F427707

General Info

Members Datasets Scaffolds Average Seq Length
377 254 755 350

Family's Representative Sequence

Representative Sequence 3300025302|Ga0207426_1008401|Ga0207426_10084013
Length 366
Sequence MRGVIFDGEQPRVVDDLTVRDPGPGEVLVGIRAAGLCHSDLSVIDGTIPFPVPVVLGHEGAGVVEAVGAGVGHVVPGDHVALSTLANCGACAECDRGRPTMCRKAIGMPQKPFRRGERELFSFASNSAFAERTVVKAVQAVKIAEDIPLTSAALIGCGVLTGVGAVLNRAKVDRGDSVVVIGAGGIGLNVLQGARIAGASVIVAVDANPAKEAVARQFGATHFIDASAVADSVKAVKEILPTGADHAFECVGSTRLIRQAVDLLDRHGQAVLLGVPPATAEASFLVSSMYLDKSILGCRYGSARPQRDIALYARLYREGRLLLDELVTRTYPVEDFARAADDAHHGRVARGVLTFGPDPGAALARS

Samples

Sample ID Description Type Environment
1 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
35 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
36 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
51 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
59 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
69 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
70 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
71 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
72 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
73 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
74 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
166 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
167 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
168 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
169 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
170 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
174 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
175 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 2508501039 Frankia saprophytica CN3 Isolate Nodule
182 2517572101 Frankia sp. DC12 Isolate Nodule
183 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
184 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
185 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
186 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
187 2643221578 Streptomyces sp. Root63 Isolate Unclassified
188 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
189 2643221647 Streptomyces sp. Root369 Isolate Unclassified
190 2643221670 Streptomyces sp. Root431 Isolate Unclassified
191 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
192 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
193 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
194 2643221714 Streptomyces sp. Root264 Isolate Unclassified
195 2671180195 Frankia sp. CcI49 Isolate Nodule
196 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
197 2687453737 Frankia sp. BMG5.36 Isolate Nodule
198 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
199 2773857922 Frankia sp. CcI49 Isolate Nodule
200 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
201 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
202 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
203 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
204 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
205 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
206 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
207 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
208 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
209 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
210 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
211 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
212 2862574272 Streptomyces sp. AcE210 Isolate Nodule
213 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
214 2867475112 Streptomyces sp. TM32 Isolate Unclassified
215 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
216 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
217 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
218 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
219 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
220 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
221 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
222 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
223 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
224 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
225 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
226 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
227 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
228 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
229 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
