F427548

General Info

Members Datasets Scaffolds Average Seq Length
376 256 342 334

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2941485952|2941489383
Length 397
Sequence DYYEILGVERTIDAPGLKAAYRKLAMIHHPDRNGGSEESLAQFKEISEAYTVLSDDQKRAAYDRFGHAGVNGGAGGGDPFGRGGAGFHDINDIFSQVFGDAFGDAFGGRGGRQQQGGPRRGSDLRYDLEISLEQAYKGSEVEIAVPTTMTCEVCDGSGAKAGTKPTICSTCGGAGRVRQANGFFQVERTCPRCSGSGEMISDPCPNCRGHGQVRKTRNLSLKVPAGVDDGSRIRLSGEGEAGQRGGPRGDLYVFLSVKPHELFERDNLDLLVTVPVPMTVAALGGIVDAPCLISDACDGKCKAAVDVPAGAQTGKTVRIKGKGMPHLNGRQRGDLVVELFVETPTDLTARQKELMQELAASFGESQSPRNSSFAGKARRFWADILGGDADNSKETAA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
17 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
32 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
33 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
175 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
249 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
250 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.89
Metatranscriptomes 1.06
Isolates 9.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.76
Nodule 0
Rhizoplane 1.33
Rhizosphere 72.87
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000781 3300003781 Bacteria 21243
2 Ga0055528_1013283 3300003790 Bacteria 3130
3 Ga0055531_10006840 3300003794 Bacteria 6361
4 Ga0055531_10006886 3300003794 Bacteria 6338
5 Ga0065165_1004269 3300005262 Bacteria 9029
6 Ga0070658_10057327 3300005327 Bacteria 3168
7 Ga0070670_100020175 3300005331 Bacteria 5726
8 Ga0068869_100009057 3300005334 Bacteria 6450
9 Ga0070660_100040304 3300005339 Bacteria 3554
10 Ga0070689_100059407 3300005340 Bacteria 2972
11 Ga0070687_100025978 3300005343 Bacteria 2815
12 Ga0070668_100003206 3300005347 Bacteria 12052
13 Ga0070668_100054463 3300005347 Bacteria 3085
14 Ga0070668_100187685 3300005347 Bacteria 1692
15 Ga0070669_100013981 3300005353 Bacteria 5708
16 Ga0070671_100026686 3300005355 Bacteria 4750
17 Ga0070674_100003784 3300005356 Bacteria 8545
18 Ga0070688_100012985 3300005365 Bacteria 4686
19 Ga0070659_100003009 3300005366 Bacteria 11993
20 Ga0070659_100003130 3300005366 Bacteria 11777
21 Ga0070667_100003113 3300005367 Bacteria 14260
22 Ga0070703_10000958 3300005406 Bacteria 9158
23 Ga0070701_10005709 3300005438 Bacteria 5170
24 Ga0070700_100129254 3300005441 Bacteria 1702
25 Ga0070708_100029459 3300005445 Bacteria 4734
26 Ga0070708_100095369 3300005445 Bacteria 2716
27 Ga0070708_100158664 3300005445 Bacteria 2107
28 Ga0070678_100267001 3300005456 Bacteria 1442
29 Ga0070662_100162876 3300005457 Bacteria 1746
30 Ga0070681_10067033 3300005458 Bacteria 3559
31 Ga0068867_100008693 3300005459 Bacteria 7169
32 Ga0070685_10025498 3300005466 Bacteria 3256
33 Ga0070706_100000092 3300005467 Bacteria 107608
34 Ga0070706_100008788 3300005467 Bacteria 9413
35 Ga0070706_100014206 3300005467 Bacteria 7357
36 Ga0070706_100018589 3300005467 Bacteria 6407
37 Ga0070706_100368800 3300005467 Bacteria 1337
38 Ga0070707_100127074 3300005468 Bacteria 2477
39 Ga0070698_100050770 3300005471 Bacteria 4226
40 Ga0070698_100254525 3300005471 Bacteria 1688
41 Ga0070679_100118470 3300005530 Bacteria 2632
42 Ga0068853_100016626 3300005539 Bacteria 6058
43 Ga0070672_100024318 3300005543 Bacteria 4474
44 Ga0070665_100000395 3300005548 Bacteria 64323
45 Ga0070665_100000455 3300005548 Bacteria 59653
46 Ga0070665_100162864 3300005548 Bacteria 2233
47 Ga0068855_100070696 3300005563 Bacteria 4060
48 Ga0068855_100127044 3300005563 Bacteria 2914
49 Ga0068855_100153593 3300005563 Bacteria 2616
50 Ga0068856_100331731 3300005614 Bacteria 1539
51 Ga0068852_100514296 3300005616 Bacteria 1194
52 Ga0068859_100003295 3300005617 Bacteria 16418
53 Ga0068859_100038518 3300005617 Bacteria 4796
54 Ga0068861_100008022 3300005719 Bacteria 7264
55 Ga0068861_100085148 3300005719 Bacteria 2482
56 Ga0068863_100004552 3300005841 Bacteria 13671
57 Ga0068863_100045009 3300005841 Bacteria 4188
58 Ga0068858_100003176 3300005842 Bacteria 16435
59 Ga0068858_100004351 3300005842 Bacteria 13897
60 Ga0068860_100042557 3300005843 Bacteria 4336
61 Ga0068860_100221538 3300005843 Bacteria 1837
62 Ga0068860_100254820 3300005843 Bacteria 1709
63 Ga0068862_100033338 3300005844 Bacteria 4352
64 Ga0068862_100065099 3300005844 Bacteria 3139
65 Ga0075365_10024106 3300006038 Bacteria 3834
66 Ga0075368_10031019 3300006042 Bacteria 2072
67 Ga0075364_10014938 3300006051 Bacteria 4806
68 Ga0075362_10004352 3300006177 Bacteria 5075
69 Ga0075367_10084508 3300006178 Bacteria 1924
70 Ga0075369_10005443 3300006186 Bacteria 4758
71 Ga0075366_10003497 3300006195 Bacteria 8298
72 Ga0097621_100076029 3300006237 Bacteria 2785
73 Ga0075370_10065671 3300006353 Bacteria 2069
74 Ga0075428_100050422 3300006844 Bacteria 4565
75 Ga0075433_10020136 3300006852 Bacteria 5572
76 Ga0075433_10128187 3300006852 Bacteria 2254
77 Ga0075434_100085600 3300006871 Bacteria 3152
78 Ga0075429_100000939 3300006880 Bacteria 23055
79 Ga0068865_100000097 3300006881 Bacteria 45492
80 Ga0068865_100003025 3300006881 Bacteria 10046
81 Ga0075436_100032298 3300006914 Bacteria 3608
82 Ga0075436_100203146 3300006914 Bacteria 1404
83 Ga0097620_100003295 3300006931 Bacteria 16418
84 Ga0097620_100038518 3300006931 Bacteria 4796
85 Ga0075435_100006446 3300007076 Bacteria 8301
86 Ga0105240_10002017 3300009093 Bacteria 33485
87 Ga0105240_10002691 3300009093 Bacteria 28287
88 Ga0105240_10011750 3300009093 Bacteria 12165
89 Ga0105240_10058975 3300009093 Bacteria 4791
90 Ga0105240_10138394 3300009093 Bacteria 2913
91 Ga0105240_10229657 3300009093 Bacteria 2158
92 Ga0111539_10078256 3300009094 Bacteria 3890
93 Ga0114129_10003485 3300009147 Bacteria 22123
94 Ga0114129_10160514 3300009147 Bacteria 3071
95 Ga0105243_10051531 3300009148 Bacteria 3256
