F427497

General Info

Members Datasets Scaffolds Average Seq Length
376 250 752 220

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0114225|Ga0501039_0114225_921_1700
Length 259
Sequence MFCSRRWNISSKTSVLLCVEDFGSNAIFEKLVNMPQATVHLLRHGEVHNPDGVLYGRLPEFHLSELGREMARMLAEHFRQRVENGARITYLAASPLDRAQETAAPTAEALRLQIHTDARIIEAENYFEGMKVTKAELRRPRHWPRLVNPLRPSWGEPYKQQAARVMEAVQEARLRAIESADGDFGAAGPEAIMVSHQLPIWATRLSAEGKPLWHDPRKRECTLTSITSLVFDDDGSLLRVHYSEPAASLLPGAASTPGA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
75 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
76 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
77 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
78 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
123 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
124 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
127 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
199 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
200 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
201 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
202 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
203 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
204 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
205 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
206 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
207 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
208 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
209 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
210 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
211 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
212 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
213 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
214 2808606394 Promicromonospora sp. C35 Isolate Unclassified
215 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
216 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
217 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
218 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
219 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
220 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
221 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
222 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
223 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
224 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
225 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
226 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
227 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
228 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
229 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
230 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
231 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
232 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
233 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
234 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
235 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
236 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
237 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
238 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
239 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
240 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
241 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
242 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
243 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
244 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
245 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
246 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
247 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
248 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
249 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