230 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
231 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
232 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
233 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
234 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
235 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
236 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
237 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
238 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
239 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
240 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
241 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
242 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
243 8002775197 Frankia nepalensis CN7 Isolate Nodule
244 8002784119 Frankia sp. AgB1.9 Isolate Nodule
245 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
246 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
247 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
248 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
249 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
250 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
251 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
252 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
253 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
254 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.78
Metatranscriptomes 0.27
Isolates 20.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 3.98
Rhizoplane 0.53
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207426_1008401 3300025302 Bacteria 4176
2 rootH1_10026989 3300003316 Bacteria 1681
3 rootH1_10026989 3300003323 Bacteria 3042
4 rootH2_10009244 3300003320 Bacteria 6340
5 rootH1_10003616 3300003323 Bacteria 3574
6 Ga0006562J51391_1108273 3300003578 Bacteria 8604
7 Ga0070670_100235946 3300005331 Bacteria 1592
8 Ga0070708_100034713 3300005445 Bacteria 4389
9 Ga0070708_100169157 3300005445 Bacteria 2040
10 Ga0070707_100131184 3300005468 Bacteria 2437
11 Ga0070707_100237664 3300005468 Bacteria 1773
12 Ga0070707_100286134 3300005468 Bacteria 1602
13 Ga0070699_100032086 3300005518 Bacteria 4536
14 Ga0070697_100177410 3300005536 Bacteria 1805
15 Ga0070697_100370197 3300005536 Bacteria 1240
16 Ga0070665_100123894 3300005548 Bacteria 2587
17 Ga0068863_100104829 3300005841 Bacteria 2690
18 Ga0068858_100078641 3300005842 Bacteria 3065
19 Ga0068860_100027122 3300005843 Bacteria 5518
20 Ga0068862_100005409 3300005844 Bacteria 10671
21 Ga0081455_10011384 3300005937 Bacteria 8941
22 Ga0075364_10020111 3300006051 Bacteria 4197
23 Ga0070715_10073646 3300006163 Bacteria 1532
24 Ga0075436_100012009 3300006914 Bacteria 5940
25 Ga0105251_10015467 3300009011 Bacteria 4169
26 Ga0111539_10196931 3300009094 Bacteria 2350
27 Ga0105248_10120416 3300009177 Bacteria 2961
28 Ga0105249_10108327 3300009553 Bacteria 2623
29 Ga0182008_10006291 3300014497 Bacteria 6662
30 Ga0157379_10020891 3300014968 Bacteria 5794
31 Ga0183367_1005 3300015688 Bacteria 652063
32 Ga0207426_1001344 3300025302 Bacteria 20886
33 Ga0207426_1036992 3300025302 Bacteria 1547
34 Ga0207646_10060724 3300025922 Bacteria 3375
35 Ga0207712_10019155 3300025961 Bacteria 4465
36 Ga0207658_10001146 3300025986 Bacteria 21228
37 Ga0209371_1007012 3300027312 Bacteria 4026
38 Ga0209371_1015280 3300027312 Bacteria 2071
39 Ga0209371_1031320 3300027312 Bacteria 1156
40 Ga0268265_10004436 3300028380 Bacteria 9743
41 Ga0307517_10000838 3300028786 Bacteria 52894
42 Ga0307517_10008611 3300028786 Bacteria 14614
43 Ga0307515_10000933 3300028794 Bacteria 67151
44 Ga0307515_10168647 3300028794 Bacteria 2194
45 Ga0268256_1012719 3300030500 Bacteria 2585
46 Ga0268256_1035587 3300030500 Bacteria 1156
47 Ga0307511_10001111 3300030521 Bacteria 28701
48 Ga0307512_10008482 3300030522 Bacteria 10010
49 Ga0307512_10044499 3300030522 Bacteria 3649
50 Ga0307513_10110486 3300031456 Bacteria 2744
51 Ga0307513_10158832 3300031456 Bacteria 2156
52 Ga0307513_10206135 3300031456 Bacteria 1802
53 Ga0307509_10006913 3300031507 Bacteria 15059
54 Ga0307509_10007427 3300031507 Bacteria 14329
55 Ga0307509_10077067 3300031507 Bacteria 3457
56 Ga0307509_10164156 3300031507 Bacteria 2113
57 Ga0307508_10024606 3300031616 Bacteria 5464
58 Ga0307508_10034013 3300031616 Bacteria 4595
59 Ga0307508_10057118 3300031616 Bacteria 3454
60 Ga0307514_10018676 3300031649 Bacteria 5682
61 Ga0307514_10158032 3300031649 Bacteria 1507
62 Ga0307516_10008421 3300031730 Bacteria 11690
