 172 | Ga0207694_10492025 | 3300025924 | Bacteria | 1026 |
| 173 | Ga0207650_10015123 | 3300025925 | Bacteria | 5370 |
| 174 | Ga0207687_10125926 | 3300025927 | Bacteria | 1923 |
| 175 | Ga0207664_10077747 | 3300025929 | Bacteria | 2690 |
| 176 | Ga0207664_10339727 | 3300025929 | Bacteria | 1327 |
| 177 | Ga0207690_10233824 | 3300025932 | Bacteria | 1412 |
| 178 | Ga0207686_10000489 | 3300025934 | Bacteria | 26020 |
| 179 | Ga0207709_10000066 | 3300025935 | Bacteria | 189194 |
| 180 | Ga0207709_10237366 | 3300025935 | Bacteria | 1324 |
| 181 | Ga0207670_10185219 | 3300025936 | Bacteria | 1571 |
| 182 | Ga0207669_10280089 | 3300025937 | Bacteria | 1257 |
| 183 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 184 | Ga0207704_10000007 | 3300025938 | Bacteria | 211230 |
| 185 | Ga0207704_11451955 | 3300025938 | Bacteria | 588 |
| 186 | Ga0207711_10000984 | 3300025941 | Bacteria | 27321 |
| 187 | Ga0207711_10655268 | 3300025941 | Bacteria | 979 |
| 188 | Ga0207711_11061084 | 3300025941 | Bacteria | 750 |
| 189 | Ga0207689_10000060 | 3300025942 | Bacteria | 85326 |
| 190 | Ga0207661_10353358 | 3300025944 | Bacteria | 1326 |
| 191 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 192 | Ga0207667_10066813 | 3300025949 | Bacteria | 3747 |
| 193 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 194 | Ga0207712_10000029 | 3300025961 | Bacteria | 220014 |
| 195 | Ga0207712_10006048 | 3300025961 | Bacteria | 7634 |
| 196 | Ga0207668_10258027 | 3300025972 | Bacteria | 1419 |
| 197 | Ga0207668_11189722 | 3300025972 | Bacteria | 685 |
| 198 | Ga0207640_10163689 | 3300025981 | Bacteria | 1649 |
| 199 | Ga0207640_10241461 | 3300025981 | Bacteria | 1396 |
| 200 | Ga0207658_10000113 | 3300025986 | Bacteria | 88960 |
| 201 | Ga0207677_10000231 | 3300026023 | Bacteria | 43615 |
| 202 | Ga0207677_10325967 | 3300026023 | Unclassified | 1278 |
| 203 | Ga0207703_10000123 | 3300026035 | Bacteria | 92590 |
| 204 | Ga0207703_10003514 | 3300026035 | Bacteria | 13110 |
| 205 | Ga0207703_10042840 | 3300026035 | Bacteria | 3631 |
| 206 | Ga0207703_10806090 | 3300026035 | Bacteria | 896 |
| 207 | Ga0207639_10006160 | 3300026041 | Bacteria | 8142 |
| 208 | Ga0207639_10408736 | 3300026041 | Bacteria | 1224 |
| 209 | Ga0207639_10469231 | 3300026041 | Bacteria | 1145 |
| 210 | Ga0207639_10745608 | 3300026041 | Bacteria | 910 |
| 211 | Ga0207678_10039513 | 3300026067 | Bacteria | 4095 |
| 212 | Ga0207702_10034476 | 3300026078 | Bacteria | 4232 |
| 213 | Ga0207702_10173139 | 3300026078 | Unclassified | 1981 |
| 214 | Ga0207702_10217185 | 3300026078 | Bacteria | 1780 |
| 215 | Ga0207641_10003451 | 3300026088 | Bacteria | 13997 |
| 216 | Ga0207641_10013855 | 3300026088 | Bacteria | 6613 |
| 217 | Ga0207641_10207687 | 3300026088 | Bacteria | 1809 |
| 218 | Ga0207641_10391273 | 3300026088 | Bacteria | 1333 |
| 219 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 220 | Ga0207676_10070176 | 3300026095 | Bacteria | 2809 |
| 221 | Ga0207676_11149662 | 3300026095 | Bacteria | 768 |
| 222 | Ga0207674_10480619 | 3300026116 | Bacteria | 1201 |
| 223 | Ga0207698_10007002 | 3300026142 | Bacteria | 7060 |
| 224 | Ga0207698_10361360 | 3300026142 | Bacteria | 1375 |
| 225 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 226 | Ga0209371_1012891 | 3300027312 | Bacteria | 2387 |
| 227 | Ga0268266_10010567 | 3300028379 | Bacteria | 8056 |
| 228 | Ga0268265_10000040 | 3300028380 | Bacteria | 194156 |
| 229 | Ga0268265_10449509 | 3300028380 | Bacteria | 1203 |
| 230 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 231 | Ga0268264_10310654 | 3300028381 | Bacteria | 1487 |
| 232 | Ga0307515_10000222 | 3300028794 | Bacteria | 140902 |
| 233 | Ga0265338_10589050 | 3300028800 | Bacteria | 775 |
| 234 | Ga0268256_1014115 | 3300030500 | Bacteria | 2387 |
| 235 | Ga0265331_10025728 | 3300031250 | Bacteria | 2967 |
| 236 | Ga0265327_10015600 | 3300031251 | Bacteria | 4891 |
| 237 | Ga0307513_10003042 | 3300031456 | Bacteria | 22874 |
| 238 | Ga0307408_100000020 | 3300031548 | Bacteria | 340408 |
| 239 | Ga0307514_10000772 | 3300031649 | Bacteria | 53243 |
| 240 | Ga0316576_10000003 | 3300031727 | Bacteria | 66659 |
| 241 | Ga0316576_10370094 | 3300031727 | Unclassified | 1065 |
| 242 | Ga0316578_10043086 | 3300031728 | Bacteria | 2620 |
| 243 | Ga0307406_10504085 | 3300031901 | Bacteria | 982 |
| 244 | Ga0307412_10209330 | 3300031911 | Bacteria | 1487 |
| 245 | Ga0307414_10153525 | 3300032004 | Bacteria | 1820 |
| 246 | Ga0307414_10280019 | 3300032004 | Bacteria | 1401 |
| 247 | Ga0307510_10245693 | 3300033180 | Bacteria | 1281 |
| 248 | Ga0316574_0320051 | 3300035398 | Bacteria | 985 |
| 249 | Ga0316574_0482515 | 3300035398 | Bacteria | 774 |
| 250 | Ga0373931_0064347 | 3300035691 | Bacteria | 1985 |
| 251 | Ga0395899_0496597 | 3300037312 | Bacteria | 792 |
| 252 | Ga0395898_0617067 | 3300037466 | Bacteria | 1027 |
| 253 | Ga0395905_0001436 | 3300037471 | Bacteria | 28673 |
| 254 | Ga0436364_0574645 | 3300037853 | Bacteria | 2921 |