250 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.18
Metatranscriptomes 3.72
Isolates 14.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 6.12
Rhizosphere 81.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0114225 3300049575 Bacteria 2112
2 LJQas_1000522 3300000549 Bacteria 6339
3 LJQas_1002330 3300000549 Bacteria 2659
4 LJQas_1012184 3300000549 Bacteria 1017
5 JGI25152J39213_1000875 3300002773 Bacteria 14817
6 JGI25151J46595_10027567 3300003187 Bacteria 2274
7 rootH1_10020185 3300003316 Bacteria 3028
8 rootL2_10127835 3300003322 Bacteria 1443
9 Ga0006562J51391_1031845 3300003578 Bacteria 1664
10 Ga0055542_1003061 3300003762 Bacteria 4827
11 Ga0065714_10015284 3300005288 Bacteria 2686
12 Ga0065714_10088894 3300005288 Bacteria 1929
13 Ga0065712_10013688 3300005290 Bacteria 1913
14 Ga0070658_10809616 3300005327 Bacteria 814
15 Ga0070670_100102304 3300005331 Bacteria 2467
16 Ga0070677_10013161 3300005333 Bacteria 2887
17 Ga0070680_100835257 3300005336 Bacteria 794
18 Ga0070660_100657392 3300005339 Bacteria 878
19 Ga0070668_100201547 3300005347 Bacteria 1634
20 Ga0070669_100055582 3300005353 Bacteria 2900
21 Ga0070675_100159742 3300005354 Bacteria 1937
22 Ga0070671_100075624 3300005355 Bacteria 2813
23 Ga0070673_100210103 3300005364 Bacteria 1680
24 Ga0070667_100096878 3300005367 Bacteria 2544
25 Ga0070713_100839285 3300005436 Bacteria 882
26 Ga0070678_100152816 3300005456 Bacteria 1861
27 Ga0070681_10791692 3300005458 Bacteria 865
28 Ga0070685_10367090 3300005466 Bacteria 988
29 Ga0070679_100072625 3300005530 Bacteria 3433
30 Ga0070672_100033339 3300005543 Bacteria 3899
31 Ga0070665_100283813 3300005548 Bacteria 1658
32 Ga0068857_100304503 3300005577 Bacteria 1469
33 Ga0070717_10166151 3300006028 Bacteria 1917
34 Ga0075432_10000974 3300006058 Bacteria 9054
35 Ga0105251_10018327 3300009011 Bacteria 3725
36 Ga0105240_10086771 3300009093 Bacteria 3833
37 Ga0105245_10637433 3300009098 Bacteria 1095
38 Ga0114129_10559386 3300009147 Bacteria 1486
39 Ga0105243_10006272 3300009148 Bacteria 9186
40 Ga0105243_10380463 3300009148 Bacteria 1305
41 Ga0105241_10377207 3300009174 Bacteria 1238
42 Ga0105248_10247781 3300009177 Bacteria 2005
43 Ga0105238_10166364 3300009551 Bacteria 2181
44 Ga0105246_10000974 3300011119 Bacteria 16410
45 Ga0105246_10051222 3300011119 Bacteria 2834
46 Ga0105246_10088038 3300011119 Bacteria 2230
47 Ga0105246_10124708 3300011119 Bacteria 1914
48 Ga0105246_10205468 3300011119 Bacteria 1534
49 Ga0157373_10001840 3300013100 Bacteria 16126
50 Ga0157371_10107124 3300013102 Bacteria 1983
51 Ga0157370_10005794 3300013104 Bacteria 13808
52 Ga0157370_10106250 3300013104 Bacteria 2627
53 Ga0157369_10025711 3300013105 Bacteria 6532
54 Ga0157369_10084158 3300013105 Bacteria 3400
55 Ga0157369_10246689 3300013105 Bacteria 1864
56 Ga0157372_10000678 3300013307 Bacteria 37470
57 Ga0157375_10127504 3300013308 Bacteria 2661
58 Ga0182008_10252725 3300014497 Bacteria 910
59 Ga0206353_11422180 3300020082 Bacteria 2906
60 Ga0209148_1005218 3300025254 Bacteria 3021
61 Ga0209129_1000060 3300025258 Bacteria 248262
62 Ga0209025_1002714 3300025294 Bacteria 17986
63 Ga0209051_1009047 3300025303 Bacteria 5185
64 Ga0209051_1010037 3300025303 Bacteria 4820
65 Ga0207697_10002822 3300025315 Bacteria 8840
66 Ga0207697_10004251 3300025315 Bacteria 6877
67 Ga0207655_1018217 3300025728 Bacteria 3741
68 Ga0207655_1028338 3300025728 Bacteria 2644
69 Ga0207713_1064469 3300025735 Bacteria 1379
70 Ga0207682_10003193 3300025893 Bacteria 7172
71 Ga0207688_10097570 3300025901 Bacteria 1693
72 Ga0207645_10017177 3300025907 Bacteria 4778
73 Ga0207652_10084054 3300025921 Bacteria 2788
74 Ga0207681_10202622 3300025923 Bacteria 1524
75 Ga0207650_10290911 3300025925 Bacteria 1332
76 Ga0207700_10499858 3300025928 Bacteria 1076
77 Ga0207644_10384928 3300025931 Bacteria 1144
78 Ga0207686_10434139 3300025934 Bacteria 1007
79 Ga0207709_10007781 3300025935 Bacteria 5940