63 Ga0307413_10057726 3300031824 Bacteria 2375
64 Ga0307518_10019325 3300031838 Bacteria 4895
65 Ga0307518_10032331 3300031838 Bacteria 3793
66 Ga0307518_10164688 3300031838 Bacteria 1519
67 Ga0307406_10121831 3300031901 Bacteria 1815
68 Ga0307416_100044172 3300032002 Bacteria 3496
69 Ga0307414_10077712 3300032004 Bacteria 2417
70 Ga0307411_10147610 3300032005 Bacteria 1743
71 Ga0307507_10006857 3300033179 Bacteria 17009
72 Ga0307507_10014960 3300033179 Bacteria 9183
73 Ga0307507_10044303 3300033179 Bacteria 4401
74 Ga0307507_10112985 3300033179 Bacteria 2210
75 Ga0307510_10033484 3300033180 Bacteria 5770
76 Ga0307510_10034711 3300033180 Bacteria 5641
77 Ga0307510_10066059 3300033180 Bacteria 3656
78 Ga0307510_10070703 3300033180 Bacteria 3482
79 Ga0307510_10094795 3300033180 Bacteria 2808
80 Ga0373923_0002762 3300035111 Bacteria 5482
81 Ga0373953_0026380 3300035117 Bacteria 2225
82 Ga0373935_0346226 3300035692 Bacteria 1059
83 Ga0373933_0006920 3300035724 Bacteria 6180
84 Ga0373937_0014017 3300036401 Bacteria 7069
85 Ga0373937_0490425 3300036401 Bacteria 1167
86 Ga0395900_0375438 3300037418 Bacteria 1391
87 Ga0395898_0002755 3300037466 Bacteria 20248
88 Ga0395898_0010768 3300037466 Bacteria 9551
89 Ga0395901_0059756 3300038443 Bacteria 3966
90 Ga0436360_0643061 3300039438 Bacteria 1846
91 Ga0436362_0446358 3300039453 Bacteria 1739
92 Ga0439436_0001975 3300041404 Bacteria 6083
93 Ga0439439_0014253 3300041406 Bacteria 1934
94 Ga0451845_0847455 3300041501 Bacteria 1794
95 Ga0451853_0940032 3300041512 Bacteria 3012
96 Ga0439433_0003732 3300041999 Bacteria 3271
97 Ga0439448_0005726 3300042005 Bacteria 3546
98 Ga0439449_0001724 3300042007 Bacteria 8593
99 Ga0439455_0000677 3300042012 Bacteria 5018
100 Ga0439457_000829 3300042014 Bacteria 9283
101 Ga0439457_002002 3300042014 Bacteria 5987
102 Ga0439462_0005341 3300042015 Bacteria 3165
103 Ga0450894_000267 3300042131 Bacteria 9384
104 Ga0450899_000206 3300042135 Bacteria 6100
105 Ga0450903_002658 3300042138 Bacteria 3148
106 Ga0450906_000878 3300042145 Bacteria 6599
107 Ga0439458_0000030 3300042157 Bacteria 22373
108 Ga0439458_0003505 3300042157 Bacteria 3665
109 Ga0466972_0018765 3300044658 Bacteria 3457
110 Ga0466972_0033797 3300044658 Bacteria 2508
111 Ga0466965_0000534 3300044683 Bacteria 13690
112 Ga0466966_0004908 3300044684 Bacteria 8792
113 Ga0466966_0096452 3300044684 Bacteria 1831
114 Ga0466961_0000287 3300044693 Bacteria 33454
115 Ga0466961_0003698 3300044693 Bacteria 9552
116 Ga0466963_0001828 3300044694 Bacteria 11592
117 Ga0466964_0013542 3300044706 Bacteria 3094
118 Ga0466964_0050716 3300044706 Bacteria 1702
119 Ga0466971_0004997 3300044719 Bacteria 5737
120 Ga0466970_0001270 3300044765 Bacteria 12198
121 Ga0466957_0000813 3300044842 Bacteria 15925
122 Ga0466959_0007174 3300045049 Bacteria 7800
123 Ga0466959_0009213 3300045049 Bacteria 7012
124 Ga0466958_0000263 3300045836 Bacteria 20321
125 Ga0466967_0007662 3300045976 Bacteria 7817
126 Ga0466967_0045140 3300045976 Bacteria 3827
127 Ga0466967_0119031 3300045976 Bacteria 2437
128 Ga0495592_0004790 3300046454 Bacteria 9937
129 Ga0495603_0000859 3300046455 Bacteria 17392
130 Ga0495603_0003363 3300046455 Bacteria 9517
131 Ga0495603_0023111 3300046455 Bacteria 3763
132 Ga0495603_0033151 3300046455 Bacteria 3108
133 Ga0495603_0155651 3300046455 Bacteria 1326
134 Ga0495629_0006743 3300046459 Bacteria 8489
135 Ga0495629_0011380 3300046459 Bacteria 6461
136 Ga0495629_0012973 3300046459 Bacteria 6026
137 Ga0495629_0017805 3300046459 Bacteria 5092
138 Ga0495629_0019896 3300046459 Bacteria 4790
139 Ga0495629_0030228 3300046459 Bacteria 3841
140 Ga0495629_0080910 3300046459 Bacteria 2267
141 Ga0495629_0130767 3300046459 Bacteria 1748
142 Ga0495638_0026609 3300046460 Bacteria 3748
143 Ga0495638_0035840 3300046460 Bacteria 3161
144 Ga0495638_0098396 3300046460 Bacteria 1753
145 Ga0495651_0000578 3300046462 Bacteria 28428
146 Ga0495651_0004345 3300046462 Bacteria 10848
147 Ga0495653_0003318 3300046463 Bacteria 12924
148 Ga0495580_0122350 3300046472 Bacteria 1806
149 Ga0495639_0052379 3300046475 Bacteria 1858
150 Ga0495662_0001250 3300046476 Bacteria 12534
151 Ga0495662_0001317 3300046476 Bacteria 12297
152 Ga0495662_0001758 3300046476 Bacteria 10832
153 Ga0495662_0144713 3300046476 Bacteria 1170
154 Ga0495664_0004549 3300046477 Bacteria 7589
155 Ga0495664_0030329 3300046477 Bacteria 3167
156 Ga0495664_0052309 3300046477 Bacteria 2426
157 Ga0495594_0001865 3300046499 Bacteria 10964
158 Ga0495594_0039732 3300046499 Bacteria 2573