96 Ga0105242_10051979 3300009176 Bacteria 3342
97 Ga0105248_10005133 3300009177 Bacteria 14449
98 Ga0105248_10039140 3300009177 Bacteria 5309
99 Ga0105248_10049048 3300009177 Bacteria 4736
100 Ga0105238_10195518 3300009551 Bacteria 1998
101 Ga0105238_10287542 3300009551 Bacteria 1626
102 Ga0105249_10058840 3300009553 Bacteria 3523
103 Ga0105249_10107720 3300009553 Bacteria 2630
104 Ga0105239_10075238 3300010375 Bacteria 3712
105 Ga0157373_10001577 3300013100 Bacteria 17397
106 Ga0157373_10001686 3300013100 Bacteria 16857
107 Ga0157370_10083012 3300013104 Bacteria 3013
108 Ga0163162_10091595 3300013306 Bacteria 3123
109 Ga0163162_10236786 3300013306 Bacteria 1956
110 Ga0157372_10258513 3300013307 Bacteria 2022
111 Ga0157375_10011042 3300013308 Bacteria 7963
112 Ga0163163_10004254 3300014325 Bacteria 12201
113 Ga0163163_10009532 3300014325 Bacteria 8675
114 Ga0163163_10152208 3300014325 Bacteria 2357
115 Ga0157380_10041974 3300014326 Bacteria 3573
116 Ga0157377_10162379 3300014745 Bacteria 1391
117 Ga0157379_10001114 3300014968 Bacteria 21987
118 Ga0163161_10022873 3300017792 Bacteria 4404
119 Ga0213872_10001556 3300021361 Bacteria 14690
120 Ga0213872_10037755 3300021361 Bacteria 2206
121 Ga0213872_10053181 3300021361 Bacteria 1837
122 Ga0213876_10000257 3300021384 Bacteria 49797
123 Ga0213875_10064823 3300021388 Unclassified 1707
124 Ga0209565_1000172 3300025263 Bacteria 84264
125 Ga0209673_1001352 3300025273 Bacteria 24446
126 Ga0209675_1011734 3300025291 Bacteria 2883
127 Ga0209676_1000140 3300025292 Bacteria 176735
128 Ga0209676_1000257 3300025292 Bacteria 112662
129 Ga0209676_1000316 3300025292 Bacteria 94380
130 Ga0209564_1004716 3300025295 Bacteria 8173
131 Ga0209564_1012100 3300025295 Bacteria 3794
132 Ga0209564_1018094 3300025295 Bacteria 2707
133 Ga0209758_1010218 3300025297 Bacteria 5659
134 Ga0209758_1024833 3300025297 Bacteria 2655
135 Ga0209050_1000604 3300025298 Bacteria 57101
136 Ga0209050_1001151 3300025298 Bacteria 31696
137 Ga0209256_1001634 3300025299 Bacteria 21832
138 Ga0209256_1002224 3300025299 Bacteria 16569
139 Ga0209256_1016437 3300025299 Bacteria 2522
140 Ga0209051_1001962 3300025303 Bacteria 15823
141 Ga0209257_1000192 3300025304 Bacteria 151851
142 Ga0209257_1000630 3300025304 Bacteria 56658
143 Ga0209257_1001221 3300025304 Bacteria 32172
144 Ga0207653_10000152 3300025885 Bacteria 48572
145 Ga0207705_10002818 3300025909 Bacteria 13290
146 Ga0207705_10119521 3300025909 Bacteria 1954
147 Ga0207705_10167756 3300025909 Bacteria 1652
148 Ga0207684_10000101 3300025910 Bacteria 162786
149 Ga0207684_10002564 3300025910 Bacteria 18227
150 Ga0207707_10069312 3300025912 Bacteria 3074
151 Ga0207695_10000269 3300025913 Bacteria 130183
152 Ga0207695_10000731 3300025913 Bacteria 63833
153 Ga0207695_10000886 3300025913 Bacteria 54376
154 Ga0207695_10003640 3300025913 Bacteria 21532
155 Ga0207695_10010664 3300025913 Bacteria 11225
156 Ga0207695_10101051 3300025913 Bacteria 2879
157 Ga0207695_10267223 3300025913 Bacteria 1607
158 Ga0207660_10002308 3300025917 Bacteria 12571
159 Ga0207662_10000991 3300025918 Bacteria 13244
160 Ga0207657_10000235 3300025919 Bacteria 58394
161 Ga0207652_10003592 3300025921 Bacteria 12780
162 Ga0207646_10023331 3300025922 Bacteria 5684
163 Ga0207681_10010520 3300025923 Bacteria 5667
164 Ga0207694_10162219 3300025924 Bacteria 1806
165 Ga0207650_10060396 3300025925 Bacteria 2829
166 Ga0207644_10001622 3300025931 Bacteria 14498
167 Ga0207690_10000031 3300025932 Bacteria 154724
168 Ga0207706_10049301 3300025933 Bacteria 3721
169 Ga0207686_10027294 3300025934 Bacteria 3342
170 Ga0207709_10113847 3300025935 Bacteria 1814
171 Ga0207670_10050130 3300025936 Bacteria 2796
172 Ga0207669_10038529 3300025937 Bacteria 2753
173 Ga0207704_10003933 3300025938 Bacteria 6753
174 Ga0207704_10023104 3300025938 Bacteria 3345
175 Ga0207691_10005666 3300025940 Bacteria 12072
176 Ga0207711_10000331 3300025941 Bacteria 50472
177 Ga0207711_10003371 3300025941 Bacteria 13845
178 Ga0207667_10018916 3300025949 Bacteria 7705
179 Ga0207667_10039668 3300025949 Bacteria 5017
180 Ga0207667_10048506 3300025949 Bacteria 4490
181 Ga0207667_10057433 3300025949 Bacteria 4085
182 Ga0207667_10161799 3300025949 Bacteria 2302
183 Ga0207651_10042651 3300025960 Bacteria 3022
184 Ga0207712_10090093 3300025961 Bacteria 2256
185 Ga0207668_10000013 3300025972 Bacteria 167989
186 Ga0207668_10002317 3300025972 Bacteria 11116
187 Ga0207668_10016133 3300025972 Bacteria 4656
188 Ga0207658_10003465 3300025986 Bacteria 11158
189 Ga0207658_10075031 3300025986 Bacteria 2571
190 Ga0207658_10131246 3300025986 Bacteria 2013
191 Ga0207703_10027208 3300026035 Bacteria 4503
192 Ga0207703_10292983 3300026035 Bacteria 1482
193 Ga0207708_10002757 3300026075 Bacteria 12910
194 Ga0207641_10003219 3300026088 Bacteria 14603
195 Ga0207641_10024105 3300026088 Bacteria 5015
196 Ga0207648_10062967 3300026089 Bacteria 3233
197 Ga0207675_100002664 3300026118 Bacteria 17612
198 Ga0207675_100131448 3300026118 Bacteria 2374
199 Ga0207698_10167228 3300026142 Bacteria 1932
200 Ga0207698_10200436 3300026142 Bacteria 1787
201 Ga0207698_10243749 3300026142 Bacteria 1640
202 Ga0209999_1004433 3300027543 Bacteria 2525
203 Ga0207428_10000085 3300027907 Bacteria 132411
204 Ga0268266_10000003 3300028379 Bacteria 1701703
205 Ga0268266_10008872 3300028379 Bacteria 8900
206 Ga0268265_10004678 3300028380 Bacteria 9454
207 Ga0268265_10030768 3300028380 Bacteria 3870
208 Ga0268265_10121160 3300028380 Bacteria 2155
209 Ga0268264_10015869 3300028381 Bacteria 6168
210 Ga0268264_10086939 3300028381 Bacteria 2687
211 Ga0265338_10011163 3300028800 Bacteria 10413
212 Ga0265338_10132040 3300028800 Bacteria 1970
213 Ga0265327_10005496 3300031251 Bacteria 10548
214 Ga0307513_10061317 3300031456 Bacteria 3982