80 Ga0207709_10141838 3300025935 Bacteria 1653
81 Ga0207709_10159671 3300025935 Bacteria 1571
82 Ga0207669_10009674 3300025937 Bacteria 4608
83 Ga0207691_10012075 3300025940 Bacteria 8283
84 Ga0207711_10399130 3300025941 Bacteria 1277
85 Ga0207679_10636914 3300025945 Bacteria 963
86 Ga0207674_10010189 3300026116 Bacteria 10679
87 Ga0207683_10068631 3300026121 Bacteria 3130
88 Ga0307515_10155340 3300028794 Bacteria 2365
89 Ga0307512_10016122 3300030522 Bacteria 6902
90 Ga0316177_1040018 3300030731 Bacteria 1096
91 Ga0316176_1032373 3300030732 Bacteria 1421
92 Ga0314311_1159901 3300030733 Bacteria 2918
93 Ga0316179_1049299 3300030734 Bacteria 991
94 Ga0316182_1295128 3300030745 Bacteria 1060
95 Ga0265327_10092238 3300031251 Bacteria 1475
96 Ga0307408_100004015 3300031548 Bacteria 10035
97 Ga0307408_100184318 3300031548 Bacteria 1676
98 Ga0307408_100194627 3300031548 Bacteria 1636
99 Ga0307408_100363069 3300031548 Bacteria 1232
100 Ga0307408_100563670 3300031548 Bacteria 1007
101 Ga0307408_100619284 3300031548 Bacteria 964
102 Ga0307514_10136128 3300031649 Bacteria 1681
103 Ga0316576_10002620 3300031727 Bacteria 10287
104 Ga0316576_10013029 3300031727 Bacteria 5511
105 Ga0316578_10090059 3300031728 Bacteria 1831
106 Ga0307405_10003148 3300031731 Bacteria 7508
107 Ga0307405_10048373 3300031731 Bacteria 2622
108 Ga0307405_10069878 3300031731 Bacteria 2253
109 Ga0307405_10091126 3300031731 Bacteria 2019
110 Ga0307405_10141235 3300031731 Bacteria 1679
111 Ga0307405_10402133 3300031731 Bacteria 1072
112 Ga0307413_10018353 3300031824 Bacteria 3669
113 Ga0307413_10021635 3300031824 Bacteria 3448
114 Ga0307413_10029736 3300031824 Bacteria 3061
115 Ga0307413_10100726 3300031824 Bacteria 1908
116 Ga0307413_10138092 3300031824 Bacteria 1680
117 Ga0307413_10173603 3300031824 Bacteria 1528
118 Ga0307413_10263541 3300031824 Bacteria 1286
119 Ga0307410_10017153 3300031852 Bacteria 4339
120 Ga0307410_10037275 3300031852 Bacteria 3174
121 Ga0307410_10042419 3300031852 Bacteria 3007
122 Ga0307410_10075125 3300031852 Bacteria 2355
123 Ga0307410_10144575 3300031852 Bacteria 1763
124 Ga0307410_10145688 3300031852 Bacteria 1757
125 Ga0307410_10173182 3300031852 Bacteria 1628
126 Ga0307410_10180819 3300031852 Bacteria 1596
127 Ga0307406_10056421 3300031901 Bacteria 2515
128 Ga0307406_10171991 3300031901 Bacteria 1569
129 Ga0307407_10013600 3300031903 Bacteria 3956
130 Ga0307407_10047260 3300031903 Bacteria 2441
131 Ga0307407_10073852 3300031903 Bacteria 2039
132 Ga0307407_10081605 3300031903 Bacteria 1958
133 Ga0307407_10216169 3300031903 Bacteria 1293
134 Ga0307412_10010998 3300031911 Bacteria 5227
135 Ga0307412_10083185 3300031911 Bacteria 2218
136 Ga0307412_10094040 3300031911 Bacteria 2104
137 Ga0307412_10105560 3300031911 Bacteria 2001
138 Ga0307412_10164527 3300031911 Bacteria 1652
139 Ga0307412_10209390 3300031911 Bacteria 1486
140 Ga0307412_10725457 3300031911 Bacteria 855
141 Ga0307409_100050931 3300031995 Bacteria 3166
142 Ga0307409_100101119 3300031995 Bacteria 2391
143 Ga0307409_100117259 3300031995 Bacteria 2246
144 Ga0307416_100001499 3300032002 Bacteria 12719
145 Ga0307416_100006057 3300032002 Bacteria 7531
146 Ga0307416_100008827 3300032002 Bacteria 6540
147 Ga0307416_100018723 3300032002 Bacteria 4888
148 Ga0307416_100371938 3300032002 Bacteria 1455
149 Ga0307416_100561166 3300032002 Bacteria 1216
150 Ga0307416_101686549 3300032002 Bacteria 738
151 Ga0307414_10254777 3300032004 Bacteria 1461
152 Ga0307411_10181650 3300032005 Bacteria 1597
153 Ga0307411_10733334 3300032005 Bacteria 864
154 Ga0307415_100344469 3300032126 Bacteria 1252
155 Ga0316593_10222222 3300032168 Bacteria 702
156 Ga0316574_0003913 3300035398 Bacteria 7742
157 Ga0316574_0018924 3300035398 Bacteria 4056
158 Ga0316582_0105065 3300036647 Bacteria 1875
159 Ga0316584_0003561 3300036712 Bacteria 10167
160 Ga0316584_0033149 3300036712 Bacteria 3824