159 Ga0495594_0043018 3300046499 Bacteria 2475
160 Ga0495607_0048762 3300046501 Bacteria 2474
161 Ga0495607_0141375 3300046501 Bacteria 1241
162 Ga0495583_0019861 3300046506 Bacteria 3496
163 Ga0495608_0055346 3300046511 Bacteria 2621
164 Ga0495618_0019831 3300046514 Bacteria 4139
165 Ga0495618_0129603 3300046514 Bacteria 1614
166 Ga0495628_0094194 3300046516 Bacteria 2315
167 Ga0495628_0124280 3300046516 Bacteria 1977
168 Ga0495631_0048673 3300046518 Bacteria 1858
169 Ga0495643_0004495 3300046522 Bacteria 9723
170 Ga0495642_0041032 3300046528 Bacteria 1882
171 Ga0495652_0017825 3300046529 Bacteria 6337
172 Ga0495652_0039478 3300046529 Bacteria 4081
173 Ga0495665_0032326 3300046531 Bacteria 2799
174 Ga0495640_0020684 3300046533 Bacteria 4840
175 Ga0495640_0035506 3300046533 Bacteria 3528
176 Ga0495640_0175069 3300046533 Bacteria 1370
177 Ga0495586_0005667 3300046535 Bacteria 6678
178 Ga0495587_0002864 3300046536 Bacteria 11545
179 Ga0495597_0098888 3300046542 Bacteria 1232
180 Ga0495645_0007152 3300046543 Bacteria 7769
181 Ga0495645_0026573 3300046543 Bacteria 4202
182 Ga0495645_0045239 3300046543 Bacteria 3211
183 Ga0495645_0139451 3300046543 Bacteria 1693
184 Ga0495622_0032677 3300046557 Bacteria 2429
185 Ga0495622_0047676 3300046557 Bacteria 1990
186 Ga0495633_0063459 3300046558 Bacteria 1729
187 Ga0495667_0032901 3300046559 Bacteria 3471
188 Ga0495667_0044885 3300046559 Bacteria 2926
189 Ga0495667_0050620 3300046559 Bacteria 2742
190 Ga0495611_0076193 3300046648 Bacteria 1537
191 Ga0495625_0077120 3300046660 Bacteria 2329
192 Ga0495635_0007896 3300046663 Bacteria 7433
193 Ga0495635_0030993 3300046663 Bacteria 3714
194 Ga0495588_0003689 3300046674 Bacteria 6706
195 Ga0495588_0006955 3300046674 Bacteria 5128
196 Ga0495588_0126367 3300046674 Bacteria 1348
197 Ga0495657_0011835 3300046675 Bacteria 6503
198 Ga0495657_0023494 3300046675 Bacteria 4403
199 Ga0495623_0042887 3300046679 Bacteria 2879
200 Ga0495646_0000796 3300046680 Bacteria 17615
201 Ga0495646_0018267 3300046680 Bacteria 4441
202 Ga0495658_0106589 3300046683 Bacteria 1680
203 Ga0495658_0116528 3300046683 Bacteria 1611
204 Ga0495613_0001593 3300046689 Bacteria 17194
205 Ga0495613_0007318 3300046689 Bacteria 8219
206 Ga0495613_0008877 3300046689 Bacteria 7455
207 Ga0495613_0011938 3300046689 Bacteria 6457
208 Ga0495613_0024849 3300046689 Bacteria 4464
209 Ga0495613_0109611 3300046689 Bacteria 1990
210 Ga0495613_0157118 3300046689 Bacteria 1619
211 Ga0495670_0002301 3300046691 Bacteria 9440
212 Ga0495671_0005958 3300046692 Bacteria 7088
213 Ga0495589_0049782 3300046794 Bacteria 2073
214 Ga0495600_0041792 3300046809 Bacteria 2988
215 Ga0495600_0109712 3300046809 Bacteria 1796
216 Ga0495581_0001441 3300047315 Bacteria 13208
217 Ga0495581_0020116 3300047315 Bacteria 3875
218 Ga0495581_0125909 3300047315 Bacteria 1492
219 Ga0495604_0000686 3300047317 Bacteria 28678
220 Ga0495604_0002718 3300047317 Bacteria 14184
221 Ga0495604_0022511 3300047317 Bacteria 5031
222 Ga0495672_0041547 3300047320 Bacteria 2780
223 Ga0495676_0032641 3300047321 Bacteria 4392
224 Ga0495676_0057692 3300047321 Bacteria 3059
225 Ga0495676_0106175 3300047321 Bacteria 2069
226 Ga0495676_0161586 3300047321 Bacteria 1584
227 Ga0495676_0235282 3300047321 Bacteria 1256
228 Ga0495680_0032892 3300047322 Bacteria 4204
229 Ga0495687_003071 3300047443 Bacteria 12517
230 Ga0495687_010721 3300047443 Bacteria 5000
231 Ga0495687_036682 3300047443 Bacteria 2191
232 Ga0495687_053103 3300047443 Bacteria 1708
233 Ga0495687_053561 3300047443 Bacteria 1698
234 Ga0495687_075526 3300047443 Bacteria 1336
235 Ga0495675_0009164 3300047444 Bacteria 6154
236 Ga0495675_0062459 3300047444 Bacteria 2358
237 Ga0495685_001229 3300047447 Bacteria 7857
238 Ga0495685_004920 3300047447 Bacteria 4338
239 Ga0495685_017473 3300047447 Bacteria 2457
240 Ga0495685_062803 3300047447 Bacteria 1250
241 Ga0495681_0000288 3300047470 Bacteria 40169
242 Ga0495681_0059383 3300047470 Bacteria 1768
243 Ga0495686_0019295 3300047472 Bacteria 4558
244 Ga0495593_0000828 3300047673 Bacteria 17973
245 Ga0495593_0006079 3300047673 Bacteria 7101
246 Ga0495593_0054710 3300047673 Bacteria 2102
247 Ga0495593_0105720 3300047673 Bacteria 1440
248 Ga0495602_0057684 3300048088 Bacteria 3404
249 Ga0495614_0000635 3300048089 Bacteria 14667
250 Ga0495614_0006259 3300048089 Bacteria 5346
251 Ga0495614_0024703 3300048089 Bacteria 2593
252 Ga0495614_0042371 3300048089 Bacteria 1951
253 Ga0496102_0029202 3300048905 Bacteria 4933