215 Ga0316579_10000706 3300031691 Bacteria 11398
216 Ga0316576_10051089 3300031727 Bacteria 3008
217 Ga0316576_10062891 3300031727 Bacteria 2723
218 Ga0316578_10045440 3300031728 Bacteria 2557
219 Ga0316577_10013345 3300031733 Unclassified 4490
220 Ga0316577_10061159 3300031733 Bacteria 2102
221 Ga0307406_10002099 3300031901 Bacteria 10866
222 Ga0307409_100174992 3300031995 Bacteria 1893
223 Ga0307411_10102536 3300032005 Bacteria 2028
224 Ga0316585_10008499 3300032137 Bacteria 2981
225 Ga0316593_10006101 3300032168 Bacteria 3233
226 Ga0316593_10042346 3300032168 Bacteria 1519
227 Ga0307510_10021666 3300033180 Bacteria 7486
228 Ga0316592_1006763 3300033524 Bacteria 2219
229 Ga0316596_1025242 3300033541 Bacteria 1528
230 Ga0316574_0040682 3300035398 Bacteria 2863
231 Ga0316584_0010233 3300036712 Bacteria 6550
232 Ga0316584_0011617 3300036712 Bacteria 6193
233 Ga0316584_0147117 3300036712 Bacteria 1755
234 Ga0373925_0000653 3300037068 Bacteria 32591
235 Ga0373925_0283826 3300037068 Bacteria 1334
236 Ga0395899_0000003 3300037312 Bacteria 1232684
237 Ga0395905_0046133 3300037471 Bacteria 4086
238 Ga0316581_0002233 3300037588 Bacteria 4581
239 Ga0436364_0421806 3300037853 Bacteria 4707
240 Ga0436364_1317829 3300037853 Bacteria 2524
241 Ga0436365_1884511 3300039437 Bacteria 98004
242 Ga0436360_0965484 3300039438 Bacteria 1673
243 Ga0436361_0335358 3300039447 Bacteria 1472
244 Ga0436361_1216728 3300039447 Bacteria 7117
245 Ga0439435_0008883 3300042436 Bacteria 2342
246 Ga0450901_001074 3300042533 Bacteria 3174
247 Ga0466957_0102156 3300044842 Bacteria 1809
248 Ga0495617_054002 3300046452 Bacteria 1334
249 Ga0495627_000655 3300046453 Bacteria 26680
250 Ga0495590_0002453 3300046457 Bacteria 7679
251 Ga0495638_0001762 3300046460 Bacteria 18966
252 Ga0495638_0002056 3300046460 Bacteria 17093
253 Ga0495638_0010173 3300046460 Bacteria 6550
254 Ga0495638_0176259 3300046460 Bacteria 1223
255 Ga0495650_0000468 3300046471 Bacteria 62149
256 Ga0495639_0078963 3300046475 Bacteria 1530
257 Ga0495607_0063880 3300046501 Bacteria 2081
258 Ga0495606_0025997 3300046507 Bacteria 4178
259 Ga0495606_0085614 3300046507 Bacteria 1949
260 Ga0495610_0000816 3300046512 Bacteria 29254
261 Ga0495610_0001843 3300046512 Bacteria 18385
262 Ga0495610_0005585 3300046512 Bacteria 8885
263 Ga0495616_0000405 3300046513 Bacteria 33255
264 Ga0495620_0020614 3300046515 Bacteria 3218
265 Ga0495637_0008713 3300046520 Bacteria 4973
266 Ga0495648_0000107 3300046524 Bacteria 104376
267 Ga0495654_0000199 3300046530 Bacteria 58450
268 Ga0495621_0019526 3300046539 Bacteria 2215
269 Ga0495668_0002308 3300046616 Bacteria 15974
270 Ga0495668_0009263 3300046616 Bacteria 6054
271 Ga0495668_0028307 3300046616 Bacteria 3169
272 Ga0495625_0000707 3300046660 Bacteria 47153
273 Ga0495625_0026812 3300046660 Bacteria 4346
274 Ga0495669_0000007 3300046684 Bacteria 180797
275 Ga0495649_0000118 3300046694 Bacteria 69833
276 Ga0495660_0041562 3300046810 Bacteria 2544
277 Ga0495672_0002176 3300047320 Bacteria 18259
278 Ga0495672_0069935 3300047320 Bacteria 1991
279 Ga0495673_0000209 3300047469 Bacteria 88818
280 Ga0495673_0001113 3300047469 Bacteria 23132
281 Ga0495673_0007297 3300047469 Bacteria 6380
282 Ga0495686_0001170 3300047472 Bacteria 30668
283 Ga0495686_0005219 3300047472 Bacteria 10324
284 Ga0495686_0006039 3300047472 Bacteria 9399
285 Ga0495686_0006577 3300047472 Bacteria 8866
286 Ga0495686_0084033 3300047472 Bacteria 1940
287 Ga0496106_0227423 3300048909 Bacteria 1489
288 Ga0496112_0061880 3300048915 Bacteria 3691
289 Ga0496115_0000434 3300048918 Bacteria 33932
290 Ga0496115_0008759 3300048918 Bacteria 7498
291 Ga0496115_0088752 3300048918 Bacteria 2525
292 Ga0496124_0058198 3300048927 Bacteria 3252
293 Ga0496125_0005019 3300048928 Bacteria 14945
294 Ga0496125_0075378 3300048928 Bacteria 2611
295 Ga0496125_0098774 3300048928 Bacteria 2159
296 Ga0496126_0005571 3300048929 Bacteria 14323
297 Ga0495678_002955 3300049459 Bacteria 10860
298 Ga0501047_0069631 3300049581 Bacteria 3388
299 Ga0501047_0089353 3300049581 Bacteria 2958
300 Ga0501047_0308307 3300049581 Bacteria 1424
301 Ga0501044_0038888 3300049823 Bacteria 4967
302 Ga0501044_0215301 3300049823 Bacteria 1874
303 nmdc:mga00v17_44063_c1 3300050491 Bacteria 2689
304 nmdc:mga0k408_1088_c1 3300050493 Bacteria 14895
305 nmdc:mga06z11_14930_c1 3300050494 Bacteria 3453
306 nmdc:mga07m45_52064_c2 3300050496 Bacteria 2016
307 nmdc:mga05p37_5995_c1 3300050507 Bacteria 14306
308 nmdc:mga09592_498_c1 3300050508 Bacteria 27783
309 nmdc:mga06r32_1824_c1 3300050510 Bacteria 19019
310 nmdc:mga06r32_198670_c1 3300050510 Bacteria 1993
311 nmdc:mga08y16_739_c1 3300050511 Bacteria 31074
312 nmdc:mga0rr50_4458_c1 3300050513 Bacteria 8241
313 nmdc:mga08x19_23967_c1 3300050514 Bacteria 3788
314 nmdc:mga0a205_325559_c1 3300050515 Bacteria 1407
315 nmdc:mga0a205_4740_c1 3300050515 Bacteria 12217
316 nmdc:mga0a205_85801_c1 3300050515 Bacteria 3040
317 nmdc:mga0sz30_2216_c1 3300050516 Bacteria 6944
318 Ga0500578_0000015 3300053086 Bacteria 179217
319 Ga0500643_004978 3300053087 Bacteria 5838
320 Ga0500644_0000305 3300053088 Bacteria 25991
321 Ga0500644_0004840 3300053088 Bacteria 3383
322 Ga0500554_016196 3300053102 Bacteria 1965
323 Ga0500556_0001597 3300053104 Bacteria 9005
324 Ga0500562_000512 3300053108 Bacteria 9380
325 Ga0500562_004801 3300053108 Bacteria 3405
326 Ga0500594_0000064 3300053118 Bacteria 33313
327 Ga0500595_004029 3300053119 Bacteria 6697
328 Ga0500608_000011 3300053122 Bacteria 92215
329 Ga0500608_063176 3300053122 Bacteria 1767
330 Ga0500618_000366 3300053125 Bacteria 31428
331 Ga0500658_0035773 3300053134 Bacteria 1967
332 Ga0500559_0000009 3300053136 Bacteria 174153
333 Ga0500559_0007112 3300053136 Bacteria 4989