| 255 | Ga0436364_0936821 | 3300037853 | Bacteria | 991 |
| 256 | Ga0436364_1123088 | 3300037853 | Bacteria | 548 |
| 257 | Ga0395901_0077545 | 3300038443 | Bacteria | 3468 |
| 258 | Ga0395901_0275921 | 3300038443 | Bacteria | 1748 |
| 259 | Ga0395901_0443392 | 3300038443 | Bacteria | 1329 |
| 260 | Ga0436365_0426365 | 3300039437 | Bacteria | 527 |
| 261 | Ga0436360_0189330 | 3300039438 | Bacteria | 572 |
| 262 | Ga0436360_1010877 | 3300039438 | Bacteria | 3070 |
| 263 | Ga0436363_1379968 | 3300039450 | Bacteria | 2136 |
| 264 | Ga0439461_0059605 | 3300041410 | Bacteria | 864 |
| 265 | Ga0451791_1862452 | 3300041451 | Bacteria | 1132 |
| 266 | Ga0451793_1172650 | 3300041452 | Bacteria | 1189 |
| 267 | Ga0451845_0117564 | 3300041501 | Bacteria | 1098 |
| 268 | Ga0439431_0040638 | 3300041997 | Bacteria | 1183 |
| 269 | Ga0450907_019272 | 3300042146 | Bacteria | 1144 |
| 270 | Ga0439446_0003711 | 3300042156 | Bacteria | 3815 |
| 271 | Ga0439434_0090929 | 3300042435 | Bacteria | 976 |
| 272 | Ga0439464_0003376 | 3300042439 | Bacteria | 4023 |
| 273 | Ga0466986_0095819 | 3300044650 | Bacteria | 2049 |
| 274 | Ga0466966_0816707 | 3300044684 | Bacteria | 562 |
| 275 | Ga0451576_0463297 | 3300045051 | Bacteria | 1331 |
| 276 | Ga0466967_0033277 | 3300045976 | Bacteria | 4362 |
| 277 | Ga0466967_0056944 | 3300045976 | Bacteria | 3449 |
| 278 | Ga0466967_0280857 | 3300045976 | Bacteria | 1598 |
| 279 | Ga0466967_0287944 | 3300045976 | Bacteria | 1577 |
| 280 | Ga0495592_0442770 | 3300046454 | Bacteria | 815 |
| 281 | Ga0495606_0235854 | 3300046507 | Bacteria | 1022 |
| 282 | Ga0495610_0039792 | 3300046512 | Bacteria | 2374 |
| 283 | Ga0495616_0002023 | 3300046513 | Bacteria | 13637 |
| 284 | Ga0495637_0081806 | 3300046520 | Bacteria | 1286 |
| 285 | Ga0495648_0004713 | 3300046524 | Bacteria | 11557 |
| 286 | Ga0495648_0125866 | 3300046524 | Bacteria | 1370 |
| 287 | Ga0495654_0070815 | 3300046530 | Bacteria | 1653 |
| 288 | Ga0495633_0013121 | 3300046558 | Bacteria | 4379 |
| 289 | Ga0495668_0053940 | 3300046616 | Bacteria | 2222 |
| 290 | Ga0495611_0074190 | 3300046648 | Bacteria | 1558 |
| 291 | Ga0495672_0003710 | 3300047320 | Bacteria | 12885 |
| 292 | Ga0495672_0140530 | 3300047320 | Bacteria | 1262 |
| 293 | Ga0495676_0004193 | 3300047321 | Bacteria | 13167 |
| 294 | Ga0495676_0101897 | 3300047321 | Bacteria | 2122 |
| 295 | Ga0495673_0018590 | 3300047469 | Bacteria | 3499 |
| 296 | Ga0496100_0002259 | 3300048903 | Bacteria | 9734 |
| 297 | Ga0496101_0002865 | 3300048904 | Bacteria | 10603 |
| 298 | Ga0496101_0083999 | 3300048904 | Bacteria | 2357 |
| 299 | Ga0496102_0000197 | 3300048905 | Bacteria | 81788 |
| 300 | Ga0496103_0000567 | 3300048906 | Bacteria | 29330 |
| 301 | Ga0496104_0007503 | 3300048907 | Bacteria | 9645 |
| 302 | Ga0496105_0001822 | 3300048908 | Bacteria | 15267 |
| 303 | Ga0496106_0002657 | 3300048909 | Bacteria | 13303 |
| 304 | Ga0496107_0007236 | 3300048910 | Bacteria | 7647 |
| 305 | Ga0496107_0036714 | 3300048910 | Bacteria | 3515 |
| 306 | Ga0496107_1289381 | 3300048910 | Bacteria | 523 |
| 307 | Ga0496108_0052549 | 3300048911 | Bacteria | 3415 |
| 308 | Ga0496108_0349766 | 3300048911 | Unclassified | 1290 |
| 309 | Ga0496109_0008620 | 3300048912 | Bacteria | 8681 |
| 310 | Ga0496109_0454783 | 3300048912 | Bacteria | 1209 |
| 311 | Ga0496109_0562024 | 3300048912 | Bacteria | 1076 |
| 312 | Ga0496110_0049896 | 3300048913 | Bacteria | 3673 |
| 313 | Ga0496112_1364067 | 3300048915 | Bacteria | 624 |
| 314 | Ga0496113_0520733 | 3300048916 | Bacteria | 954 |
| 315 | Ga0496114_0000312 | 3300048917 | Bacteria | 35518 |
| 316 | Ga0496115_0000958 | 3300048918 | Bacteria | 20936 |
| 317 | Ga0496116_0014596 | 3300048919 | Bacteria | 6262 |
| 318 | Ga0496116_0232442 | 3300048919 | Bacteria | 934 |
| 319 | Ga0496117_0000160 | 3300048920 | Bacteria | 141709 |
| 320 | Ga0496118_0000391 | 3300048921 | Bacteria | 74169 |
| 321 | Ga0496119_0095494 | 3300048922 | Bacteria | 1679 |
| 322 | Ga0496121_0009366 | 3300048924 | Bacteria | 11279 |
| 323 | Ga0496124_0091082 | 3300048927 | Bacteria | 2485 |
| 324 | Ga0496125_0127219 | 3300048928 | Bacteria | 1802 |
| 325 | Ga0496126_0003942 | 3300048929 | Bacteria | 18162 |
| 326 | Ga0501032_0281258 | 3300049569 | Bacteria | 1077 |
| 327 | Ga0501037_0112942 | 3300049573 | Bacteria | 1956 |
| 328 | Ga0501041_0870933 | 3300049577 | Bacteria | 578 |
| 329 | Ga0501048_0189686 | 3300049582 | Bacteria | 1457 |
| 330 | Ga0501073_0446635 | 3300049589 | Bacteria | 894 |
| 331 | Ga0501074_0128004 | 3300049590 | Bacteria | 1817 |
| 332 | Ga0501075_0374846 | 3300049591 | Unclassified | 1085 |
| 333 | Ga0501076_0238412 | 3300049592 | Bacteria | 1488 |
| 334 | Ga0501076_0722924 | 3300049592 | Bacteria | 822 |
| 335 | Ga0501077_0248859 | 3300049593 | Bacteria | 1130 |
| 336 | Ga0501077_0575793 | 3300049593 | Bacteria | 723 |
| 337 | Ga0501223_000084 | 3300049663 | Bacteria | 28507 |
| 338 | Ga0501225_0000044 | 3300049705 | Bacteria | 41695 |
| 339 | Ga0501225_0011814 | 3300049705 | Bacteria | 2455 |