254 Ga0496116_0000580 3300048919 Bacteria 48889
255 Ga0496117_0018522 3300048920 Bacteria 5762
256 Ga0496118_0015627 3300048921 Bacteria 7015
257 Ga0501032_0022431 3300049569 Bacteria 4375
258 Ga0501032_0072733 3300049569 Bacteria 2291
259 Ga0501034_0072941 3300049571 Bacteria 3441
260 Ga0501037_0002586 3300049573 Bacteria 13078
261 Ga0501038_0023924 3300049574 Bacteria 5454
262 Ga0501038_0036303 3300049574 Bacteria 4326
263 Ga0501039_0145171 3300049575 Bacteria 1865
264 Ga0501043_0027760 3300049579 Bacteria 4443
265 Ga0501047_0048191 3300049581 Bacteria 4114
266 Ga0501070_0029401 3300049586 Bacteria 4607
267 Ga0501070_0130845 3300049586 Bacteria 2073
268 Ga0501070_0169025 3300049586 Bacteria 1801
269 Ga0501073_0114669 3300049589 Bacteria 1868
270 Ga0501074_0214865 3300049590 Bacteria 1370
271 Ga0501035_0092798 3300049822 Bacteria 2656
272 Ga0501044_0006500 3300049823 Bacteria 12913
273 Ga0501044_0014284 3300049823 Bacteria 8574
274 nmdc:mga00v17_4022_c1 3300050491 Bacteria 7594
275 nmdc:mga09592_606489_c1 3300050508 Bacteria 937
276 nmdc:mga08y16_416765_c1 3300050511 Bacteria 1373
277 nmdc:mga0n895_73688_c1 3300050512 Bacteria 3390
278 Ga0495601_0005483 3300053077 Bacteria 7394
279 Ga0495619_0044404 3300053085 Bacteria 2917
280 Ga0500583_0059751 3300053092 Bacteria 1796
281 Ga0500640_001577 3300053095 Bacteria 7010
282 Ga0500641_0051967 3300053096 Bacteria 1688
283 Ga0500654_041599 3300053099 Bacteria 2602
284 Ga0500553_018821 3300053101 Bacteria 3500
285 Ga0500553_026638 3300053101 Bacteria 2910
286 Ga0500569_001401 3300053109 Bacteria 4535
287 Ga0500652_000538 3300053131 Bacteria 13329
288 Ga0500658_0000368 3300053134 Bacteria 19898
289 Ga0500561_0000370 3300053137 Bacteria 7418
290 Ga0500573_0008687 3300053140 Bacteria 5603
291 Ga0500573_0067193 3300053140 Bacteria 2049
292 Ga0500579_089926 3300053143 Bacteria 1665
293 Ga0500600_0004002 3300053149 Bacteria 8587
294 Ga0500600_0096217 3300053149 Bacteria 1571
295 Ga0500616_0003151 3300053153 Bacteria 12870
296 Ga0500634_0002683 3300053161 Bacteria 7599
297 Ga0500636_0124720 3300053177 Bacteria 1441
298 Ga0500587_003314 3300053739 Bacteria 2259
299 Ga0466962_0003084 3300061719 Bacteria 7928
300 2508676142 2508501039 Bacteria 9978592
301 2517763532 2517572101 Bacteria 6884336
302 2585308765 2582581313 Bacteria 10042643
303 2585313460 2582581314 Bacteria 11452267
304 2616695101 2616644814 Bacteria 11555299
305 2616902114 2616644941 Bacteria 8510691
306 2643902687 2643221578 Bacteria 9213798
307 2643942135 2643221587 Bacteria 7586415
308 2644262248 2643221647 Bacteria 10741251
309 2644389799 2643221670 Bacteria 6497041
310 2644404805 2643221673 Bacteria 9196637
311 2644429218 2643221677 Bacteria 7584031
312 2644437137 2643221678 Bacteria 9540101
313 2644628876 2643221714 Bacteria 9015452
314 2671832576 2671180195 Bacteria 9757215
315 2671836101 2671180195 Bacteria 9757215
316 2671840125 2671180195 Bacteria 9757215
317 2676205938 2675902999 Bacteria 9438463
318 2689959356 2687453737 Bacteria 11203906
319 2774850513 2773857921 Bacteria 9435764
320 2774850732 2773857922 Bacteria 9757215
321 2774854257 2773857922 Bacteria 9757215
322 2774858281 2773857922 Bacteria 9757215
323 2785343342 2784746763 Bacteria 9783172
324 2785369473 2784746768 Bacteria 10036182
325 2786670579 2786546132 Bacteria 10419719
326 2793983931 2791355406 Bacteria 11364898
327 2808842033 2808606359 Bacteria 9866990
328 2808920548 2808606375 Bacteria 9466072
329 2811849003 2808606982 Bacteria 7791042
330 2812358135 2811994879 Bacteria 9313447
331 2852636705 2852635781 Bacteria 8251373
332 2862181856 2862178590 Bacteria 8583590
333 2862285620 2862281513 Bacteria 9621493
334 2862295519 2862290372 Bacteria 7471434
335 2862579279 2862574272 Bacteria 10567477
336 2863404642 2863404153 Bacteria 9672205
337 2867480573 2867475112 Bacteria 6909112
338 2873155757 2873151551 Bacteria 8625867
339 2875395847 2875391855 Bacteria 7600475
340 2877681136 2877676314 Bacteria 9512378
341 2912719987 2912715099 Bacteria 9460473
342 2918505675 2918501144 Bacteria 8668083
343 2919469541 2919468124 Bacteria 9133025
344 2935393876 2935390628 Bacteria 7043367
345 2946048781 2946045630 Bacteria 8527308
346 2946067706 2946064051 Bacteria 8957905
347 2946075888 2946072368 Bacteria 8999607
348 2947229262 2947224130 Bacteria 9938529
349 2954007447 2954002825 Bacteria 9173742
350 2954386269 2954380949 Bacteria 10050426
351 2954676899 2954673503 Bacteria 9685905
352 2954687259 2954682443 Bacteria 9862841
353 2954696906 2954691527 Bacteria 10720516