161 Ga0395899_0011021 3300037312 Bacteria 6924
162 Ga0395899_0020238 3300037312 Bacteria 5049
163 Ga0395899_0038017 3300037312 Bacteria 3607
164 Ga0395900_0008527 3300037418 Bacteria 10535
165 Ga0395900_0021190 3300037418 Bacteria 6644
166 Ga0395900_0025564 3300037418 Bacteria 6045
167 Ga0395900_0151578 3300037418 Bacteria 2368
168 Ga0395900_0221670 3300037418 Bacteria 1906
169 Ga0395898_0009705 3300037466 Bacteria 10093
170 Ga0395898_0019107 3300037466 Bacteria 6976
171 Ga0395898_0020656 3300037466 Bacteria 6687
172 Ga0395898_0054323 3300037466 Bacteria 3909
173 Ga0395898_0054719 3300037466 Bacteria 3893
174 Ga0395898_0208716 3300037466 Bacteria 1863
175 Ga0395898_0240803 3300037466 Bacteria 1725
176 Ga0395905_0028840 3300037471 Bacteria 5231
177 Ga0395905_0802902 3300037471 Bacteria 844
178 Ga0395901_0004640 3300038443 Bacteria 13860
179 Ga0395901_0005633 3300038443 Bacteria 12674
180 Ga0395901_0009942 3300038443 Bacteria 9644
181 Ga0395901_0056182 3300038443 Bacteria 4095
182 Ga0395901_0098629 3300038443 Bacteria 3063
183 Ga0395901_0254796 3300038443 Bacteria 1828
184 Ga0395901_0359495 3300038443 Bacteria 1501
185 Ga0439436_0010369 3300041404 Bacteria 2842
186 Ga0439436_0023377 3300041404 Bacteria 1828
187 Ga0439438_039892 3300041405 Bacteria 1221
188 Ga0439439_0000395 3300041406 Bacteria 7240
189 Ga0439439_0009769 3300041406 Bacteria 2288
190 Ga0439461_0004735 3300041410 Bacteria 2286
191 Ga0439466_0016004 3300041411 Bacteria 2716
192 Ga0439465_0012730 3300041413 Bacteria 2630
193 Ga0451797_0029636 3300041453 Bacteria 3411
194 Ga0451837_1751331 3300041494 Bacteria 1028
195 Ga0451843_0768602 3300041509 Bacteria 3100
196 Ga0451853_2080040 3300041512 Bacteria 1376
197 Ga0439431_0018951 3300041997 Bacteria 1632
198 Ga0439433_0004345 3300041999 Bacteria 3056
199 Ga0439433_0005845 3300041999 Bacteria 2643
200 Ga0439433_0013398 3300041999 Bacteria 1800
201 Ga0439442_000091 3300042002 Bacteria 21757
202 Ga0439442_004679 3300042002 Bacteria 2720
203 Ga0439442_019951 3300042002 Bacteria 1388
204 Ga0439449_0012156 3300042007 Bacteria 3236
205 Ga0439449_0039768 3300042007 Bacteria 1748
206 Ga0439449_0080067 3300042007 Bacteria 1204
207 Ga0439452_004426 3300042010 Bacteria 4715
208 Ga0439457_002089 3300042014 Bacteria 5831
209 Ga0439457_002483 3300042014 Bacteria 5254
210 Ga0439462_0016941 3300042015 Bacteria 1886
211 Ga0439462_0023193 3300042015 Bacteria 1626
212 Ga0450911_012164 3300042115 Bacteria 1166
213 Ga0450919_009845 3300042121 Bacteria 1095
214 Ga0450920_000067 3300042122 Bacteria 13305
215 Ga0450920_004164 3300042122 Bacteria 2532
216 Ga0450920_008125 3300042122 Bacteria 1913
217 Ga0450907_000247 3300042146 Bacteria 18621
218 Ga0450907_017920 3300042146 Bacteria 1182
219 Ga0439446_0031970 3300042156 Bacteria 1525
220 Ga0450908_005710 3300042184 Bacteria 2380
221 Ga0450909_002558 3300042185 Bacteria 2576
222 Ga0439434_0000183 3300042435 Bacteria 17117
223 Ga0439434_0051980 3300042435 Bacteria 1271
224 Ga0450918_000853 3300042531 Bacteria 6437
225 Ga0450918_011095 3300042531 Bacteria 1570
226 Ga0466966_0165252 3300044684 Bacteria 1346
227 Ga0466961_0017509 3300044693 Bacteria 4604
228 Ga0466961_0111663 3300044693 Bacteria 1719
229 Ga0466970_0082799 3300044765 Bacteria 1736
230 Ga0466970_0473670 3300044765 Bacteria 719
231 Ga0466957_0424411 3300044842 Bacteria 913
232 Ga0466960_0082160 3300044901 Bacteria 1626
233 Ga0466967_0062990 3300045976 Bacteria 3294
234 Ga0466967_0253501 3300045976 Bacteria 1682
235 Ga0495603_0333873 3300046455 Bacteria 870
236 Ga0495590_0153688 3300046457 Bacteria 835
237 Ga0495641_0034322 3300046461 Bacteria 2399
238 Ga0495653_0050692 3300046463 Bacteria 3191
239 Ga0495580_0017443 3300046472 Bacteria 5370
240 Ga0495580_0199809 3300046472 Bacteria 1378
241 Ga0495582_0098745 3300046473 Bacteria 1634
242 Ga0495582_0183451 3300046473 Bacteria 1193
243 Ga0495639_0239605 3300046475 Bacteria 895