334 Ga0500564_000037 3300053138 Bacteria 36834
335 Ga0500573_0028040 3300053140 Bacteria 3241
336 Ga0500577_0000575 3300053142 Bacteria 9472
337 Ga0500588_0012932 3300053146 Bacteria 2083
338 Ga0500616_0017064 3300053153 Bacteria 4122
339 Ga0500622_0000840 3300053156 Bacteria 26274
340 Ga0500627_0022300 3300053158 Bacteria 2566
341 Ga0500636_0010696 3300053177 Bacteria 5357
342 Ga0500645_006567 3300053730 Bacteria 4130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100158664 Ga0070708_1001586643 272
2 3300031728 Ga0316578_10045440 Ga0316578_100454402 275
3 3300031733 Ga0316577_10013345 Ga0316577_100133452 275
4 3300036712 Ga0316584_0010233 Ga0316584_0010233_4031_5155 275
5 3300046475 Ga0495639_0078963 Ga0495639_0078963_359_1480 275
6 3300033180 Ga0307510_10021666 Ga0307510_100216663 276
7 3300053146 Ga0500588_0012932 Ga0500588_0012932_592_1707 276
8 3300005467 Ga0070706_100368800 Ga0070706_1003688001 277
9 3300005471 Ga0070698_100050770 Ga0070698_1000507702 277
10 3300036712 Ga0316584_0147117 Ga0316584_0147117_338_1462 277
11 3300005406 Ga0070703_10000958 Ga0070703_100009584 278
12 3300005467 Ga0070706_100000092 Ga0070706_10000009251 278
13 3300025885 Ga0207653_10000152 Ga0207653_1000015232 278
14 3300025910 Ga0207684_10000101 Ga0207684_1000010180 278
15 3300005563 Ga0068855_100070696 Ga0068855_1000706962 280
16 3300009093 Ga0105240_10002691 Ga0105240_100026914 280
17 3300009093 Ga0105240_10011750 Ga0105240_100117502 280
18 3300025913 Ga0207695_10000731 Ga0207695_1000073117 280
19 3300025913 Ga0207695_10003640 Ga0207695_1000364027 280
20 3300025949 Ga0207667_10057433 Ga0207667_100574333 280
21 3300005563 Ga0068855_100153593 Ga0068855_1001535931 282
22 3300025949 Ga0207667_10048506 Ga0207667_100485061 282
23 3300037068 Ga0373925_0283826 Ga0373925_0283826_101_1252 282
24 3300039438 Ga0436360_0965484 Ga0436360_0965484_268_1398 282
25 3300046457 Ga0495590_0002453 Ga0495590_0002453_1701_2849 282
26 3300046460 Ga0495638_0001762 Ga0495638_0001762_721_1869 282
27 3300046512 Ga0495610_0005585 Ga0495610_0005585_7108_8256 282
28 3300046616 Ga0495668_0009263 Ga0495668_0009263_747_1898 282
29 3300046660 Ga0495625_0000707 Ga0495625_0000707_22661_23809 282
30 3300047472 Ga0495686_0001170 Ga0495686_0001170_23771_24919 282
31 3300049459 Ga0495678_002955 Ga0495678_002955_2167_3315 282
32 3300053086 Ga0500578_0000015 Ga0500578_0000015_67521_68669 282
33 3300053108 Ga0500562_004801 Ga0500562_004801_807_1955 282
34 3300053118 Ga0500594_0000064 Ga0500594_0000064_24555_25703 282
35 3300053136 Ga0500559_0000009 Ga0500559_0000009_144885_146033 282
36 3300053156 Ga0500622_0000840 Ga0500622_0000840_7022_8170 282
37 3300013306 Ga0163162_10236786 Ga0163162_102367861 283
38 3300003794 Ga0055531_10006840 Ga0055531_100068402 284
39 3300005445 Ga0070708_100095369 Ga0070708_1000953693 284
40 3300025304 Ga0209257_1000192 Ga0209257_1000192121 284
41 3300031691 Ga0316579_10000706 Ga0316579_100007069 284
42 3300031727 Ga0316576_10051089 Ga0316576_100510892 284
43 3300032137 Ga0316585_10008499 Ga0316585_100084992 284
44 3300032168 Ga0316593_10006101 Ga0316593_100061012 284
45 3300036712 Ga0316584_0011617 Ga0316584_0011617_202_1326 284
46 3300037588 Ga0316581_0002233 Ga0316581_0002233_159_1283 284
47 3300042436 Ga0439435_0008883 Ga0439435_0008883_878_2029 284
48 3300047472 Ga0495686_0006039 Ga0495686_0006039_1487_2641 284
49 3300025297 Ga0209758_1024833 Ga0209758_10248334 285
50 3300031456 Ga0307513_10061317 Ga0307513_100613173 285
51 3300039447 Ga0436361_0335358 Ga0436361_0335358_371_1456 285
52 3300046452 Ga0495617_054002 Ga0495617_054002_61_1212 285
53 3300053102 Ga0500554_016196 Ga0500554_016196_126_1277 285
54 3300010375 Ga0105239_10075238 Ga0105239_100752385 286
55 3300017792 Ga0163161_10022873 Ga0163161_100228732 286
56 3300025299 Ga0209256_1002224 Ga0209256_10022242 286
57 3300025910 Ga0207684_10002564 Ga0207684_1000256419 286
58 3300046460 Ga0495638_0010173 Ga0495638_0010173_332_1483 286
59 3300046513 Ga0495616_0000405 Ga0495616_0000405_793_1944 286
60 3300053177 Ga0500636_0010696 Ga0500636_0010696_707_1891 286
61 3300046460 Ga0495638_0176259 Ga0495638_0176259_11_1165 287
62 3300046507 Ga0495606_0085614 Ga0495606_0085614_266_1417 287
63 3300046512 Ga0495610_0001843 Ga0495610_0001843_16128_17282 287
64 3300046524 Ga0495648_0000107 Ga0495648_0000107_82918_84066 287
65 3300046539 Ga0495621_0019526 Ga0495621_0019526_789_1949 287
66 3300047469 Ga0495673_0000209 Ga0495673_0000209_80044_81192 287
67 3300047469 Ga0495673_0007297 Ga0495673_0007297_796_1947 287
68 3300048928 Ga0496125_0098774 Ga0496125_0098774_252_1406 287
69 3300048929 Ga0496126_0005571 Ga0496126_0005571_4254_5408 287
70 3300053088 Ga0500644_0000305 Ga0500644_0000305_11305_12453 287
71 3300053108 Ga0500562_000512 Ga0500562_000512_5725_6885 287
72 3300053138 Ga0500564_000037 Ga0500564_000037_7562_8710 287
73 3300006880 Ga0075429_100000939 Ga0075429_10000093910 288
74 3300009147 Ga0114129_10003485 Ga0114129_1000348512 288
75 3300025972 Ga0207668_10002317 Ga0207668_1000231710 288
76 3300028380 Ga0268265_10004678 Ga0268265_100046787 288
77 3300046460 Ga0495638_0002056 Ga0495638_0002056_15134_16282 288
78 3300050507 nmdc:mga05p37_5995_c1 nmdc:mga05p37_5995_c1_7669_8790 288
79 3300050508 nmdc:mga09592_498_c1 nmdc:mga09592_498_c1_17737_18858 288
80 3300050510 nmdc:mga06r32_198670_c1 nmdc:mga06r32_198670_c1_210_1331 288
81 3300053122 Ga0500608_000011 Ga0500608_000011_82553_83713 288
82 3300053122 Ga0500608_063176 Ga0500608_063176_583_1734 288
83 3300003790 Ga0055528_1013283 Ga0055528_10132833 289
84 3300003794 Ga0055531_10006886 Ga0055531_100068865 289
85 3300005262 Ga0065165_1004269 Ga0065165_10042692 289
86 3300006186 Ga0075369_10005443 Ga0075369_100054432 289