354 2954705229 2954701450 Bacteria 10834262
355 2954716277 2954711539 Bacteria 10867210
356 2954726219 2954721474 Bacteria 10456478
357 2954735591 2954731030 Bacteria 10243860
358 2954745144 2954740390 Bacteria 10229294
359 2954754447 2954749733 Bacteria 10366972
360 2954764118 2954759201 Bacteria 9358192
361 2990066456 2990059506 Bacteria 9321252
362 2995465822 2995463766 Bacteria 8577691
363 2995466676 2995463766 Bacteria 8577691
364 2997458303 2997451912 Bacteria 8492419
365 2997601431 2997600082 Bacteria 9896405
366 3006492723 3006486233 Bacteria 8157040
367 8002780165 8002775197 Bacteria 10728764
368 8002789376 8002784119 Bacteria 9788632
369 8008567334 8008558824 Bacteria 10610750
370 8025479002 8025478263 Bacteria 8209203
371 8047896878 8047893842 Bacteria 11723082
372 8048362072 8048356638 Bacteria 11044339
373 8048373863 8048369669 Bacteria 11666822
374 8048384365 8048379754 Bacteria 11877923
375 8048412781 8048406513 Bacteria 8936924
376 8054164188 8054160619 Bacteria 7783213
377 8056672865 8056667051 Bacteria 6953971
378 8056831726 8056829672 Bacteria 9045328
379 Ga0207426_1008401
380 rootH1_10026989
381 rootH2_10009244
382 rootH1_10003616
383 Ga0006562J51391_1108273
384 Ga0070670_100235946
385 Ga0070708_100034713
386 Ga0070708_100169157
387 Ga0070707_100131184
388 Ga0070707_100237664
389 Ga0070707_100286134
390 Ga0070699_100032086
391 Ga0070697_100177410
392 Ga0070697_100370197
393 Ga0070665_100123894
394 Ga0068863_100104829
395 Ga0068858_100078641
396 Ga0068860_100027122
397 Ga0068862_100005409
398 Ga0081455_10011384
399 Ga0075364_10020111
400 Ga0070715_10073646
401 Ga0075436_100012009
402 Ga0105251_10015467
403 Ga0111539_10196931
404 Ga0105248_10120416
405 Ga0105249_10108327
406 Ga0182008_10006291
407 Ga0157379_10020891
408 Ga0183367_1005
409 Ga0207426_1001344
410 Ga0207426_1036992
411 Ga0207646_10060724
412 Ga0207712_10019155
413 Ga0207658_10001146
414 Ga0209371_1007012
415 Ga0209371_1015280
416 Ga0209371_1031320
417 Ga0268265_10004436
418 Ga0307517_10000838
419 Ga0307517_10008611
420 Ga0307515_10000933
421 Ga0307515_10168647
422 Ga0268256_1012719
423 Ga0268256_1035587
424 Ga0307511_10001111
425 Ga0307512_10008482
426 Ga0307512_10044499
427 Ga0307513_10110486
428 Ga0307513_10158832
429 Ga0307513_10206135
430 Ga0307509_10006913
431 Ga0307509_10007427
432 Ga0307509_10077067
433 Ga0307509_10164156
434 Ga0307508_10024606
435 Ga0307508_10034013
436 Ga0307508_10057118
437 Ga0307514_10018676
438 Ga0307514_10158032
439 Ga0307516_10008421
440 Ga0307413_10057726
441 Ga0307518_10019325
442 Ga0307518_10032331
443 Ga0307518_10164688
444 Ga0307406_10121831
445 Ga0307416_100044172
446 Ga0307414_10077712
447 Ga0307411_10147610
448 Ga0307507_10006857
449 Ga0307507_10014960
450 Ga0307507_10044303
451 Ga0307507_10112985
452 Ga0307510_10033484
453 Ga0307510_10034711
454 Ga0307510_10066059
455 Ga0307510_10070703
456 Ga0307510_10094795
457 Ga0373923_0002762
458 Ga0373953_0026380
459 Ga0373935_0346226
460 Ga0373933_0006920
461 Ga0373937_0014017
462 Ga0373937_0490425
463 Ga0395900_0375438
464 Ga0395898_0002755
465 Ga0395898_0010768
466 Ga0395901_0059756
467 Ga0436360_0643061
468 Ga0436362_0446358
469 Ga0439436_0001975
470 Ga0439439_0014253
471 Ga0451845_0847455
472 Ga0451853_0940032
473 Ga0439433_0003732
474 Ga0439448_0005726
475 Ga0439449_0001724
476 Ga0439455_0000677
477 Ga0439457_000829
478 Ga0439457_002002
479 Ga0439462_0005341
480 Ga0450894_000267
481 Ga0450899_000206
482 Ga0450903_002658
483 Ga0450906_000878
484 Ga0439458_0000030
485 Ga0439458_0003505
486 Ga0466972_0018765
487 Ga0466972_0033797
488 Ga0466965_0000534
489 Ga0466966_0004908
490 Ga0466966_0096452
491 Ga0466961_0000287
492 Ga0466961_0003698
493 Ga0466963_0001828
494 Ga0466964_0013542
495 Ga0466964_0050716
496 Ga0466971_0004997
497 Ga0466970_0001270
498 Ga0466957_0000813
499 Ga0466959_0007174
500 Ga0466959_0009213
501 Ga0466958_0000263
502 Ga0466967_0007662
503 Ga0466967_0045140
504 Ga0466967_0119031
505 Ga0495592_0004790
506 Ga0495603_0000859
507 Ga0495603_0003363
508 Ga0495603_0023111
509 Ga0495603_0033151
510 Ga0495603_0155651
511 Ga0495629_0006743
512 Ga0495629_0011380
513 Ga0495629_0012973
514 Ga0495629_0017805
515 Ga0495629_0019896
516 Ga0495629_0030228
517 Ga0495629_0080910
518 Ga0495629_0130767
519 Ga0495638_0026609
520 Ga0495638_0035840
521 Ga0495638_0098396
522 Ga0495651_0000578
523 Ga0495651_0004345
524 Ga0495653_0003318
525 Ga0495580_0122350
526 Ga0495639_0052379
527 Ga0495662_0001250
528 Ga0495662_0001317
529 Ga0495662_0001758
530 Ga0495662_0144713
531 Ga0495664_0004549
532 Ga0495664_0030329
533 Ga0495664_0052309
534 Ga0495594_0001865
535 Ga0495594_0039732
536 Ga0495594_0043018
537 Ga0495607_0048762
538 Ga0495607_0141375
539 Ga0495583_0019861
540 Ga0495608_0055346
541 Ga0495618_0019831
542 Ga0495618_0129603
543 Ga0495628_0094194
544 Ga0495628_0124280
545 Ga0495631_0048673
546 Ga0495643_0004495
547 Ga0495642_0041032
548 Ga0495652_0017825
549 Ga0495652_0039478
550 Ga0495665_0032326
551 Ga0495640_0020684
552 Ga0495640_0035506
553 Ga0495640_0175069
554 Ga0495586_0005667
555 Ga0495587_0002864
556 Ga0495597_0098888
557 Ga0495645_0007152
558 Ga0495645_0026573
559 Ga0495645_0045239
560 Ga0495645_0139451
561 Ga0495622_0032677
562 Ga0495622_0047676
563 Ga0495633_0063459
564 Ga0495667_0032901
565 Ga0495667_0044885
566 Ga0495667_0050620
567 Ga0495611_0076193
568 Ga0495625_0077120
569 Ga0495635_0007896
570 Ga0495635_0030993
571 Ga0495588_0003689
572 Ga0495588_0006955
573 Ga0495588_0126367
574 Ga0495657_0011835
575 Ga0495657_0023494
576 Ga0495623_0042887
577 Ga0495646_0000796
578 Ga0495646_0018267
579 Ga0495658_0106589
580 Ga0495658_0116528
581 Ga0495613_0001593
582 Ga0495613_0007318
583 Ga0495613_0008877
584 Ga0495613_0011938
585 Ga0495613_0024849
586 Ga0495613_0109611
587 Ga0495613_0157118
588 Ga0495670_0002301
589 Ga0495671_0005958
590 Ga0495589_0049782
591 Ga0495600_0041792
592 Ga0495600_0109712
593 Ga0495581_0001441
594 Ga0495581_0020116
595 Ga0495581_0125909
596 Ga0495604_0000686
597 Ga0495604_0002718
598 Ga0495604_0022511
599 Ga0495672_0041547
600 Ga0495676_0032641
601 Ga0495676_0057692
602 Ga0495676_0106175
603 Ga0495676_0161586
604 Ga0495676_0235282
605 Ga0495680_0032892
606 Ga0495687_003071
607 Ga0495687_010721
608 Ga0495687_036682
609 Ga0495687_053103
610 Ga0495687_053561
611 Ga0495687_075526
612 Ga0495675_0009164
613 Ga0495675_0062459
614 Ga0495685_001229
615 Ga0495685_004920
616 Ga0495685_017473
617 Ga0495685_062803
618 Ga0495681_0000288
619 Ga0495681_0059383
620 Ga0495686_0019295
621 Ga0495593_0000828
622 Ga0495593_0006079
623 Ga0495593_0054710
624 Ga0495593_0105720
625 Ga0495602_0057684
626 Ga0495614_0000635
627 Ga0495614_0006259
628 Ga0495614_0024703
629 Ga0495614_0042371
630 Ga0496102_0029202
631 Ga0496116_0000580
632 Ga0496117_0018522
633 Ga0496118_0015627
634 Ga0501032_0022431
635 Ga0501032_0072733
636 Ga0501034_0072941
637 Ga0501037_0002586
638 Ga0501038_0023924
639 Ga0501038_0036303
640 Ga0501039_0145171
641 Ga0501043_0027760
642 Ga0501047_0048191
643 Ga0501070_0029401
644 Ga0501070_0130845
645 Ga0501070_0169025
646 Ga0501073_0114669
647 Ga0501074_0214865
648 Ga0501035_0092798
649 Ga0501044_0006500
650 Ga0501044_0014284
651 nmdc:mga00v17_4022_c1
652 nmdc:mga09592_606489_c1
653 nmdc:mga08y16_416765_c1
654 nmdc:mga0n895_73688_c1
655 Ga0495601_0005483
656 Ga0495619_0044404
657 Ga0500583_0059751
658 Ga0500640_001577
659 Ga0500641_0051967
660 Ga0500654_041599
661 Ga0500553_018821
662 Ga0500553_026638
663 Ga0500569_001401
664 Ga0500652_000538
665 Ga0500658_0000368
666 Ga0500561_0000370
667 Ga0500573_0008687
668 Ga0500573_0067193
669 Ga0500579_089926
670 Ga0500600_0004002
671 Ga0500600_0096217
672 Ga0500616_0003151
673 Ga0500634_0002683
674 Ga0500636_0124720
675 Ga0500587_003314
676 Ga0466962_0003084
677 2508676142
678 2517763532
679 2585308765
680 2585313460
681 2616695101
682 2616902114
683 2643902687
684 2643942135
685 2644262248
686 2644389799
687 2644404805
688 2644429218
689 2644437137
690 2644628876
691 2671832576
692 2671836101
693 2671840125
694 2676205938
695 2689959356
696 2774850513
697 2774850732
698 2774854257
699 2774858281
700 2785343342
701 2785369473
702 2786670579
703 2793983931
704 2808842033
705 2808920548
706 2811849003
707 2812358135
708 2852636705
709 2862181856
710 2862285620
711 2862295519
712 2862579279
713 2863404642
714 2867480573
715 2873155757
716 2875395847
717 2877681136
718 2912719987
719 2918505675
720 2919469541
721 2935393876
722 2946048781
723 2946067706
724 2946075888
725 2947229262
726 2954007447
727 2954386269
728 2954676899
729 2954687259
730 2954696906
731 2954705229
732 2954716277
733 2954726219
734 2954735591
735 2954745144
736 2954754447
737 2954764118
738 2990066456
739 2995465822
740 2995466676
741 2997458303
742 2997601431
743 3006492723
744 8002780165
745 8002789376
746 8008567334
747 8025479002
748 8047896878
749 8048362072
750 8048373863
751 8048384365
752 8048412781
753 8054164188
754 8056672865
755 8056831726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