244 Ga0495639_0288439 3300046475 Bacteria 817
245 Ga0495662_0030753 3300046476 Bacteria 2592
246 Ga0495664_0017599 3300046477 Bacteria 4088
247 Ga0495594_0014074 3300046499 Bacteria 4188
248 Ga0495630_0039966 3300046517 Bacteria 3506
249 Ga0495631_0040384 3300046518 Bacteria 2067
250 Ga0495642_0225650 3300046528 Bacteria 818
251 Ga0495665_0008276 3300046531 Bacteria 5637
252 Ga0495665_0077250 3300046531 Bacteria 1752
253 Ga0495586_0003384 3300046535 Bacteria 8552
254 Ga0495586_0012356 3300046535 Bacteria 4529
255 Ga0495586_0024787 3300046535 Bacteria 3208
256 Ga0495587_0019844 3300046536 Bacteria 4154
257 Ga0495645_0063710 3300046543 Bacteria 2669
258 Ga0495645_0207347 3300046543 Bacteria 1325
259 Ga0495667_0012246 3300046559 Bacteria 5812
260 Ga0495656_0012491 3300046615 Bacteria 3135
261 Ga0495634_0368626 3300046642 Bacteria 857
262 Ga0495635_0084280 3300046663 Bacteria 2175
263 Ga0495588_0030832 3300046674 Bacteria 2696
264 Ga0495588_0204813 3300046674 Bacteria 1042
265 Ga0495657_0029958 3300046675 Bacteria 3814
266 Ga0495623_0058067 3300046679 Bacteria 2433
267 Ga0495670_0015926 3300046691 Bacteria 3694
268 Ga0495670_0059499 3300046691 Bacteria 1918
269 Ga0495600_0106125 3300046809 Bacteria 1830
270 Ga0495581_0020666 3300047315 Bacteria 3817
271 Ga0495581_0066053 3300047315 Bacteria 2091
272 Ga0495581_0248418 3300047315 Bacteria 1040
273 Ga0495636_0001535 3300047318 Bacteria 8779
274 Ga0495680_0375666 3300047322 Bacteria 985
275 Ga0495680_0552772 3300047322 Bacteria 775
276 Ga0495675_0031249 3300047444 Bacteria 3399
277 Ga0495677_0192769 3300047445 Bacteria 791
278 Ga0495593_0099422 3300047673 Bacteria 1493
279 Ga0495615_0014250 3300048090 Bacteria 1677
280 Ga0496101_0224800 3300048904 Bacteria 1457
281 Ga0496101_0553217 3300048904 Bacteria 910
282 Ga0496102_0041361 3300048905 Bacteria 4172
283 Ga0496102_0053324 3300048905 Bacteria 3686
284 Ga0496102_0074360 3300048905 Bacteria 3123
285 Ga0496103_0008291 3300048906 Bacteria 6170
286 Ga0496103_0018260 3300048906 Bacteria 4206
287 Ga0496105_0398048 3300048908 Bacteria 1093
288 Ga0496110_0076827 3300048913 Bacteria 2969
289 Ga0496110_0217710 3300048913 Bacteria 1736
290 Ga0496110_0301449 3300048913 Bacteria 1459
291 Ga0496111_0089961 3300048914 Bacteria 2248
292 Ga0496112_0044230 3300048915 Bacteria 4363
293 Ga0496112_0403960 3300048915 Bacteria 1306
294 Ga0496112_0745702 3300048915 Bacteria 906
295 Ga0496113_0091873 3300048916 Bacteria 2341
296 Ga0496113_0310221 3300048916 Bacteria 1264
297 Ga0496114_0009612 3300048917 Bacteria 7681
298 Ga0496114_0041267 3300048917 Bacteria 3823
299 Ga0496114_0334655 3300048917 Bacteria 1338
300 Ga0496114_0363474 3300048917 Bacteria 1280
301 Ga0496115_0124573 3300048918 Bacteria 2122
302 Ga0496119_0160609 3300048922 Bacteria 1195
303 Ga0496122_0219828 3300048925 Bacteria 1091
304 Ga0496126_0073448 3300048929 Bacteria 3041
305 Ga0501309_011885 3300049129 Bacteria 1140
306 Ga0501341_07050 3300049131 Bacteria 699
307 Ga0501305_049242 3300049161 Bacteria 703
308 Ga0501311_020127 3300049527 Bacteria 900
309 Ga0501315_011920 3300049531 Bacteria 1068
310 Ga0501317_039418 3300049533 Bacteria 716
311 Ga0501318_012685 3300049534 Bacteria 970
312 Ga0501318_019873 3300049534 Bacteria 841
313 Ga0501323_014313 3300049539 Bacteria 990
314 Ga0501324_009528 3300049540 Bacteria 872
315 Ga0501037_0156960 3300049573 Bacteria 1623
316 Ga0501038_0052855 3300049574 Bacteria 3501
317 Ga0501038_0341581 3300049574 Bacteria 1167
318 Ga0501043_0171478 3300049579 Bacteria 1692
319 Ga0501043_0268425 3300049579 Bacteria 1310
320 Ga0501044_0347886 3300049823 Bacteria 1402
321 nmdc:mga05p37_452539_c1 3300050507 Bacteria 1485
322 Ga0495595_0012227 3300053084 Bacteria 3603
323 Ga0587072_006628 3300059643 Bacteria 1770
324 2537899215 2537561592 Bacteria 4348607
325 2555228947 2554235227 Bacteria 3637389
326 2655033429 2654587600 Bacteria 3911798