87 3300013100 Ga0157373_10001577 Ga0157373_100015772 289
88 3300025263 Ga0209565_1000172 Ga0209565_100017221 289
89 3300025273 Ga0209673_1001352 Ga0209673_100135213 289
90 3300025291 Ga0209675_1011734 Ga0209675_10117342 289
91 3300025292 Ga0209676_1000257 Ga0209676_100025778 289
92 3300025295 Ga0209564_1004716 Ga0209564_10047163 289
93 3300025295 Ga0209564_1018094 Ga0209564_10180943 289
94 3300025297 Ga0209758_1010218 Ga0209758_10102182 289
95 3300025298 Ga0209050_1001151 Ga0209050_10011515 289
96 3300025299 Ga0209256_1001634 Ga0209256_10016342 289
97 3300025304 Ga0209257_1001221 Ga0209257_10012212 289
98 3300037853 Ga0436364_1317829 Ga0436364_1317829_868_2031 289
99 3300046471 Ga0495650_0000468 Ga0495650_0000468_59618_60769 289
100 3300046501 Ga0495607_0063880 Ga0495607_0063880_248_1399 289
101 3300046507 Ga0495606_0025997 Ga0495606_0025997_1902_3056 289
102 3300046512 Ga0495610_0000816 Ga0495610_0000816_27446_28597 289
103 3300046515 Ga0495620_0020614 Ga0495620_0020614_1928_3079 289
104 3300046520 Ga0495637_0008713 Ga0495637_0008713_3799_4950 289
105 3300046530 Ga0495654_0000199 Ga0495654_0000199_793_1944 289
106 3300046616 Ga0495668_0002308 Ga0495668_0002308_13389_14546 289
107 3300046616 Ga0495668_0028307 Ga0495668_0028307_1494_2648 289
108 3300046660 Ga0495625_0026812 Ga0495625_0026812_2547_3698 289
109 3300046694 Ga0495649_0000118 Ga0495649_0000118_24793_25998 289
110 3300046810 Ga0495660_0041562 Ga0495660_0041562_466_1617 289
111 3300047320 Ga0495672_0002176 Ga0495672_0002176_11236_12387 289
112 3300047472 Ga0495686_0005219 Ga0495686_0005219_1362_2513 289
113 3300047472 Ga0495686_0084033 Ga0495686_0084033_552_1706 289
114 3300048918 Ga0496115_0088752 Ga0496115_0088752_1184_2341 289
115 3300048927 Ga0496124_0058198 Ga0496124_0058198_605_1762 289
116 3300050516 nmdc:mga0sz30_2216_c1 nmdc:mga0sz30_2216_c1_3526_4683 289
117 3300053104 Ga0500556_0001597 Ga0500556_0001597_1343_2494 289
118 3300053125 Ga0500618_000366 Ga0500618_000366_8443_9597 289
119 3300053134 Ga0500658_0035773 Ga0500658_0035773_478_1629 289
120 3300053153 Ga0500616_0017064 Ga0500616_0017064_709_1860 289
121 3300053158 Ga0500627_0022300 Ga0500627_0022300_833_1984 289
122 3300053730 Ga0500645_006567 Ga0500645_006567_1127_2278 289
123 3300025295 Ga0209564_1012100 Ga0209564_10121002 290
124 3300025299 Ga0209256_1016437 Ga0209256_10164372 290
125 3300032168 Ga0316593_10042346 Ga0316593_100423461 290
126 3300046453 Ga0495627_000655 Ga0495627_000655_15_1163 290
127 3300047469 Ga0495673_0001113 Ga0495673_0001113_9422_10570 290
128 3300053142 Ga0500577_0000575 Ga0500577_0000575_7478_8629 290
129 3300014325 Ga0163163_10152208 Ga0163163_101522081 291
130 3300031733 Ga0316577_10061159 Ga0316577_100611592 291
131 3300037068 Ga0373925_0000653 Ga0373925_0000653_17748_18899 291
132 3300046684 Ga0495669_0000007 Ga0495669_0000007_119003_120157 291
133 3300049581 Ga0501047_0069631 Ga0501047_0069631_984_2123 291
134 3300050510 nmdc:mga06r32_1824_c1 nmdc:mga06r32_1824_c1_17843_18952 291
135 3300053119 Ga0500595_004029 Ga0500595_004029_3559_4719 291
136 3300005347 Ga0070668_100003206 Ga0070668_1000032062 292
137 3300005445 Ga0070708_100029459 Ga0070708_1000294594 292
138 3300005467 Ga0070706_100014206 Ga0070706_1000142062 292
139 3300005467 Ga0070706_100018589 Ga0070706_1000185895 292
140 3300005468 Ga0070707_100127074 Ga0070707_1001270743 292
141 3300005471 Ga0070698_100254525 Ga0070698_1002545252 292
142 3300005548 Ga0070665_100000395 Ga0070665_10000039523 292
143 3300006852 Ga0075433_10128187 Ga0075433_101281873 292
144 3300006914 Ga0075436_100203146 Ga0075436_1002031462 292
145 3300007076 Ga0075435_100006446 Ga0075435_1000064465 292
146 3300021388 Ga0213875_10064823 Ga0213875_100648232 292
147 3300025922 Ga0207646_10023331 Ga0207646_100233314 292
148 3300025972 Ga0207668_10000013 Ga0207668_1000001386 292
149 3300025986 Ga0207658_10003465 Ga0207658_1000346511 292
150 3300028379 Ga0268266_10008872 Ga0268266_100088726 292
151 3300028380 Ga0268265_10121160 Ga0268265_101211601 292
152 3300037853 Ga0436364_0421806 Ga0436364_0421806_516_1640 292
153 3300048928 Ga0496125_0005019 Ga0496125_0005019_2393_3598 292
154 3300050513 nmdc:mga0rr50_4458_c1 nmdc:mga0rr50_4458_c1_4134_5246 292
155 3300050515 nmdc:mga0a205_85801_c1 nmdc:mga0a205_85801_c1_1556_2668 292
156 3300005334 Ga0068869_100009057 Ga0068869_1000090571 293
157 3300005340 Ga0070689_100059407 Ga0070689_1000594071 293
158 3300005343 Ga0070687_100025978 Ga0070687_1000259782 293
159 3300005347 Ga0070668_100187685 Ga0070668_1001876852 293
160 3300005356 Ga0070674_100003784 Ga0070674_1000037842 293
161 3300005365 Ga0070688_100012985 Ga0070688_1000129851 293
162 3300005438 Ga0070701_10005709 Ga0070701_100057092 293
163 3300005441 Ga0070700_100129254 Ga0070700_1001292542 293
164 3300005456 Ga0070678_100267001 Ga0070678_1002670012 293
165 3300005457 Ga0070662_100162876 Ga0070662_1001628761 293
166 3300005459 Ga0068867_100008693 Ga0068867_1000086935 293
167 3300005466 Ga0070685_10025498 Ga0070685_100254982 293
168 3300005467 Ga0070706_100008788 Ga0070706_1000087886 293
169 3300005543 Ga0070672_100024318 Ga0070672_1000243183 293
170 3300005616 Ga0068852_100514296 Ga0068852_1005142961 293
171 3300005617 Ga0068859_100038518 Ga0068859_1000385185 293
172 3300005719 Ga0068861_100008022 Ga0068861_1000080225 293
173 3300005841 Ga0068863_100045009 Ga0068863_1000450091 293
174 3300005842 Ga0068858_100004351 Ga0068858_1000043517 293
175 3300005843 Ga0068860_100254820 Ga0068860_1002548202 293
176 3300006038 Ga0075365_10024106 Ga0075365_100241062 293
177 3300006042 Ga0075368_10031019 Ga0075368_100310192 293
178 3300006051 Ga0075364_10014938 Ga0075364_100149383 293
179 3300006177 Ga0075362_10004352 Ga0075362_100043523 293