| 340 | Ga0501079_1430912 | 3300049741 | Bacteria | 544 |
| 341 | Ga0501081_0526146 | 3300049743 | Unclassified | 882 |
| 342 | Ga0501081_0598233 | 3300049743 | Bacteria | 826 |
| 343 | Ga0501081_1096280 | 3300049743 | Bacteria | 602 |
| 344 | Ga0501083_0702654 | 3300049744 | Bacteria | 658 |
| 345 | Ga0501044_0256035 | 3300049823 | Bacteria | 1690 |
| 346 | Ga0501044_0834587 | 3300049823 | Bacteria | 799 |
| 347 | Ga0501044_0895177 | 3300049823 | Bacteria | 763 |
| 348 | Ga0501045_1354686 | 3300049824 | Bacteria | 517 |
| 349 | nmdc:mga00v17_255546_c1 | 3300050491 | Bacteria | 1136 |
| 350 | nmdc:mga05p37_863123_c1 | 3300050507 | Bacteria | 981 |
| 351 | nmdc:mga0n895_1060959_c1 | 3300050512 | Bacteria | 789 |
| 352 | Ga0495619_0018759 | 3300053085 | Bacteria | 4392 |
| 353 | Ga0500643_000216 | 3300053087 | Bacteria | 54230 |
| 354 | Ga0500646_0072397 | 3300053090 | Bacteria | 1036 |
| 355 | Ga0500620_089817 | 3300053155 | Bacteria | 1070 |
| 356 | Ga0530510_0252030 | 3300061734 | Bacteria | 1316 |
| 357 | Ga0530510_1040223 | 3300061734 | Bacteria | 627 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10875563 | Ga0114129_108755631 | 123 |
| 2 | 3300050507 | nmdc:mga05p37_863123_c1 | nmdc:mga05p37_863123_c1_46_435 | 123 |
| 3 | 3300032004 | Ga0307414_10153525 | Ga0307414_101535252 | 132 |
| 4 | 3300009098 | Ga0105245_10137775 | Ga0105245_101377754 | 135 |
| 5 | 3300009176 | Ga0105242_10215079 | Ga0105242_102150793 | 135 |
| 6 | 3300009177 | Ga0105248_10145455 | Ga0105248_101454554 | 135 |
| 7 | 3300009545 | Ga0105237_10052631 | Ga0105237_100526313 | 135 |
| 8 | 3300011119 | Ga0105246_10388458 | Ga0105246_103884582 | 135 |
| 9 | 3300013306 | Ga0163162_10556240 | Ga0163162_105562402 | 135 |
| 10 | 3300013307 | Ga0157372_10866275 | Ga0157372_108662752 | 135 |
| 11 | 3300013308 | Ga0157375_10097994 | Ga0157375_100979943 | 135 |
| 12 | 3300014745 | Ga0157377_10387795 | Ga0157377_103877952 | 135 |
| 13 | 3300014968 | Ga0157379_10061020 | Ga0157379_100610204 | 135 |
| 14 | 3300046513 | Ga0495616_0002023 | Ga0495616_0002023_7288_7794 | 136 |
| 15 | 3300005353 | Ga0070669_100034317 | Ga0070669_1000343174 | 137 |
| 16 | 3300005367 | Ga0070667_100000142 | Ga0070667_10000014291 | 137 |
| 17 | 3300005444 | Ga0070694_100123810 | Ga0070694_1001238102 | 137 |
| 18 | 3300005471 | Ga0070698_100674495 | Ga0070698_1006744951 | 137 |
| 19 | 3300005548 | Ga0070665_100017201 | Ga0070665_1000172014 | 137 |
| 20 | 3300005617 | Ga0068859_100002067 | Ga0068859_10000206712 | 137 |
| 21 | 3300005618 | Ga0068864_100114460 | Ga0068864_1001144604 | 137 |
| 22 | 3300005841 | Ga0068863_100005764 | Ga0068863_10000576412 | 137 |
| 23 | 3300005842 | Ga0068858_100060394 | Ga0068858_1000603944 | 137 |
| 24 | 3300005843 | Ga0068860_100000160 | Ga0068860_10000016015 | 137 |
| 25 | 3300005844 | Ga0068862_100001362 | Ga0068862_10000136215 | 137 |
| 26 | 3300006871 | Ga0075434_101143099 | Ga0075434_1011430992 | 137 |
| 27 | 3300006931 | Ga0097620_100002067 | Ga0097620_10000206712 | 137 |
| 28 | 3300009101 | Ga0105247_10000078 | Ga0105247_1000007815 | 137 |
| 29 | 3300009177 | Ga0105248_10000082 | Ga0105248_1000008215 | 137 |
| 30 | 3300009177 | Ga0105248_10367990 | Ga0105248_103679903 | 137 |
| 31 | 3300009553 | Ga0105249_10000031 | Ga0105249_10000031104 | 137 |
| 32 | 3300014325 | Ga0163163_10104560 | Ga0163163_101045603 | 137 |
| 33 | 3300025900 | Ga0207710_10000022 | Ga0207710_1000002261 | 137 |
| 34 | 3300025923 | Ga0207681_10818242 | Ga0207681_108182422 | 137 |
| 35 | 3300025941 | Ga0207711_10000984 | Ga0207711_1000098428 | 137 |
| 36 | 3300025941 | Ga0207711_11061084 | Ga0207711_110610842 | 137 |
| 37 | 3300025961 | Ga0207712_10000029 | Ga0207712_10000029104 | 137 |
| 38 | 3300025986 | Ga0207658_10000113 | Ga0207658_1000011388 | 137 |
| 39 | 3300026035 | Ga0207703_10042840 | Ga0207703_100428403 | 137 |
| 40 | 3300026088 | Ga0207641_10003451 | Ga0207641_1000345112 | 137 |
| 41 | 3300028379 | Ga0268266_10010567 | Ga0268266_100105673 | 137 |
| 42 | 3300028380 | Ga0268265_10000040 | Ga0268265_1000004087 | 137 |
| 43 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017266 | 137 |
| 44 | 3300046507 | Ga0495606_0235854 | Ga0495606_0235854_414_842 | 137 |
| 45 | 3300046524 | Ga0495648_0004713 | Ga0495648_0004713_8268_8696 | 137 |
| 46 | 3300046530 | Ga0495654_0070815 | Ga0495654_0070815_626_1054 | 137 |
| 47 | 3300046558 | Ga0495633_0013121 | Ga0495633_0013121_2754_3266 | 137 |
| 48 | 3300046616 | Ga0495668_0053940 | Ga0495668_0053940_102_530 | 137 |
| 49 | 3300047320 | Ga0495672_0140530 | Ga0495672_0140530_603_1031 | 137 |
| 50 | 3300047469 | Ga0495673_0018590 | Ga0495673_0018590_1542_1970 | 137 |
| 51 | 3300048903 | Ga0496100_0002259 | Ga0496100_0002259_3747_4178 | 137 |
| 52 | 3300048904 | Ga0496101_0002865 | Ga0496101_0002865_7406_7837 | 137 |
| 53 | 3300048905 | Ga0496102_0000197 | Ga0496102_0000197_55734_56165 | 137 |
| 54 | 3300048906 | Ga0496103_0000567 | Ga0496103_0000567_838_1269 | 137 |
| 55 | 3300048910 | Ga0496107_0036714 | Ga0496107_0036714_2694_3125 | 137 |