327 2691515211 2690315906 Bacteria 4517044
328 2738693937 2738541272 Bacteria 6848551
329 2739326894 2738543027 Bacteria 6409078
330 2739607254 2739367654 Bacteria 6049412
331 2760304838 2758568522 Bacteria 5953541
332 2760621339 2758568621 Bacteria 5967089
333 2774395004 2773857762 Bacteria 5971770
334 2775655669 2775506735 Bacteria 4556596
335 2808828400 2808606357 Bacteria 4466944
336 2808849641 2808606360 Bacteria 4404006
337 2808877766 2808606366 Bacteria 4415912
338 2808892619 2808606370 Bacteria 4942454
339 2808899199 2808606371 Bacteria 4251511
340 2809026124 2808606394 Bacteria 6248540
341 2809194148 2808606439 Bacteria 5952208
342 2810364709 2808606700 Bacteria 3482157
343 2812319882 2811994871 Bacteria 4497550
344 2812348897 2811994878 Bacteria 5992952
345 2844850040 2844849076 Bacteria 4091819
346 2857480251 2857479173 Bacteria 2469263
347 2857633863 2857632687 Bacteria 2448521
348 2857742309 2857740372 Bacteria 4782044
349 2870801837 2870801768 Bacteria 2710986
350 2870806227 2870804320 Bacteria 2552467
351 2891973357 2891968417 Bacteria 5821697
352 2904500566 2904497146 Bacteria 4731781
353 2904777186 2904776348 Bacteria 4658726
354 2905929478 2905926851 Bacteria 4423176
355 2910814236 2910809715 Bacteria 4982797
356 2919038245 2919034639 Bacteria 4763403
357 2919053493 2919051321 Bacteria 4210889
358 2919059211 2919059106 Bacteria 4991624
359 2919393501 2919391150 Bacteria 4884741
360 2919541182 2919538618 Bacteria 4677069
361 2932427335 2932426870 Bacteria 4547726
362 2933420902 2933418574 Bacteria 4476724
363 2939599252 2939598168 Bacteria 4687164
364 2939650449 2939647034 Bacteria 4681660
365 2939676811 2939674588 Bacteria 4844420
366 2945922074 2945920336 Bacteria 4501603
367 2945941762 2945941187 Bacteria 4682474
368 2945960546 2945956166 Bacteria 5110334
369 2946037675 2946037020 Bacteria 4900426
370 2946061452 2946059875 Bacteria 4386623
371 2953998935 2953998280 Bacteria 4812144
372 2974305697 2974302888 Bacteria 4369871
373 8004023349 8004021418 Bacteria 4313954
374 8004025673 8004025490 Bacteria 4327753
375 8054110906 8054107350 Bacteria 5022511
376 8056581780 8056579771 Bacteria 5840325
377 Ga0501039_0114225
378 LJQas_1000522
379 LJQas_1002330
380 LJQas_1012184
381 JGI25152J39213_1000875
382 JGI25151J46595_10027567
383 rootH1_10020185
384 rootL2_10127835
385 Ga0006562J51391_1031845
386 Ga0055542_1003061
387 Ga0065714_10015284
388 Ga0065714_10088894
389 Ga0065712_10013688
390 Ga0070658_10809616
391 Ga0070670_100102304
392 Ga0070677_10013161
393 Ga0070680_100835257
394 Ga0070660_100657392
395 Ga0070668_100201547
396 Ga0070669_100055582
397 Ga0070675_100159742
398 Ga0070671_100075624
399 Ga0070673_100210103
400 Ga0070667_100096878
401 Ga0070713_100839285
402 Ga0070678_100152816
403 Ga0070681_10791692
404 Ga0070685_10367090
405 Ga0070679_100072625
406 Ga0070672_100033339
407 Ga0070665_100283813
408 Ga0068857_100304503
409 Ga0070717_10166151
410 Ga0075432_10000974
411 Ga0105251_10018327
412 Ga0105240_10086771
413 Ga0105245_10637433
414 Ga0114129_10559386
415 Ga0105243_10006272
416 Ga0105243_10380463
417 Ga0105241_10377207
418 Ga0105248_10247781
419 Ga0105238_10166364
420 Ga0105246_10000974
421 Ga0105246_10051222
422 Ga0105246_10088038
423 Ga0105246_10124708
424 Ga0105246_10205468
425 Ga0157373_10001840
426 Ga0157371_10107124
427 Ga0157370_10005794
428 Ga0157370_10106250
429 Ga0157369_10025711
430 Ga0157369_10084158
431 Ga0157369_10246689
432 Ga0157372_10000678
433 Ga0157375_10127504
434 Ga0182008_10252725
435 Ga0206353_11422180
436 Ga0209148_1005218
437 Ga0209129_1000060
438 Ga0209025_1002714
439 Ga0209051_1009047
440 Ga0209051_1010037
441 Ga0207697_10002822
442 Ga0207697_10004251
443 Ga0207655_1018217
444 Ga0207655_1028338
445 Ga0207713_1064469
446 Ga0207682_10003193
447 Ga0207688_10097570
448 Ga0207645_10017177
449 Ga0207652_10084054
450 Ga0207681_10202622
451 Ga0207650_10290911
452 Ga0207700_10499858