180 3300006178 Ga0075367_10084508 Ga0075367_100845082 293
181 3300006195 Ga0075366_10003497 Ga0075366_100034974 293
182 3300006237 Ga0097621_100076029 Ga0097621_1000760293 293
183 3300006353 Ga0075370_10065671 Ga0075370_100656712 293
184 3300006844 Ga0075428_100050422 Ga0075428_1000504222 293
185 3300006852 Ga0075433_10020136 Ga0075433_100201364 293
186 3300006871 Ga0075434_100085600 Ga0075434_1000856002 293
187 3300006881 Ga0068865_100003025 Ga0068865_1000030252 293
188 3300006914 Ga0075436_100032298 Ga0075436_1000322983 293
189 3300006931 Ga0097620_100038518 Ga0097620_1000385185 293
190 3300009094 Ga0111539_10078256 Ga0111539_100782562 293
191 3300009147 Ga0114129_10160514 Ga0114129_101605143 293
192 3300009148 Ga0105243_10051531 Ga0105243_100515312 293
193 3300009177 Ga0105248_10049048 Ga0105248_100490482 293
194 3300009553 Ga0105249_10058840 Ga0105249_100588404 293
195 3300013308 Ga0157375_10011042 Ga0157375_100110422 293
196 3300014326 Ga0157380_10041974 Ga0157380_100419742 293
197 3300014745 Ga0157377_10162379 Ga0157377_101623792 293
198 3300025918 Ga0207662_10000991 Ga0207662_1000099110 293
199 3300025933 Ga0207706_10049301 Ga0207706_100493012 293
200 3300025935 Ga0207709_10113847 Ga0207709_101138472 293
201 3300025936 Ga0207670_10050130 Ga0207670_100501302 293
202 3300025937 Ga0207669_10038529 Ga0207669_100385293 293
203 3300025938 Ga0207704_10023104 Ga0207704_100231042 293
204 3300025940 Ga0207691_10005666 Ga0207691_100056669 293
205 3300025960 Ga0207651_10042651 Ga0207651_100426514 293
206 3300025986 Ga0207658_10131246 Ga0207658_101312462 293
207 3300026075 Ga0207708_10002757 Ga0207708_100027572 293
208 3300026088 Ga0207641_10024105 Ga0207641_100241054 293
209 3300026089 Ga0207648_10062967 Ga0207648_100629674 293
210 3300026118 Ga0207675_100002664 Ga0207675_10000266413 293
211 3300026142 Ga0207698_10243749 Ga0207698_102437491 293
212 3300027907 Ga0207428_10000085 Ga0207428_10000085108 293
213 3300031727 Ga0316576_10062891 Ga0316576_100628912 293
214 3300033524 Ga0316592_1006763 Ga0316592_10067631 293
215 3300033541 Ga0316596_1025242 Ga0316596_10252422 293
216 3300035398 Ga0316574_0040682 Ga0316574_0040682_93_1217 293
217 3300050491 nmdc:mga00v17_44063_c1 nmdc:mga00v17_44063_c1_230_1339 293
218 3300050493 nmdc:mga0k408_1088_c1 nmdc:mga0k408_1088_c1_1944_3053 293
219 3300050494 nmdc:mga06z11_14930_c1 nmdc:mga06z11_14930_c1_1207_2316 293
220 3300050496 nmdc:mga07m45_52064_c2 nmdc:mga07m45_52064_c2_700_1809 293
221 3300050511 nmdc:mga08y16_739_c1 nmdc:mga08y16_739_c1_27737_28846 293
222 3300050514 nmdc:mga08x19_23967_c1 nmdc:mga08x19_23967_c1_741_1856 293
223 3300050515 nmdc:mga0a205_325559_c1 nmdc:mga0a205_325559_c1_269_1378 293
224 3300050515 nmdc:mga0a205_4740_c1 nmdc:mga0a205_4740_c1_3670_4785 293
225 3300053087 Ga0500643_004978 Ga0500643_004978_3065_4213 293
226 3300005548 Ga0070665_100000455 Ga0070665_10000045554 294
227 3300028379 Ga0268266_10000003 Ga0268266_100000031473 294
228 3300031251 Ga0265327_10005496 Ga0265327_100054965 294
229 3300032005 Ga0307411_10102536 Ga0307411_101025362 294
230 3300037312 Ga0395899_0000003 Ga0395899_0000003_971617_972783 294
231 3300053136 Ga0500559_0007112 Ga0500559_0007112_990_2150 294
232 3300009093 Ga0105240_10002017 Ga0105240_1000201731 295
233 3300021361 Ga0213872_10037755 Ga0213872_100377552 295
234 3300025909 Ga0207705_10167756 Ga0207705_101677561 295
235 3300025913 Ga0207695_10000886 Ga0207695_1000088625 295
236 3300037471 Ga0395905_0046133 Ga0395905_0046133_2045_3205 295
237 3300048928 Ga0496125_0075378 Ga0496125_0075378_1328_2479 295
238 3300028800 Ga0265338_10011163 Ga0265338_100111632 296
239 3300047472 Ga0495686_0006577 Ga0495686_0006577_7624_8787 296
240 3300049581 Ga0501047_0308307 Ga0501047_0308307_156_1307 297
241 3300027543 Ga0209999_1004433 Ga0209999_10044332 298
242 3300048918 Ga0496115_0000434 Ga0496115_0000434_14148_15305 298
243 3300053140 Ga0500573_0028040 Ga0500573_0028040_1194_2393 298
244 iso_pu_bacteria 2510917020 2511121314 298
245 iso_pu_bacteria 2643221583 2643926774 298
246 3300013100 Ga0157373_10001686 Ga0157373_100016862 299
247 3300026142 Ga0207698_10167228 Ga0207698_101672282 299
248 iso_pu_bacteria 2582581279 2585149812 299
249 3300005331 Ga0070670_100020175 Ga0070670_1000201751 300
250 3300005353 Ga0070669_100013981 Ga0070669_1000139814 300
251 3300005355 Ga0070671_100026686 Ga0070671_1000266864 300
252 3300005366 Ga0070659_100003130 Ga0070659_1000031302 300
253 3300005548 Ga0070665_100162864 Ga0070665_1001628642 300
254 3300005617 Ga0068859_100003295 Ga0068859_1000032952 300
255 3300005841 Ga0068863_100004552 Ga0068863_10000455210 300
256 3300005842 Ga0068858_100003176 Ga0068858_10000317611 300
257 3300005843 Ga0068860_100221538 Ga0068860_1002215382 300
258 3300005844 Ga0068862_100033338 Ga0068862_1000333382 300
259 3300006931 Ga0097620_100003295 Ga0097620_1000032952 300
260 3300009093 Ga0105240_10229657 Ga0105240_102296572 300
261 3300009177 Ga0105248_10039140 Ga0105248_100391402 300
262 3300009551 Ga0105238_10195518 Ga0105238_101955181 300
263 3300013306 Ga0163162_10091595 Ga0163162_100915952 300
264 3300014325 Ga0163163_10004254 Ga0163163_100042543 300
265 3300014968 Ga0157379_10001114 Ga0157379_1000111414 300
266 3300025923 Ga0207681_10010520 Ga0207681_100105202 300
267 3300025925 Ga0207650_10060396 Ga0207650_100603961 300
268 3300025931 Ga0207644_10001622 Ga0207644_100016228 300
269 3300025932 Ga0207690_10000031 Ga0207690_1000003165 300
270 3300025941 Ga0207711_10003371 Ga0207711_1000337110 300
271 3300025986 Ga0207658_10075031 Ga0207658_100750312 300
272 3300026035 Ga0207703_10027208 Ga0207703_100272084 300
273 3300026088 Ga0207641_10003219 Ga0207641_100032195 300
274 3300028381 Ga0268264_10015869 Ga0268264_100158692 300
275 3300047320 Ga0495672_0069935 Ga0495672_0069935_161_1318 300
276 3300048918 Ga0496115_0008759 Ga0496115_0008759_5444_6598 300
277 iso_pu_bacteria 2582581280 2585151248 300
278 iso_pu_bacteria 2582581293 2585197117 300
279 iso_pu_bacteria 2643221545 2643747666 300
280 iso_pu_bacteria 2643221552 2643780901 300
281 iso_pu_bacteria 2643221584 2643931896 300
282 iso_pu_bacteria 2643221691 2644506951 300
283 iso_pu_bacteria 2818991435 2819538324 300
284 iso_pu_bacteria 2818991454 2819647106 300
285 3300049581 Ga0501047_0089353 Ga0501047_0089353_621_1772 301
286 3300049823 Ga0501044_0038888 Ga0501044_0038888_2509_3657 301
287 iso_pu_bacteria 2643221598 2643999669 301
288 iso_pu_bacteria 2643221614 2644087656 301
289 iso_pu_bacteria 2643221661 2644344300 301
290 iso_pu_bacteria 2643221666 2644367015 301
291 iso_pu_bacteria 2791355048 2792460831 301
292 iso_pu_bacteria 2843744320 2843745509 301
293 iso_pu_bacteria 2849560528 2849561122 301
294 iso_pu_bacteria 2849573788 2849578588 301
295 iso_pu_bacteria 2851153111 2851157158 301
296 iso_pu_bacteria 2898329390 2898332816 301
297 3300005530 Ga0070679_100118470 Ga0070679_1001184701 302
298 3300006881 Ga0068865_100000097 Ga0068865_10000009710 302
299 3300013307 Ga0157372_10258513 Ga0157372_102585132 302
300 3300025913 Ga0207695_10000269 Ga0207695_1000026957 302
301 3300025913 Ga0207695_10101051 Ga0207695_101010512 302
302 3300025938 Ga0207704_10003933 Ga0207704_100039336 302
303 3300025949 Ga0207667_10161799 Ga0207667_101617992 302
304 iso_pu_bacteria 2585428106 2587919964 302
305 iso_pu_bacteria 2643221640 2644223403 302
306 iso_pu_bacteria 2643221642 2644237145 302
307 iso_pu_bacteria 2857504554 2857505779 302
308 iso_pu_bacteria 2884960567 2884965596 302
309 3300005327 Ga0070658_10057327 Ga0070658_100573272 303
310 3300005339 Ga0070660_100040304 Ga0070660_1000403042 303
311 3300005366 Ga0070659_100003009 Ga0070659_1000030093 303
312 3300005458 Ga0070681_10067033 Ga0070681_100670332 303
313 3300005539 Ga0068853_100016626 Ga0068853_1000166262 303
314 3300005563 Ga0068855_100127044 Ga0068855_1001270442 303
315 3300005614 Ga0068856_100331731 Ga0068856_1003317312 303
316 3300009093 Ga0105240_10058975 Ga0105240_100589752 303
317 3300009551 Ga0105238_10287542 Ga0105238_102875422 303
318 3300013104 Ga0157370_10083012 Ga0157370_100830122 303
319 3300021361 Ga0213872_10001556 Ga0213872_1000155616 303
320 3300021361 Ga0213872_10053181 Ga0213872_100531812 303
321 3300025909 Ga0207705_10002818 Ga0207705_1000281810 303
322 3300025912 Ga0207707_10069312 Ga0207707_100693126 303
323 3300025913 Ga0207695_10010664 Ga0207695_100106646 303
324 3300025913 Ga0207695_10267223 Ga0207695_102672232 303
325 3300025917 Ga0207660_10002308 Ga0207660_100023083 303
326 3300025919 Ga0207657_10000235 Ga0207657_100002353 303
327 3300025921 Ga0207652_10003592 Ga0207652_100035928 303
328 3300025924 Ga0207694_10162219 Ga0207694_101622193 303
329 3300025949 Ga0207667_10018916 Ga0207667_100189162 303
330 3300025949 Ga0207667_10039668 Ga0207667_100396687 303
331 3300026142 Ga0207698_10200436 Ga0207698_102004363 303
332 3300039447 Ga0436361_1216728 Ga0436361_1216728_633_1802 303
333 3300049823 Ga0501044_0215301 Ga0501044_0215301_440_1594 303
334 iso_pu_bacteria 2928531327 2928532105 303
335 3300009093 Ga0105240_10138394 Ga0105240_101383943 304
336 3300009176 Ga0105242_10051979 Ga0105242_100519792 304
337 3300009177 Ga0105248_10005133 Ga0105248_1000513318 304
338 3300014325 Ga0163163_10009532 Ga0163163_100095322 304
339 3300021384 Ga0213876_10000257 Ga0213876_1000025720 304
340 3300025934 Ga0207686_10027294 Ga0207686_100272944 304
341 3300025941 Ga0207711_10000331 Ga0207711_1000033118 304
342 3300039437 Ga0436365_1884511 Ga0436365_1884511_85949_87100 304
343 3300048915 Ga0496112_0061880 Ga0496112_0061880_1814_2968 304
344 3300005347 Ga0070668_100054463 Ga0070668_1000544632 305
345 3300005367 Ga0070667_100003113 Ga0070667_1000031136 305
346 3300005719 Ga0068861_100085148 Ga0068861_1000851482 305
347 3300005843 Ga0068860_100042557 Ga0068860_1000425572 305
348 3300005844 Ga0068862_100065099 Ga0068862_1000650992 305
349 3300009553 Ga0105249_10107720 Ga0105249_101077202 305
350 3300025292 Ga0209676_1000316 Ga0209676_100031621 305
351 3300025298 Ga0209050_1000604 Ga0209050_100060421 305
352 3300025303 Ga0209051_1001962 Ga0209051_10019629 305
353 3300025909 Ga0207705_10119521 Ga0207705_101195213 305
354 3300025961 Ga0207712_10090093 Ga0207712_100900931 305
355 3300025972 Ga0207668_10016133 Ga0207668_100161333 305
356 3300026035 Ga0207703_10292983 Ga0207703_102929831 305
357 3300026118 Ga0207675_100131448 Ga0207675_1001314482 305
358 3300028380 Ga0268265_10030768 Ga0268265_100307683 305
359 3300028381 Ga0268264_10086939 Ga0268264_100869391 305
360 3300028800 Ga0265338_10132040 Ga0265338_101320402 305
361 3300044842 Ga0466957_0102156 Ga0466957_0102156_115_1269 305
362 3300031995 Ga0307409_100174992 Ga0307409_1001749922 307
363 iso_pu_bacteria 2643221574 2643882186 307
364 iso_pu_bacteria 2643221699 2644547792 307
365 3300053088 Ga0500644_0004840 Ga0500644_0004840_1052_2236 308
366 3300048909 Ga0496106_0227423 Ga0496106_0227423_224_1399 309
367 iso_pu_bacteria 2643221663 2644351334 309
368 iso_pu_bacteria 2643221699 2644549119 309
369 iso_pu_bacteria 2928972540 2928974594 309
370 iso_pu_bacteria 2977240413 2977243517 309
371 3300042533 Ga0450901_001074 Ga0450901_001074_754_1962 310
372 iso_pu_bacteria 2941485952 2941489383 310
373 3300031901 Ga0307406_10002099 Ga0307406_1000209912 313
374 3300003781 Ga0055536_1000781 Ga0055536_10007816 314
375 3300025292 Ga0209676_1000140 Ga0209676_1000140104 314
376 3300025304 Ga0209257_1000630 Ga0209257_100063016 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

1

63

0.99

PF00684

DnaJ_CXXCXGXG

DnaJ central domain

151

211

0.96

PF01556

DnaJ_C

DnaJ C terminal domain

124

344

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9653 2 64
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9508 2 64
5ayl-assembly1.cif.gz_A crystal structure of erdj5 form ii 0.9479 2 69
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9478 4 68
6rzy-assembly2.cif.gz_B plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain 0.9436 1 66
ID Description Score Start End Superfamily
af_Q8GUN6_21_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.99 2 67 1.10.287.110
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9892 3 67 1.10.287.110
af_P46997_4_92_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9879 5 67 1.10.287.110
af_Q22138_17_102_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.978 3 67 1.10.287.110
af_Q4DS80_4_96_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9767 3 75 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A0D2S1Y0-F1-model_v4 J domain-containing protein 0.9911 1 75
AF-A0A1R3I0V9-F1-model_v4 Protein kinase domain-containing protein 0.9872 1 72 GO:0004672
GO:0005524
GO:0012505
GO:0016020
AF-A0A3C1BWB0-F1-model_v4 Molecular chaperone DnaJ 0.9865 2 73 GO:0005737
GO:0006260
GO:0044183
GO:0051082
GO:0051087
GO:0061077
AF-A0A3P7L7C8-F1-model_v4 DnaJ homolog subfamily B member 9 (Endoplasmic reticulum DNA J domain-containing protein 4) 0.9865 3 74 GO:0005783
GO:0036503
GO:0051087
GO:0051787
AF-A0A3Q0FCE8-F1-model_v4 Chaperone protein dnaJ 15 isoform X2 0.9853 3 73

Feature Viewer

pLDDT pTM Quality
75.6 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map