| 56 | 3300048910 | Ga0496107_1289381 | Ga0496107_1289381_60_488 | 137 |
| 57 | 3300048912 | Ga0496109_0562024 | Ga0496109_0562024_10_438 | 137 |
| 58 | 3300048919 | Ga0496116_0014596 | Ga0496116_0014596_3117_3548 | 137 |
| 59 | 3300048920 | Ga0496117_0000160 | Ga0496117_0000160_68403_68834 | 137 |
| 60 | 3300048921 | Ga0496118_0000391 | Ga0496118_0000391_25496_25927 | 137 |
| 61 | 3300048922 | Ga0496119_0095494 | Ga0496119_0095494_452_880 | 137 |
| 62 | 3300048924 | Ga0496121_0009366 | Ga0496121_0009366_5075_5506 | 137 |
| 63 | 3300048927 | Ga0496124_0091082 | Ga0496124_0091082_547_978 | 137 |
| 64 | 3300048928 | Ga0496125_0127219 | Ga0496125_0127219_1142_1573 | 137 |
| 65 | 3300048929 | Ga0496126_0003942 | Ga0496126_0003942_4987_5418 | 137 |
| 66 | 3300049592 | Ga0501076_0238412 | Ga0501076_0238412_947_1387 | 137 |
| 67 | 3300049593 | Ga0501077_0248859 | Ga0501077_0248859_443_883 | 137 |
| 68 | 3300049741 | Ga0501079_1430912 | Ga0501079_1430912_68_523 | 137 |
| 69 | 3300049743 | Ga0501081_0526146 | Ga0501081_0526146_388_828 | 137 |
| 70 | 3300049824 | Ga0501045_1354686 | Ga0501045_1354686_12_446 | 137 |
| 71 | 3300053090 | Ga0500646_0072397 | Ga0500646_0072397_295_723 | 137 |
| 72 | 3300053155 | Ga0500620_089817 | Ga0500620_089817_469_897 | 137 |
| 73 | 3300045051 | Ga0451576_0463297 | Ga0451576_0463297_526_963 | 139 |
| 74 | 3300047320 | Ga0495672_0003710 | Ga0495672_0003710_8645_9112 | 139 |
| 75 | 3300047321 | Ga0495676_0101897 | Ga0495676_0101897_65_502 | 139 |
| 76 | 3300049743 | Ga0501081_0598233 | Ga0501081_0598233_245_742 | 139 |
| 77 | 3300049743 | Ga0501081_1096280 | Ga0501081_1096280_21_473 | 139 |
| 78 | 3300061734 | Ga0530510_1040223 | Ga0530510_1040223_90_587 | 139 |
| 79 | iso_pu_bacteria | 2510065053 | 2510284794 | 145 |
| 80 | iso_pu_bacteria | 2510065055 | 2510295104 | 145 |
| 81 | iso_pu_bacteria | 2510065058 | 2510312172 | 145 |
| 82 | iso_pu_bacteria | 2600254954 | 2600443412 | 145 |
| 83 | iso_pu_bacteria | 2600255389 | 2602009133 | 145 |
| 84 | iso_pu_bacteria | 2823421272 | 2823425024 | 145 |
| 85 | iso_pu_bacteria | 2917832318 | 2917834221 | 145 |
| 86 | iso_pu_bacteria | 2919125081 | 2919127777 | 145 |
| 87 | iso_pu_bacteria | 2931396565 | 2931399422 | 145 |
| 88 | iso_pu_bacteria | 2974298342 | 2974298623 | 145 |
| 89 | iso_pu_bacteria | 2984499530 | 2984500868 | 145 |
| 90 | iso_pu_bacteria | 2984504281 | 2984505688 | 145 |
| 91 | iso_pu_bacteria | 3007252601 | 3007256026 | 145 |
| 92 | iso_pu_bacteria | 8034962539 | 8034962997 | 145 |
| 93 | iso_pu_bacteria | 8052494512 | 8052495527 | 145 |
| 94 | iso_pu_bacteria | 8056172158 | 8056176174 | 145 |
| 95 | 3300049582 | Ga0501048_0189686 | Ga0501048_0189686_701_1174 | 146 |
| 96 | 3300049593 | Ga0501077_0575793 | Ga0501077_0575793_98_589 | 146 |
| 97 | 3300005327 | Ga0070658_11354617 | Ga0070658_113546171 | 147 |
| 98 | 3300005336 | Ga0070680_100020130 | Ga0070680_1000201303 | 147 |
| 99 | 3300005367 | Ga0070667_100140698 | Ga0070667_1001406983 | 147 |
| 100 | 3300005530 | Ga0070679_100130216 | Ga0070679_1001302162 | 147 |
| 101 | 3300005563 | Ga0068855_100100483 | Ga0068855_1001004832 | 147 |
| 102 | 3300013104 | Ga0157370_10000680 | Ga0157370_1000068020 | 147 |
| 103 | 3300013105 | Ga0157369_10026651 | Ga0157369_100266513 | 147 |
| 104 | 3300013307 | Ga0157372_10704233 | Ga0157372_107042332 | 147 |
| 105 | 3300025929 | Ga0207664_10077747 | Ga0207664_100777473 | 147 |
| 106 | 3300037312 | Ga0395899_0496597 | Ga0395899_0496597_295_756 | 147 |
| 107 | 3300037466 | Ga0395898_0617067 | Ga0395898_0617067_126_587 | 147 |
| 108 | 3300037853 | Ga0436364_0574645 | Ga0436364_0574645_1312_1773 | 147 |
| 109 | 3300038443 | Ga0395901_0443392 | Ga0395901_0443392_827_1288 | 147 |
| 110 | 3300044650 | Ga0466986_0095819 | Ga0466986_0095819_1511_1987 | 147 |
| 111 | 3300049823 | Ga0501044_0256035 | Ga0501044_0256035_222_704 | 147 |
| 112 | 3300026078 | Ga0207702_10173139 | Ga0207702_101731392 | 148 |
| 113 | 3300003781 | Ga0055536_1038527 | Ga0055536_10385272 | 149 |
| 114 | 3300005338 | Ga0068868_100113920 | Ga0068868_1001139201 | 149 |
| 115 | 3300005340 | Ga0070689_100619409 | Ga0070689_1006194092 | 149 |
| 116 | 3300005459 | Ga0068867_100023459 | Ga0068867_1000234593 | 149 |
| 117 | 3300005841 | Ga0068863_100116515 | Ga0068863_1001165152 | 149 |
| 118 | 3300005842 | Ga0068858_100006118 | Ga0068858_10000611814 | 149 |
| 119 | 3300005843 | Ga0068860_100114117 | Ga0068860_1001141172 | 149 |
| 120 | 3300005844 | Ga0068862_100475513 | Ga0068862_1004755131 | 149 |
| 121 | 3300006881 | Ga0068865_100273298 | Ga0068865_1002732983 | 149 |
| 122 | 3300006944 | Ga0099823_1000030 | Ga0099823_10000303 | 149 |
| 123 | 3300013100 | Ga0157373_10619749 | Ga0157373_106197492 | 149 |
| 124 | 3300013102 | Ga0157371_10011585 | Ga0157371_100115856 | 149 |
| 125 | 3300013297 | Ga0157378_10063161 | Ga0157378_100631612 | 149 |
| 126 | 3300025292 | Ga0209676_1001035 | Ga0209676_10010354 | 149 |
| 127 | 3300025292 | Ga0209676_1051830 | Ga0209676_10518302 | 149 |