453 Ga0207644_10384928
454 Ga0207686_10434139
455 Ga0207709_10007781
456 Ga0207709_10141838
457 Ga0207709_10159671
458 Ga0207669_10009674
459 Ga0207691_10012075
460 Ga0207711_10399130
461 Ga0207679_10636914
462 Ga0207674_10010189
463 Ga0207683_10068631
464 Ga0307515_10155340
465 Ga0307512_10016122
466 Ga0316177_1040018
467 Ga0316176_1032373
468 Ga0314311_1159901
469 Ga0316179_1049299
470 Ga0316182_1295128
471 Ga0265327_10092238
472 Ga0307408_100004015
473 Ga0307408_100184318
474 Ga0307408_100194627
475 Ga0307408_100363069
476 Ga0307408_100563670
477 Ga0307408_100619284
478 Ga0307514_10136128
479 Ga0316576_10002620
480 Ga0316576_10013029
481 Ga0316578_10090059
482 Ga0307405_10003148
483 Ga0307405_10048373
484 Ga0307405_10069878
485 Ga0307405_10091126
486 Ga0307405_10141235
487 Ga0307405_10402133
488 Ga0307413_10018353
489 Ga0307413_10021635
490 Ga0307413_10029736
491 Ga0307413_10100726
492 Ga0307413_10138092
493 Ga0307413_10173603
494 Ga0307413_10263541
495 Ga0307410_10017153
496 Ga0307410_10037275
497 Ga0307410_10042419
498 Ga0307410_10075125
499 Ga0307410_10144575
500 Ga0307410_10145688
501 Ga0307410_10173182
502 Ga0307410_10180819
503 Ga0307406_10056421
504 Ga0307406_10171991
505 Ga0307407_10013600
506 Ga0307407_10047260
507 Ga0307407_10073852
508 Ga0307407_10081605
509 Ga0307407_10216169
510 Ga0307412_10010998
511 Ga0307412_10083185
512 Ga0307412_10094040
513 Ga0307412_10105560
514 Ga0307412_10164527
515 Ga0307412_10209390
516 Ga0307412_10725457
517 Ga0307409_100050931
518 Ga0307409_100101119
519 Ga0307409_100117259
520 Ga0307416_100001499
521 Ga0307416_100006057
522 Ga0307416_100008827
523 Ga0307416_100018723
524 Ga0307416_100371938
525 Ga0307416_100561166
526 Ga0307416_101686549
527 Ga0307414_10254777
528 Ga0307411_10181650
529 Ga0307411_10733334
530 Ga0307415_100344469
531 Ga0316593_10222222
532 Ga0316574_0003913
533 Ga0316574_0018924
534 Ga0316582_0105065
535 Ga0316584_0003561
536 Ga0316584_0033149
537 Ga0395899_0011021
538 Ga0395899_0020238
539 Ga0395899_0038017
540 Ga0395900_0008527
541 Ga0395900_0021190
542 Ga0395900_0025564
543 Ga0395900_0151578
544 Ga0395900_0221670
545 Ga0395898_0009705
546 Ga0395898_0019107
547 Ga0395898_0020656
548 Ga0395898_0054323
549 Ga0395898_0054719
550 Ga0395898_0208716
551 Ga0395898_0240803
552 Ga0395905_0028840
553 Ga0395905_0802902
554 Ga0395901_0004640
555 Ga0395901_0005633
556 Ga0395901_0009942
557 Ga0395901_0056182
558 Ga0395901_0098629
559 Ga0395901_0254796
560 Ga0395901_0359495
561 Ga0439436_0010369
562 Ga0439436_0023377
563 Ga0439438_039892
564 Ga0439439_0000395
565 Ga0439439_0009769
566 Ga0439461_0004735
567 Ga0439466_0016004
568 Ga0439465_0012730
569 Ga0451797_0029636
570 Ga0451837_1751331
571 Ga0451843_0768602
572 Ga0451853_2080040
573 Ga0439431_0018951
574 Ga0439433_0004345
575 Ga0439433_0005845
576 Ga0439433_0013398
577 Ga0439442_000091
578 Ga0439442_004679
579 Ga0439442_019951
580 Ga0439449_0012156
581 Ga0439449_0039768
582 Ga0439449_0080067
583 Ga0439452_004426
584 Ga0439457_002089
585 Ga0439457_002483
586 Ga0439462_0016941
587 Ga0439462_0023193
588 Ga0450911_012164
589 Ga0450919_009845
590 Ga0450920_000067
591 Ga0450920_004164
592 Ga0450920_008125
593 Ga0450907_000247
594 Ga0450907_017920
595 Ga0439446_0031970
596 Ga0450908_005710
597 Ga0450909_002558
598 Ga0439434_0000183
599 Ga0439434_0051980
600 Ga0450918_000853
601 Ga0450918_011095
602 Ga0466966_0165252
603 Ga0466961_0017509
604 Ga0466961_0111663
605 Ga0466970_0082799
606 Ga0466970_0473670
607 Ga0466957_0424411
608 Ga0466960_0082160
609 Ga0466967_0062990
610 Ga0466967_0253501
611 Ga0495603_0333873
612 Ga0495590_0153688
613 Ga0495641_0034322
614 Ga0495653_0050692
615 Ga0495580_0017443
616 Ga0495580_0199809
617 Ga0495582_0098745
618 Ga0495582_0183451
619 Ga0495639_0239605
620 Ga0495639_0288439
621 Ga0495662_0030753
622 Ga0495664_0017599
623 Ga0495594_0014074
624 Ga0495630_0039966
625 Ga0495631_0040384