23

145

0.91

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

185

316

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

218

351

0.79

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

151

352

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a72-assembly1.cif.gz_A-2 an active-site double mutant (phe93->trp, val203->ala) of horse liver alcohol dehydrogenase in complex with the isosteric nad analog cpad 0.9506 2 349
5tnx-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria 0.9504 2 349
1axg-assembly2.cif.gz_D crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution 0.9459 2 349
1a72-assembly1.cif.gz_A-2 an active-site double mutant (phe93->trp, val203->ala) of horse liver alcohol dehydrogenase in complex with the isosteric nad analog cpad 0.9454 2 349
5tnx-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria 0.9451 2 349
ID Description Score Start End Superfamily
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9523 170 289 3.40.50.720
af_K7MH10_157_229_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9497 162 226 3.90.180.10
af_A1L4Y2_14_383_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9478 5 343 3.90.180.10
6adhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 162 292 3.40.50.720
5tnxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9425 162 291 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M1GX83-F1-model_v4 Zinc-binding dehydrogenase 0.9781 130 349 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A4V1UEY3-F1-model_v4 Alcohol dehydrogenase 0.9774 159 349 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A351XC68-F1-model_v4 Alcohol dehydrogenase 0.9737 125 349 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A0U1D8C3-F1-model_v4 Alcohol dehydrogenase 0.9711 114 279 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A6I2ZE13-F1-model_v4 Zinc-binding dehydrogenase 0.968 154 349 GO:0005829
GO:0008270
GO:0046294
GO:0051903

Map