| 128 | 3300025728 | Ga0207655_1001035 | Ga0207655_100103523 | 149 |
| 129 | 3300025728 | Ga0207655_1002809 | Ga0207655_10028096 | 149 |
| 130 | 3300025735 | Ga0207713_1024390 | Ga0207713_10243902 | 149 |
| 131 | 3300025735 | Ga0207713_1037789 | Ga0207713_10377892 | 149 |
| 132 | 3300025904 | Ga0207647_10001970 | Ga0207647_1000197012 | 149 |
| 133 | 3300025914 | Ga0207671_10268633 | Ga0207671_102686332 | 149 |
| 134 | 3300025927 | Ga0207687_10125926 | Ga0207687_101259262 | 149 |
| 135 | 3300025936 | Ga0207670_10185219 | Ga0207670_101852193 | 149 |
| 136 | 3300025938 | Ga0207704_11451955 | Ga0207704_114519551 | 149 |
| 137 | 3300025941 | Ga0207711_10655268 | Ga0207711_106552682 | 149 |
| 138 | 3300026023 | Ga0207677_10325967 | Ga0207677_103259672 | 149 |
| 139 | 3300026035 | Ga0207703_10003514 | Ga0207703_100035145 | 149 |
| 140 | 3300026078 | Ga0207702_10217185 | Ga0207702_102171853 | 149 |
| 141 | 3300026088 | Ga0207641_10013855 | Ga0207641_100138556 | 149 |
| 142 | 3300027296 | Ga0209389_1000002 | Ga0209389_1000002109 | 149 |
| 143 | 3300027312 | Ga0209371_1012891 | Ga0209371_10128912 | 149 |
| 144 | 3300028380 | Ga0268265_10449509 | Ga0268265_104495092 | 149 |
| 145 | 3300028381 | Ga0268264_10310654 | Ga0268264_103106542 | 149 |
| 146 | 3300030500 | Ga0268256_1014115 | Ga0268256_10141152 | 149 |
| 147 | 3300032004 | Ga0307414_10280019 | Ga0307414_102800193 | 149 |
| 148 | 3300042439 | Ga0439464_0003376 | Ga0439464_0003376_38_556 | 149 |
| 149 | 3300045976 | Ga0466967_0056944 | Ga0466967_0056944_101_577 | 149 |
| 150 | 3300046520 | Ga0495637_0081806 | Ga0495637_0081806_732_1205 | 149 |
| 151 | 3300047321 | Ga0495676_0004193 | Ga0495676_0004193_2690_3163 | 149 |
| 152 | iso_pu_bacteria | 2821443989 | 2821447889 | 149 |
| 153 | iso_pu_bacteria | 2902837492 | 2902843041 | 149 |
| 154 | 3300005355 | Ga0070671_100678996 | Ga0070671_1006789962 | 150 |
| 155 | 3300005841 | Ga0068863_100204992 | Ga0068863_1002049922 | 150 |
| 156 | 3300005842 | Ga0068858_100001528 | Ga0068858_10000152810 | 150 |
| 157 | 3300006051 | Ga0075364_10714516 | Ga0075364_107145162 | 150 |
| 158 | 3300006844 | Ga0075428_100000815 | Ga0075428_10000081510 | 150 |
| 159 | 3300013306 | Ga0163162_10087147 | Ga0163162_100871472 | 150 |
| 160 | 3300013306 | Ga0163162_10379232 | Ga0163162_103792323 | 150 |
| 161 | 3300026035 | Ga0207703_10000123 | Ga0207703_1000012365 | 150 |
| 162 | 3300026088 | Ga0207641_10207687 | Ga0207641_102076872 | 150 |
| 163 | 3300039437 | Ga0436365_0426365 | Ga0436365_0426365_41_514 | 150 |
| 164 | 3300039450 | Ga0436363_1379968 | Ga0436363_1379968_1453_1920 | 150 |
| 165 | 3300046524 | Ga0495648_0125866 | Ga0495648_0125866_176_643 | 150 |
| 166 | 3300050491 | nmdc:mga00v17_255546_c1 | nmdc:mga00v17_255546_c1_25_495 | 150 |
| 167 | 3300050512 | nmdc:mga0n895_1060959_c1 | nmdc:mga0n895_1060959_c1_254_724 | 150 |
| 168 | 3300053087 | Ga0500643_000216 | Ga0500643_000216_14911_15384 | 150 |
| 169 | iso_pu_bacteria | 2844533157 | 2844540412 | 150 |
| 170 | 3300003792 | Ga0055540_1017426 | Ga0055540_10174263 | 151 |
| 171 | 3300005328 | Ga0070676_10000855 | Ga0070676_1000085515 | 151 |
| 172 | 3300005328 | Ga0070676_10141209 | Ga0070676_101412092 | 151 |
| 173 | 3300005331 | Ga0070670_100013816 | Ga0070670_1000138165 | 151 |
| 174 | 3300005334 | Ga0068869_100000031 | Ga0068869_10000003134 | 151 |
| 175 | 3300005335 | Ga0070666_10305794 | Ga0070666_103057941 | 151 |
| 176 | 3300005338 | Ga0068868_100000060 | Ga0068868_10000006029 | 151 |
| 177 | 3300005338 | Ga0068868_100712243 | Ga0068868_1007122432 | 151 |
| 178 | 3300005347 | Ga0070668_101654684 | Ga0070668_1016546841 | 151 |
| 179 | 3300005353 | Ga0070669_100200104 | Ga0070669_1002001042 | 151 |
| 180 | 3300005356 | Ga0070674_100358806 | Ga0070674_1003588062 | 151 |
| 181 | 3300005364 | Ga0070673_100000009 | Ga0070673_10000000929 | 151 |
| 182 | 3300005435 | Ga0070714_100752414 | Ga0070714_1007524142 | 151 |
| 183 | 3300005445 | Ga0070708_100744150 | Ga0070708_1007441502 | 151 |
| 184 | 3300005459 | Ga0068867_100000165 | Ga0068867_10000016510 | 151 |
| 185 | 3300005544 | Ga0070686_101126167 | Ga0070686_1011261672 | 151 |
| 186 | 3300005563 | Ga0068855_100000371 | Ga0068855_10000037129 | 151 |
| 187 | 3300005578 | Ga0068854_100082323 | Ga0068854_1000823232 | 151 |
| 188 | 3300005616 | Ga0068852_101305828 | Ga0068852_1013058282 | 151 |
| 189 | 3300005618 | Ga0068864_100259442 | Ga0068864_1002594422 | 151 |
| 190 | 3300006844 | Ga0075428_100004847 | Ga0075428_10000484715 | 151 |
| 191 | 3300006844 | Ga0075428_101287929 | Ga0075428_1012879292 | 151 |
| 192 | 3300006881 | Ga0068865_100000014 | Ga0068865_100000014114 | 151 |
| 193 | 3300009098 | Ga0105245_10000160 | Ga0105245_1000016037 | 151 |
| 194 | 3300009148 | Ga0105243_10000070 | Ga0105243_1000007093 | 151 |
| 195 | 3300009148 | Ga0105243_10359700 | Ga0105243_103597002 | 151 |
| 196 | 3300009176 | Ga0105242_10000722 | Ga0105242_1000072223 | 151 |
| 197 | 3300009176 | Ga0105242_10720380 | Ga0105242_107203802 | 151 |