626 Ga0495642_0225650
627 Ga0495665_0008276
628 Ga0495665_0077250
629 Ga0495586_0003384
630 Ga0495586_0012356
631 Ga0495586_0024787
632 Ga0495587_0019844
633 Ga0495645_0063710
634 Ga0495645_0207347
635 Ga0495667_0012246
636 Ga0495656_0012491
637 Ga0495634_0368626
638 Ga0495635_0084280
639 Ga0495588_0030832
640 Ga0495588_0204813
641 Ga0495657_0029958
642 Ga0495623_0058067
643 Ga0495670_0015926
644 Ga0495670_0059499
645 Ga0495600_0106125
646 Ga0495581_0020666
647 Ga0495581_0066053
648 Ga0495581_0248418
649 Ga0495636_0001535
650 Ga0495680_0375666
651 Ga0495680_0552772
652 Ga0495675_0031249
653 Ga0495677_0192769
654 Ga0495593_0099422
655 Ga0495615_0014250
656 Ga0496101_0224800
657 Ga0496101_0553217
658 Ga0496102_0041361
659 Ga0496102_0053324
660 Ga0496102_0074360
661 Ga0496103_0008291
662 Ga0496103_0018260
663 Ga0496105_0398048
664 Ga0496110_0076827
665 Ga0496110_0217710
666 Ga0496110_0301449
667 Ga0496111_0089961
668 Ga0496112_0044230
669 Ga0496112_0403960
670 Ga0496112_0745702
671 Ga0496113_0091873
672 Ga0496113_0310221
673 Ga0496114_0009612
674 Ga0496114_0041267
675 Ga0496114_0334655
676 Ga0496114_0363474
677 Ga0496115_0124573
678 Ga0496119_0160609
679 Ga0496122_0219828
680 Ga0496126_0073448
681 Ga0501309_011885
682 Ga0501341_07050
683 Ga0501305_049242
684 Ga0501311_020127
685 Ga0501315_011920
686 Ga0501317_039418
687 Ga0501318_012685
688 Ga0501318_019873
689 Ga0501323_014313
690 Ga0501324_009528
691 Ga0501037_0156960
692 Ga0501038_0052855
693 Ga0501038_0341581
694 Ga0501043_0171478
695 Ga0501043_0268425
696 Ga0501044_0347886
697 nmdc:mga05p37_452539_c1
698 Ga0495595_0012227
699 Ga0587072_006628
700 2537899215
701 2555228947
702 2655033429
703 2691515211
704 2738693937
705 2739326894
706 2739607254
707 2760304838
708 2760621339
709 2774395004
710 2775655669
711 2808828400
712 2808849641
713 2808877766
714 2808892619
715 2808899199
716 2809026124
717 2809194148
718 2810364709
719 2812319882
720 2812348897
721 2844850040
722 2857480251
723 2857633863
724 2857742309
725 2870801837
726 2870806227
727 2891973357
728 2904500566
729 2904777186
730 2905929478
731 2910814236
732 2919038245
733 2919053493
734 2919059211
735 2919393501
736 2919541182
737 2932427335
738 2933420902
739 2939599252
740 2939650449
741 2939676811
742 2945922074
743 2945941762
744 2945960546
745 2946037675
746 2946061452
747 2953998935
748 2974305697
749 8004023349
750 8004025673
751 8054110906
752 8056581780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

39

243

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s2q-assembly2.cif.gz_D mycobacterial hydrolase 1 0.7912 3 203
4pza-assembly1.cif.gz_A the complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate 0.7839 5 206
3eoz-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from plasmodium falciparum, pfd0660w 0.782 1 206
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.7791 4 203
6s2q-assembly1.cif.gz_A mycobacterial hydrolase 1 0.7734 5 206
ID Description Score Start End Superfamily
af_O06391_3_198_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9548 3 206 3.40.50.1240
af_O06391_3_198_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9453 3 206 3.40.50.1240
af_A0A0R4IBA6_29_133_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8997 186 206 2.60.40.10
2xwxB03 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8584 187 205 2.60.40.2550
af_A0A0R0JRC5_62_140_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8478 187 205 3.30.420.10
ID Description Score Start End GO Terms
AF-A9WS02-F1-model_v4 Phosphoglycerate mutase 0.9708 1 211
AF-A0A1G5PIH5-F1-model_v4 Broad specificity phosphatase PhoE 0.9685 1 221 GO:0005737
GO:0016791
AF-A0A6H0SIX8-F1-model_v4 Histidine phosphatase family protein 0.9675 1 221 GO:0005737
GO:0016791
AF-A0A7X6H8U4-F1-model_v4 deleted 0.9648 1 176
AF-A0A078MS02-F1-model_v4 Phosphoglycerate mutase GpmB 0.9642 1 221 GO:0005737
GO:0016791

Map