| 198 | 3300009177 | Ga0105248_12326517 | Ga0105248_123265172 | 151 |
| 199 | 3300009553 | Ga0105249_10037759 | Ga0105249_100377593 | 151 |
| 200 | 3300009978 | Ga0105148_100031 | Ga0105148_1000315 | 151 |
| 201 | 3300011119 | Ga0105246_10000434 | Ga0105246_1000043410 | 151 |
| 202 | 3300013296 | Ga0157374_10000542 | Ga0157374_100005428 | 151 |
| 203 | 3300013297 | Ga0157378_10000624 | Ga0157378_100006248 | 151 |
| 204 | 3300013308 | Ga0157375_10001639 | Ga0157375_100016398 | 151 |
| 205 | 3300013308 | Ga0157375_11075087 | Ga0157375_110750871 | 151 |
| 206 | 3300014326 | Ga0157380_10013963 | Ga0157380_100139632 | 151 |
| 207 | 3300014745 | Ga0157377_10029968 | Ga0157377_100299682 | 151 |
| 208 | 3300014968 | Ga0157379_10633858 | Ga0157379_106338582 | 151 |
| 209 | 3300014969 | Ga0157376_10000096 | Ga0157376_1000009629 | 151 |
| 210 | 3300014969 | Ga0157376_11684676 | Ga0157376_116846761 | 151 |
| 211 | 3300025907 | Ga0207645_10002952 | Ga0207645_1000295211 | 151 |
| 212 | 3300025917 | Ga0207660_10354678 | Ga0207660_103546782 | 151 |
| 213 | 3300025922 | Ga0207646_10756820 | Ga0207646_107568202 | 151 |
| 214 | 3300025923 | Ga0207681_10295039 | Ga0207681_102950392 | 151 |
| 215 | 3300025925 | Ga0207650_10015123 | Ga0207650_100151236 | 151 |
| 216 | 3300025929 | Ga0207664_10339727 | Ga0207664_103397272 | 151 |
| 217 | 3300025934 | Ga0207686_10000489 | Ga0207686_1000048923 | 151 |
| 218 | 3300025935 | Ga0207709_10000066 | Ga0207709_100000667 | 151 |
| 219 | 3300025935 | Ga0207709_10237366 | Ga0207709_102373662 | 151 |
| 220 | 3300025937 | Ga0207669_10280089 | Ga0207669_102800892 | 151 |
| 221 | 3300025938 | Ga0207704_10000002 | Ga0207704_10000002191 | 151 |
| 222 | 3300025938 | Ga0207704_10000007 | Ga0207704_10000007191 | 151 |
| 223 | 3300025942 | Ga0207689_10000060 | Ga0207689_1000006058 | 151 |
| 224 | 3300025949 | Ga0207667_10000017 | Ga0207667_10000017317 | 151 |
| 225 | 3300025960 | Ga0207651_10000004 | Ga0207651_10000004260 | 151 |
| 226 | 3300025961 | Ga0207712_10006048 | Ga0207712_100060485 | 151 |
| 227 | 3300025972 | Ga0207668_11189722 | Ga0207668_111897222 | 151 |
| 228 | 3300025981 | Ga0207640_10163689 | Ga0207640_101636892 | 151 |
| 229 | 3300026023 | Ga0207677_10000231 | Ga0207677_1000023141 | 151 |
| 230 | 3300026035 | Ga0207703_10806090 | Ga0207703_108060902 | 151 |
| 231 | 3300026041 | Ga0207639_10006160 | Ga0207639_100061606 | 151 |
| 232 | 3300026088 | Ga0207641_10391273 | Ga0207641_103912732 | 151 |
| 233 | 3300026089 | Ga0207648_10000003 | Ga0207648_1000000329 | 151 |
| 234 | 3300026095 | Ga0207676_10070176 | Ga0207676_100701763 | 151 |
| 235 | 3300026142 | Ga0207698_10361360 | Ga0207698_103613602 | 151 |
| 236 | 3300028800 | Ga0265338_10589050 | Ga0265338_105890502 | 151 |
| 237 | 3300031548 | Ga0307408_100000020 | Ga0307408_10000002063 | 151 |
| 238 | 3300031727 | Ga0316576_10000003 | Ga0316576_1000000353 | 151 |
| 239 | 3300031728 | Ga0316578_10043086 | Ga0316578_100430862 | 151 |
| 240 | 3300037853 | Ga0436364_0936821 | Ga0436364_0936821_150_623 | 151 |
| 241 | 3300037853 | Ga0436364_1123088 | Ga0436364_1123088_49_525 | 151 |
| 242 | 3300039438 | Ga0436360_0189330 | Ga0436360_0189330_51_527 | 151 |
| 243 | 3300041410 | Ga0439461_0059605 | Ga0439461_0059605_183_728 | 151 |
| 244 | 3300041451 | Ga0451791_1862452 | Ga0451791_1862452_451_927 | 151 |
| 245 | 3300041452 | Ga0451793_1172650 | Ga0451793_1172650_468_938 | 151 |
| 246 | 3300041501 | Ga0451845_0117564 | Ga0451845_0117564_303_773 | 151 |
| 247 | 3300042156 | Ga0439446_0003711 | Ga0439446_0003711_3108_3653 | 151 |
| 248 | 3300042435 | Ga0439434_0090929 | Ga0439434_0090929_139_684 | 151 |
| 249 | 3300044684 | Ga0466966_0816707 | Ga0466966_0816707_35_517 | 151 |
| 250 | 3300046454 | Ga0495592_0442770 | Ga0495592_0442770_234_710 | 151 |
| 251 | 3300046648 | Ga0495611_0074190 | Ga0495611_0074190_910_1392 | 151 |
| 252 | 3300048904 | Ga0496101_0083999 | Ga0496101_0083999_1671_2147 | 151 |
| 253 | 3300048907 | Ga0496104_0007503 | Ga0496104_0007503_4909_5385 | 151 |
| 254 | 3300048908 | Ga0496105_0001822 | Ga0496105_0001822_11575_12051 | 151 |
| 255 | 3300048909 | Ga0496106_0002657 | Ga0496106_0002657_12113_12589 | 151 |
| 256 | 3300048910 | Ga0496107_0007236 | Ga0496107_0007236_7084_7560 | 151 |
| 257 | 3300048911 | Ga0496108_0052549 | Ga0496108_0052549_594_1067 | 151 |
| 258 | 3300048911 | Ga0496108_0349766 | Ga0496108_0349766_788_1267 | 151 |
| 259 | 3300048912 | Ga0496109_0454783 | Ga0496109_0454783_464_934 | 151 |
| 260 | 3300048913 | Ga0496110_0049896 | Ga0496110_0049896_291_761 | 151 |
| 261 | 3300048916 | Ga0496113_0520733 | Ga0496113_0520733_466_936 | 151 |
| 262 | 3300048917 | Ga0496114_0000312 | Ga0496114_0000312_16414_16890 | 151 |
| 263 | 3300048918 | Ga0496115_0000958 | Ga0496115_0000958_20398_20874 | 151 |
| 264 | 3300048919 | Ga0496116_0232442 | Ga0496116_0232442_386_856 | 151 |
| 265 | 3300049569 | Ga0501032_0281258 | Ga0501032_0281258_402_890 | 151 |
| 266 | 3300049577 | Ga0501041_0870933 | Ga0501041_0870933_41_532 | 151 |
| 267 | 3300049591 | Ga0501075_0374846 | Ga0501075_0374846_382_873 | 151 |
| 268 | 3300049592 | Ga0501076_0722924 | Ga0501076_0722924_52_540 | 151 |
| 269 | 3300049663 | Ga0501223_000084 | Ga0501223_000084_23602_24072 | 151 |
| 270 | 3300049705 | Ga0501225_0000044 | Ga0501225_0000044_19117_19587 | 151 |
| 271 | 3300049705 | Ga0501225_0011814 | Ga0501225_0011814_1839_2309 | 151 |
| 272 | 3300049823 | Ga0501044_0895177 | Ga0501044_0895177_129_623 | 151 |
| 273 | 3300053085 | Ga0495619_0018759 | Ga0495619_0018759_969_1445 | 151 |
| 274 | 3300061734 | Ga0530510_0252030 | Ga0530510_0252030_61_552 | 151 |
| 275 | 3300005539 | Ga0068853_100607866 | Ga0068853_1006078662 | 152 |
| 276 | 3300009545 | Ga0105237_10457375 | Ga0105237_104573752 | 152 |
| 277 | 3300021441 | Ga0213871_10071423 | Ga0213871_100714232 | 152 |
| 278 | 3300026041 | Ga0207639_10469231 | Ga0207639_104692312 | 152 |
| 279 | 3300039438 | Ga0436360_1010877 | Ga0436360_1010877_1597_2070 | 152 |
| 280 | 3300049744 | Ga0501083_0702654 | Ga0501083_0702654_60_539 | 152 |
| 281 | iso_pu_bacteria | 2932422444 | 2932422530 | 152 |
| 282 | 3300001915 | JGI24741J21665_1016040 | JGI24741J21665_10160402 | 153 |
| 283 | 3300001979 | JGI24740J21852_10012950 | JGI24740J21852_100129503 | 153 |
| 284 | 3300001989 | JGI24739J22299_10058635 | JGI24739J22299_100586351 | 153 |
| 285 | 3300002067 | JGI24735J21928_10005786 | JGI24735J21928_100057865 | 153 |
| 286 | 3300002075 | JGI24738J21930_10034945 | JGI24738J21930_100349452 | 153 |
| 287 | 3300002987 | JGI25159J45721_1041222 | JGI25159J45721_10412221 | 153 |
| 288 | 3300003187 | JGI25151J46595_10000330 | JGI25151J46595_1000033046 | 153 |
| 289 | 3300003187 | JGI25151J46595_10000531 | JGI25151J46595_1000053127 | 153 |
| 290 | 3300005327 | Ga0070658_10052972 | Ga0070658_100529722 | 153 |
| 291 | 3300005329 | Ga0070683_100113743 | Ga0070683_1001137432 | 153 |
| 292 | 3300005336 | Ga0070680_100016789 | Ga0070680_1000167895 | 153 |
| 293 | 3300005344 | Ga0070661_100005232 | Ga0070661_1000052325 | 153 |
| 294 | 3300005347 | Ga0070668_100601083 | Ga0070668_1006010831 | 153 |
| 295 | 3300005353 | Ga0070669_100117575 | Ga0070669_1001175753 | 153 |
| 296 | 3300005353 | Ga0070669_100787498 | Ga0070669_1007874982 | 153 |
| 297 | 3300005366 | Ga0070659_100013699 | Ga0070659_1000136992 | 153 |
| 298 | 3300005434 | Ga0070709_10307602 | Ga0070709_103076022 | 153 |
| 299 | 3300005437 | Ga0070710_10551281 | Ga0070710_105512812 | 153 |
| 300 | 3300005455 | Ga0070663_100031007 | Ga0070663_1000310072 | 153 |
| 301 | 3300005458 | Ga0070681_10098554 | Ga0070681_100985542 | 153 |
| 302 | 3300005458 | Ga0070681_10304691 | Ga0070681_103046911 | 153 |
| 303 | 3300005468 | Ga0070707_100182488 | Ga0070707_1001824882 | 153 |
| 304 | 3300005468 | Ga0070707_100612673 | Ga0070707_1006126732 | 153 |
| 305 | 3300005471 | Ga0070698_100339046 | Ga0070698_1003390461 | 153 |
| 306 | 3300005518 | Ga0070699_100101989 | Ga0070699_1001019892 | 153 |
| 307 | 3300005530 | Ga0070679_100019300 | Ga0070679_1000193006 | 153 |
| 308 | 3300005535 | Ga0070684_101502638 | Ga0070684_1015026381 | 153 |
| 309 | 3300005539 | Ga0068853_100020735 | Ga0068853_1000207353 | 153 |
| 310 | 3300005539 | Ga0068853_100570843 | Ga0068853_1005708432 | 153 |
| 311 | 3300005543 | Ga0070672_100452413 | Ga0070672_1004524133 | 153 |
| 312 | 3300005563 | Ga0068855_100029826 | Ga0068855_1000298268 | 153 |
| 313 | 3300005577 | Ga0068857_100187763 | Ga0068857_1001877633 | 153 |
| 314 | 3300005578 | Ga0068854_100257885 | Ga0068854_1002578852 | 153 |
| 315 | 3300005616 | Ga0068852_100009398 | Ga0068852_1000093988 | 153 |
| 316 | 3300005618 | Ga0068864_101242682 | Ga0068864_1012426822 | 153 |
| 317 | 3300009551 | Ga0105238_10031321 | Ga0105238_100313211 | 153 |
| 318 | 3300013100 | Ga0157373_10107935 | Ga0157373_101079353 | 153 |
| 319 | 3300013105 | Ga0157369_10268908 | Ga0157369_102689082 | 153 |
| 320 | 3300014325 | Ga0163163_11334694 | Ga0163163_113346942 | 153 |
| 321 | 3300025284 | Ga0209130_1000771 | Ga0209130_100077115 | 153 |
| 322 | 3300025294 | Ga0209025_1000327 | Ga0209025_100032754 | 153 |
| 323 | 3300025297 | Ga0209758_1002694 | Ga0209758_100269420 | 153 |
| 324 | 3300025302 | Ga0207426_1000080 | Ga0207426_1000080114 | 153 |
| 325 | 3300025898 | Ga0207692_10428648 | Ga0207692_104286482 | 153 |
| 326 | 3300025904 | Ga0207647_10068302 | Ga0207647_100683022 | 153 |
| 327 | 3300025909 | Ga0207705_10003472 | Ga0207705_100034725 | 153 |
| 328 | 3300025912 | Ga0207707_10221387 | Ga0207707_102213873 | 153 |
| 329 | 3300025912 | Ga0207707_10287311 | Ga0207707_102873112 | 153 |
| 330 | 3300025917 | Ga0207660_10011899 | Ga0207660_100118998 | 153 |
| 331 | 3300025919 | Ga0207657_10015781 | Ga0207657_100157818 | 153 |
| 332 | 3300025920 | Ga0207649_10016372 | Ga0207649_100163723 | 153 |
| 333 | 3300025920 | Ga0207649_10518793 | Ga0207649_105187932 | 153 |
| 334 | 3300025921 | Ga0207652_10021398 | Ga0207652_100213985 | 153 |
| 335 | 3300025922 | Ga0207646_10249314 | Ga0207646_102493142 | 153 |
| 336 | 3300025923 | Ga0207681_10101376 | Ga0207681_101013763 | 153 |
| 337 | 3300025923 | Ga0207681_10325938 | Ga0207681_103259382 | 153 |
| 338 | 3300025924 | Ga0207694_10492025 | Ga0207694_104920252 | 153 |
| 339 | 3300025932 | Ga0207690_10233824 | Ga0207690_102338242 | 153 |
| 340 | 3300025944 | Ga0207661_10353358 | Ga0207661_103533582 | 153 |
| 341 | 3300025949 | Ga0207667_10066813 | Ga0207667_100668132 | 153 |
| 342 | 3300025972 | Ga0207668_10258027 | Ga0207668_102580272 | 153 |
| 343 | 3300025981 | Ga0207640_10241461 | Ga0207640_102414612 | 153 |
| 344 | 3300026041 | Ga0207639_10408736 | Ga0207639_104087361 | 153 |
| 345 | 3300026041 | Ga0207639_10745608 | Ga0207639_107456082 | 153 |
| 346 | 3300026067 | Ga0207678_10039513 | Ga0207678_100395136 | 153 |
| 347 | 3300026078 | Ga0207702_10034476 | Ga0207702_100344763 | 153 |
| 348 | 3300026095 | Ga0207676_11149662 | Ga0207676_111496622 | 153 |
| 349 | 3300026116 | Ga0207674_10480619 | Ga0207674_104806192 | 153 |
| 350 | 3300026142 | Ga0207698_10007002 | Ga0207698_100070026 | 153 |
| 351 | 3300028794 | Ga0307515_10000222 | Ga0307515_10000222111 | 153 |
| 352 | 3300031250 | Ga0265331_10025728 | Ga0265331_100257283 | 153 |
| 353 | 3300031251 | Ga0265327_10015600 | Ga0265327_100156006 | 153 |
| 354 | 3300031456 | Ga0307513_10003042 | Ga0307513_1000304212 | 153 |
| 355 | 3300031649 | Ga0307514_10000772 | Ga0307514_1000077243 | 153 |
| 356 | 3300031727 | Ga0316576_10370094 | Ga0316576_103700942 | 153 |
| 357 | 3300031901 | Ga0307406_10504085 | Ga0307406_105040851 | 153 |
| 358 | 3300031911 | Ga0307412_10209330 | Ga0307412_102093302 | 153 |
| 359 | 3300033180 | Ga0307510_10245693 | Ga0307510_102456932 | 153 |
| 360 | 3300035398 | Ga0316574_0320051 | Ga0316574_0320051_17_505 | 153 |
| 361 | 3300035398 | Ga0316574_0482515 | Ga0316574_0482515_106_594 | 153 |
| 362 | 3300035691 | Ga0373931_0064347 | Ga0373931_0064347_1449_1925 | 153 |
| 363 | 3300037471 | Ga0395905_0001436 | Ga0395905_0001436_18240_18722 | 153 |
| 364 | 3300038443 | Ga0395901_0077545 | Ga0395901_0077545_2750_3259 | 153 |
| 365 | 3300038443 | Ga0395901_0275921 | Ga0395901_0275921_1183_1677 | 153 |
| 366 | 3300041997 | Ga0439431_0040638 | Ga0439431_0040638_505_987 | 153 |
| 367 | 3300042146 | Ga0450907_019272 | Ga0450907_019272_456_938 | 153 |
| 368 | 3300045976 | Ga0466967_0033277 | Ga0466967_0033277_394_870 | 153 |
| 369 | 3300045976 | Ga0466967_0280857 | Ga0466967_0280857_650_1144 | 153 |
| 370 | 3300045976 | Ga0466967_0287944 | Ga0466967_0287944_195_671 | 153 |
| 371 | 3300046512 | Ga0495610_0039792 | Ga0495610_0039792_854_1336 | 153 |
| 372 | 3300048912 | Ga0496109_0008620 | Ga0496109_0008620_2520_3131 | 153 |
| 373 | 3300048915 | Ga0496112_1364067 | Ga0496112_1364067_40_516 | 153 |
| 374 | 3300049573 | Ga0501037_0112942 | Ga0501037_0112942_11_532 | 153 |
| 375 | 3300049589 | Ga0501073_0446635 | Ga0501073_0446635_45_521 | 153 |
| 376 | 3300049590 | Ga0501074_0128004 | Ga0501074_0128004_424_900 | 153 |
| 377 | 3300049823 | Ga0501044_0834587 | Ga0501044_0834587_60_554 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ekr-assembly1.cif.gz_A | moac protein from e. coli | 0.9542 | 11 | 143 |
| 4pyd-assembly1.cif.gz_D | moac in complex with cpmp crystallized in space group p212121 | 0.9504 | 5 | 146 |
| 3jqj-assembly1.cif.gz_B | crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 | 0.9491 | 11 | 152 |
| 3jqk-assembly1.cif.gz_A | crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) | 0.9327 | 12 | 152 |
| 4pyd-assembly1.cif.gz_A | moac in complex with cpmp crystallized in space group p212121 | 0.9268 | 15 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FJH5_64_220_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9644 | 3 | 153 | 3.30.70.640 |
| 1ekrA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9542 | 11 | 143 | 3.30.70.640 |
| af_B4FJH5_64_220_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9461 | 3 | 153 | 3.30.70.640 |
| af_P9WJR7_13_167_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.94 | 2 | 153 | 3.30.70.640 |
| af_P9WJR7_13_167_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9282 | 2 | 153 | 3.30.70.640 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C9RCT0-F1-model_v4 | Molybdenum cofactor biosynthesis protein C | 0.9735 | 11 | 152 |
GO:0006777
GO:0061799 |
| AF-A0A535QPK6-F1-model_v4 | Multifunctional fusion protein [Includes: DNA polymerase IV (Pol IV) (EC 2.7.7.7); Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C)] | 0.9702 | 1 | 153 |
GO:0000287
GO:0003684 GO:0003887 GO:0005829 GO:0006261 GO:0006777 GO:0009432 GO:0042276 GO:0061799 |
| AF-A0A059FIL4-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.9691 | 15 | 151 |
GO:0006777
GO:0061798 GO:0061799 |
| AF-A0A1F3CXQ4-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.9686 | 14 | 152 |
GO:0006777
GO:0061799 |
| AF-A0A847PBA7-F1-model_v4 | Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C) | 0.9682 | 4 | 153 |
GO:0005525
GO:0006777 GO:0061799 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar