F427458

General Info

Members Datasets Scaffolds Average Seq Length
376 236 752 171

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0000854|Ga0495648_0000854_2194_2781
Length 195
Sequence MRLRFRRIFVANDVGETACAHIVMGVSGSGKSTVADKLAERLHWSYEDADKFHPPSNVAKMRAGQPLTDEDRWPWLQAIADEIDRVCNAGGHVVIACSALKRAYRDILVHGRKDVRIIFLLGTEELIANRLAKRVGHFMPPGLLASQFMTLEPPDASENPIVVSIDAPVEKIVDDIVRQLKLSPAEGDSARRNRS

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
164 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
228 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
232 2791355199
233 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
234 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
235 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
236 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0.53
Rhizoplane 5.85
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0000854 3300046524 Bacteria 32146
2 Ga0065715_10360281 3300005293 Bacteria 886
3 Ga0070676_10452264 3300005328 Bacteria 903
4 Ga0070670_100250002 3300005331 Bacteria 1544
5 Ga0070670_100515306 3300005331 Bacteria 1065
6 Ga0070677_10039442 3300005333 Bacteria 1853
7 Ga0068869_100001853 3300005334 Bacteria 12707
8 Ga0068868_100049412 3300005338 Bacteria 3301
9 Ga0068868_100266317 3300005338 Bacteria 1447
10 Ga0068868_100942533 3300005338 Bacteria 787
11 Ga0070689_100032293 3300005340 Bacteria 3981
12 Ga0070689_100134720 3300005340 Bacteria 1983
13 Ga0070689_100267462 3300005340 Bacteria 1414
14 Ga0070687_100037962 3300005343 Bacteria 2411
15 Ga0070661_101206295 3300005344 Bacteria 633
16 Ga0070668_100000539 3300005347 Bacteria 25247
17 Ga0070669_100187381 3300005353 Bacteria 1621
18 Ga0070669_100214195 3300005353 Bacteria 1521
19 Ga0070669_100936666 3300005353 Bacteria 741
20 Ga0070675_100537785 3300005354 Bacteria 1056
21 Ga0070671_100518207 3300005355 Bacteria 1026
22 Ga0070674_100055866 3300005356 Bacteria 2736
23 Ga0070674_100199402 3300005356 Bacteria 1544
24 Ga0070673_100635821 3300005364 Bacteria 976
25 Ga0070673_100678322 3300005364 Bacteria 945
26 Ga0070673_101122119 3300005364 Bacteria 735
27 Ga0070688_100065821 3300005365 Bacteria 2304
28 Ga0070688_100400295 3300005365 Bacteria 1016
29 Ga0070688_100749322 3300005365 Bacteria 760
30 Ga0070659_100024567 3300005366 Bacteria 4620
31 Ga0070667_100106089 3300005367 Bacteria 2432
32 Ga0070667_100364337 3300005367 Bacteria 1311
33 Ga0070667_100389938 3300005367 Bacteria 1266
34 Ga0070709_10000372 3300005434 Bacteria 27588
35 Ga0070714_100005173 3300005435 Bacteria 9928
36 Ga0070713_100057436 3300005436 Bacteria 3241
37 Ga0070710_10000509 3300005437 Bacteria 18274
38 Ga0070701_10220306 3300005438 Bacteria 1131
39 Ga0070711_100008047 3300005439 Bacteria 6436
40 Ga0070705_101166141 3300005440 Bacteria 633
41 Ga0070708_100435422 3300005445 Bacteria 1237
42 Ga0070708_100507993 3300005445 Bacteria 1137
43 Ga0070663_100248975 3300005455 Bacteria 1406
44 Ga0070678_100114685 3300005456 Bacteria 2114
45 Ga0070678_100197013 3300005456 Bacteria 1660
46 Ga0070681_11102210 3300005458 Bacteria 715
47 Ga0068867_100081490 3300005459 Bacteria 2439
48 Ga0068867_100367755 3300005459 Bacteria 1205
49 Ga0068867_100770282 3300005459 Bacteria 855
50 Ga0070685_10045376 3300005466 Bacteria 2520
51 Ga0070707_100783564 3300005468 Bacteria 917
52 Ga0070697_100784016 3300005536 Bacteria 843
53 Ga0068853_100447917 3300005539 Bacteria 1214
54 Ga0068853_100649599 3300005539 Bacteria 1004
55 Ga0070672_100274810 3300005543 Bacteria 1423
56 Ga0070672_100276028 3300005543 Bacteria 1420
57 Ga0070686_100255073 3300005544 Bacteria 1283
58 Ga0070686_100347176 3300005544 Bacteria 1114
59 Ga0070665_100010187 3300005548 Bacteria 9509
60 Ga0070704_100281454 3300005549 Bacteria 1378
61 Ga0068855_100041998 3300005563 Bacteria 5419
62 Ga0070664_100432125 3300005564 Bacteria 1207
63 Ga0068857_100509864 3300005577 Bacteria 1130
64 Ga0068857_100518329 3300005577 Bacteria 1120
65 Ga0068856_100038330 3300005614 Bacteria 4704
66 Ga0068856_100400588 3300005614 Bacteria 1392
67 Ga0070702_100042445 3300005615 Bacteria 2557
68 Ga0070702_100224644 3300005615 Bacteria 1258
69 Ga0068852_100010757 3300005616 Bacteria 6854
70 Ga0068852_100097130 3300005616 Bacteria 2649
71 Ga0068852_101518060 3300005616 Bacteria 692
72 Ga0068859_100046174 3300005617 Bacteria 4375
73 Ga0068859_100786978 3300005617 Bacteria 1039
74 Ga0068859_100844427 3300005617 Bacteria 1002
75 Ga0068859_101183685 3300005617 Bacteria 842
76 Ga0068864_100031589 3300005618 Bacteria 4494
77 Ga0068864_100048712 3300005618 Bacteria 3643
78 Ga0068864_100613133 3300005618 Bacteria 1057
79 Ga0068864_101485017 3300005618 Bacteria 681
80 Ga0068866_10284419 3300005718 Bacteria 1026
81 Ga0068861_100250975 3300005719 Bacteria 1510
82 Ga0068861_100377407 3300005719 Bacteria 1251
83 Ga0068861_100720219 3300005719 Bacteria 929
84 Ga0068851_10085318 3300005834 Bacteria 1655
85 Ga0068870_10064017 3300005840 Bacteria 1985
86 Ga0068870_10378866 3300005840 Bacteria 915
87 Ga0068863_100030201 3300005841 Bacteria 5177
88 Ga0068863_100340206 3300005841 Bacteria 1460
89 Ga0068858_100019630 3300005842 Bacteria 6319
90 Ga0068860_100093486 3300005843 Bacteria 2866
91 Ga0068860_100148491 3300005843 Bacteria 2256
92 Ga0068860_100402269 3300005843 Bacteria 1355
93 Ga0068860_100461503 3300005843 Bacteria 1264
94 Ga0068860_100995877 3300005843 Bacteria 856
95 Ga0068862_100001001 3300005844 Bacteria 27048
96 Ga0081455_10004399 3300005937 Bacteria 15836
97 Ga0081538_10148215 3300005981 Bacteria 1068
98 Ga0081539_10139384 3300005985 Bacteria 1180
99 Ga0070717_10258511 3300006028 Bacteria 1540
100 Ga0070717_10428284 3300006028 Bacteria 1191
101 Ga0075363_100322694 3300006048 Bacteria 899
102 Ga0075364_10567106 3300006051 Bacteria 776
103 Ga0075364_10745406 3300006051 Bacteria 668
104 Ga0070716_100060990 3300006173 Bacteria 2181
105 Ga0070712_100008402 3300006175 Bacteria 6493
106 Ga0075362_10224653 3300006177 Bacteria 918
107 Ga0075366_10218025 3300006195 Bacteria 1162
108 Ga0097621_100119528 3300006237 Bacteria 2234
109 Ga0097621_100265165 3300006237 Bacteria 1508
110 Ga0097621_101166280 3300006237 Bacteria 725
111 Ga0075370_10200887 3300006353 Bacteria 1176
112 Ga0068871_100459768 3300006358 Bacteria 1142
113 Ga0075428_100107431 3300006844 Bacteria 3042
114 Ga0075430_100272128 3300006846 Bacteria 1402
115 Ga0068865_100170841 3300006881 Bacteria 1666
116 Ga0068865_100207422 3300006881 Bacteria 1525
117 Ga0068865_101273659 3300006881 Bacteria 653
118 Ga0075436_100506268 3300006914 Bacteria 884
119 Ga0097620_100046170 3300006931 Bacteria 4375
120 Ga0097620_100787054 3300006931 Bacteria 1039
121 Ga0097620_100844454 3300006931 Bacteria 1002
122 Ga0097620_101183654 3300006931 Bacteria 842
123 Ga0111539_10104106 3300009094 Bacteria 3330
124 Ga0111539_11433326 3300009094 Bacteria 801
125 Ga0105245_10126550 3300009098 Bacteria 2392
126 Ga0105245_10134396 3300009098 Bacteria 2323
127 Ga0105245_10855780 3300009098 Bacteria 949
128 Ga0105245_11664763 3300009098 Bacteria 690
129 Ga0105247_10022173 3300009101 Bacteria 3823
130 Ga0105243_10172649 3300009148 Bacteria 1874
131 Ga0105243_10201617 3300009148 Bacteria 1745
132 Ga0105243_10205422 3300009148 Bacteria 1730
133 Ga0105243_11870205 3300009148 Bacteria 633
134 Ga0105241_10537362 3300009174 Bacteria 1047
135 Ga0105242_10284824 3300009176 Unclassified 1502
136 Ga0105242_10342478 3300009176 Bacteria 1378
137 Ga0105242_12015371 3300009176 Bacteria 620
138 Ga0105248_10001255 3300009177 Bacteria 28351
139 Ga0105248_12062046 3300009177 Bacteria 648
140 Ga0105237_10159014 3300009545 Bacteria 2257
141 Ga0105237_11592038 3300009545 Bacteria 660
142 Ga0105238_10021605 3300009551 Bacteria 6555
143 Ga0105238_11084087 3300009551 Bacteria 823
144 Ga0105238_11171431 3300009551 Unclassified 792
145 Ga0105249_10246374 3300009553 Bacteria 1769
146 Ga0105249_10633083 3300009553 Bacteria 1126
147 Ga0105249_10779191 3300009553 Bacteria 1019
148 Ga0105249_10898754 3300009553 Bacteria 952
149 Ga0105239_10036907 3300010375 Bacteria 5361
150 Ga0105239_10240890 3300010375 Bacteria 2030
151 Ga0105239_10248905 3300010375 Bacteria 1996
152 Ga0105246_10032495 3300011119 Bacteria 3461
153 Ga0105246_10034284 3300011119 Bacteria 3381
154 Ga0105246_10046850 3300011119 Bacteria 2950
155 Ga0157374_10054400 3300013296 Bacteria 3733
156 Ga0157374_10264942 3300013296 Bacteria 1693
157 Ga0157378_10185142 3300013297 Bacteria 1961
158 Ga0157378_10704199 3300013297 Bacteria 1029
159 Ga0163162_10043115 3300013306 Bacteria 4517
160 Ga0163162_10385155 3300013306 Bacteria 1535
161 Ga0163162_10557147 3300013306 Bacteria 1274
162 Ga0163162_10612830 3300013306 Bacteria 1214
163 Ga0157375_10077806 3300013308 Bacteria 3348
164 Ga0157375_10584588 3300013308 Bacteria 1277
165 Ga0163163_10030297 3300014325 Bacteria 5212
166 Ga0163163_10690645 3300014325 Bacteria 1084
167 Ga0157380_10031542 3300014326 Bacteria 4069
168 Ga0157380_10519716 3300014326 Bacteria 1161
169 Ga0157380_10873019 3300014326 Bacteria 923
170 Ga0157380_11204267 3300014326 Bacteria 801
171 Ga0157380_11966943 3300014326 Bacteria 646
172 Ga0157380_12212927 3300014326 Bacteria 614
173 Ga0157379_10037901 3300014968 Bacteria 4300
174 Ga0157376_10112367 3300014969 Bacteria 2400
175 Ga0209677_100563 3300025253 Bacteria 20558
176 Ga0207682_10014287 3300025893 Bacteria 3093
177 Ga0207692_10001401 3300025898 Bacteria 9021
178 Ga0207692_10444102 3300025898 Bacteria 815
179 Ga0207642_10173206 3300025899 Bacteria 1169
180 Ga0207710_10381064 3300025900 Bacteria 722
181 Ga0207699_10000245 3300025906 Bacteria 30434
182 Ga0207643_10029773 3300025908 Bacteria 3036
183 Ga0207654_10091885 3300025911 Bacteria 1852
184 Ga0207693_10003833 3300025915 Bacteria 12803
185 Ga0207693_10055131 3300025915 Bacteria 3119
186 Ga0207663_10002846 3300025916 Bacteria 8362
187 Ga0207660_10039647 3300025917 Bacteria 3294
188 Ga0207662_10070913 3300025918 Bacteria 2108
189 Ga0207681_10863212 3300025923 Bacteria 757
190 Ga0207694_10099059 3300025924 Bacteria 2308
191 Ga0207694_10826932 3300025924 Bacteria 783
192 Ga0207659_10659432 3300025926 Bacteria 894
193 Ga0207687_10046115 3300025927 Bacteria 3016
194 Ga0207687_10137527 3300025927 Bacteria 1849
195 Ga0207700_10568666 3300025928 Bacteria 1007
196 Ga0207664_10005476 3300025929 Bacteria 8685
197 Ga0207644_10188395 3300025931 Bacteria 1621
198 Ga0207644_10393416 3300025931 Bacteria 1132
199 Ga0207690_10173153 3300025932 Bacteria 1619
200 Ga0207686_10061337 3300025934 Bacteria 2384
201 Ga0207686_10633567 3300025934 Bacteria 844
202 Ga0207709_10438263 3300025935 Bacteria 1007
203 Ga0207709_10646911 3300025935 Bacteria 841
204 Ga0207670_10142423 3300025936 Bacteria 1769
205 Ga0207669_10019788 3300025937 Bacteria 3514
206 Ga0207669_10023327 3300025937 Bacteria 3303
207 Ga0207704_10006645 3300025938 Bacteria 5414
208 Ga0207704_10127394 3300025938 Bacteria 1756
209 Ga0207704_10369761 3300025938 Bacteria 1122
210 Ga0207665_10022568 3300025939 Bacteria 4141
211 Ga0207691_10083772 3300025940 Bacteria 2863
212 Ga0207691_10212760 3300025940 Bacteria 1679
213 Ga0207711_10053719 3300025941 Bacteria 3455
214 Ga0207711_10844755 3300025941 Bacteria 852
215 Ga0207689_10002843 3300025942 Bacteria 15975
216 Ga0207689_10035172 3300025942 Bacteria 4162
217 Ga0207689_10515691 3300025942 Bacteria 1002
218 Ga0207679_10032657 3300025945 Bacteria 3657
219 Ga0207667_10094670 3300025949 Bacteria 3084
220 Ga0207667_10397488 3300025949 Bacteria 1403
221 Ga0207651_10021861 3300025960 Bacteria 3898
222 Ga0207651_10252557 3300025960 Bacteria 1443
223 Ga0207651_11027315 3300025960 Bacteria 737
224 Ga0207668_10007115 3300025972 Bacteria 6639
225 Ga0207658_10110763 3300025986 Bacteria 2170
226 Ga0207658_10863207 3300025986 Bacteria 823
227 Ga0207677_10243798 3300026023 Bacteria 1455
228 Ga0207677_10499096 3300026023 Bacteria 1052
229 Ga0207677_11063963 3300026023 Bacteria 736
230 Ga0207703_10045202 3300026035 Bacteria 3541
231 Ga0207703_11216830 3300026035 Bacteria 724
232 Ga0207678_10019339 3300026067 Bacteria 5982
233 Ga0207702_10023130 3300026078 Bacteria 5154
234 Ga0207641_10038479 3300026088 Bacteria 3999
235 Ga0207641_10259634 3300026088 Bacteria 1626
236 Ga0207648_10063137 3300026089 Bacteria 3229
237 Ga0207648_10163394 3300026089 Unclassified 1967
238 Ga0207648_10506887 3300026089 Bacteria 1105
239 Ga0207676_10306616 3300026095 Bacteria 1452
240 Ga0207676_11208040 3300026095 Bacteria 749
241 Ga0207674_10051710 3300026116 Bacteria 4193
242 Ga0207674_10222779 3300026116 Bacteria 1834
243 Ga0207675_100026253 3300026118 Bacteria 5423
244 Ga0207675_100555415 3300026118 Bacteria 1148
245 Ga0207675_100800509 3300026118 Bacteria 956
246 Ga0207683_10038256 3300026121 Bacteria 4180
247 Ga0207683_10152125 3300026121 Bacteria 2088
248 Ga0207698_10290712 3300026142 Bacteria 1516
249 Ga0268266_10396014 3300028379 Bacteria 1305
250 Ga0268266_10855162 3300028379 Bacteria 879
251 Ga0268266_11366110 3300028379 Bacteria 684
252 Ga0268265_10000975 3300028380 Bacteria 26114
253 Ga0268265_10089949 3300028380 Bacteria 2451
254 Ga0268265_10931384 3300028380 Bacteria 855
255 Ga0268264_10103256 3300028381 Bacteria 2482
256 Ga0268264_10967569 3300028381 Bacteria 857
257 Ga0307515_10454459 3300028794 Bacteria 896
258 Ga0265338_10005172 3300028800 Bacteria 17141
259 Ga0307513_10079886 3300031456 Bacteria 3376
260 Ga0307513_10202210 3300031456 Bacteria 1826
261 Ga0307509_10194666 3300031507 Bacteria 1873
262 Ga0265314_10067982 3300031711 Bacteria 2397
263 Ga0307416_102114966 3300032002 Bacteria 665
264 Ga0307414_10045053 3300032004 Bacteria 3018
265 Ga0373930_0026091 3300034816 Bacteria 1176
266 Ga0373928_0150080 3300035084 Bacteria 645
267 Ga0373952_0131501 3300035092 Bacteria 688
268 Ga0373936_0095672 3300035113 Bacteria 1249
269 Ga0373937_0668357 3300036401 Bacteria 985
270 Ga0373937_0694410 3300036401 Bacteria 964
271 Ga0395899_0000137 3300037312 Bacteria 111924
272 Ga0395899_0173789 3300037312 Bacteria 1515
273 Ga0395899_0223149 3300037312 Bacteria 1304
274 Ga0395900_0000108 3300037418 Bacteria 147706
275 Ga0395900_0085703 3300037418 Bacteria 3237
276 Ga0395898_0000632 3300037466 Bacteria 64373
277 Ga0395898_0026044 3300037466 Bacteria 5889
278 Ga0395898_0083896 3300037466 Bacteria 3071
279 Ga0395905_0000780 3300037471 Bacteria 41824
280 Ga0395905_0132544 3300037471 Bacteria 2344
281 Ga0436364_0729605 3300037853 Bacteria 1149
282 Ga0395901_0000050 3300038443 Bacteria 171046
283 Ga0395901_0637875 3300038443 Bacteria 1070
284 Ga0395901_1213666 3300038443 Bacteria 719
285 Ga0436365_0961428 3300039437 Bacteria 1707
286 Ga0436365_1603010 3300039437 Bacteria 1104
287 Ga0436365_1815653 3300039437 Bacteria 1069
288 Ga0436361_1193008 3300039447 Bacteria 2545
289 Ga0439453_0014546 3300041408 Bacteria 1350
290 Ga0451843_0339312 3300041509 Bacteria 895
291 Ga0439451_070525 3300042009 Bacteria 700
292 Ga0439446_0031605 3300042156 Bacteria 1533
293 Ga0439446_0177366 3300042156 Bacteria 711
294 Ga0439444_0024219 3300042437 Bacteria 1096
295 Ga0466965_0367468 3300044683 Bacteria 790
296 Ga0466960_0066370 3300044901 Bacteria 1784
297 Ga0451576_0963099 3300045051 Bacteria 895
298 Ga0466967_0027806 3300045976 Bacteria 4710
299 Ga0466967_0803624 3300045976 Bacteria 934
300 Ga0495617_011865 3300046452 Bacteria 2972
301 Ga0495592_0507832 3300046454 Bacteria 747
302 Ga0495603_0111586 3300046455 Bacteria 1595
303 Ga0495638_0005607 3300046460 Bacteria 9269
304 Ga0495651_0206404 3300046462 Bacteria 1371
305 Ga0495631_0050014 3300046518 Bacteria 1829
306 Ga0495621_0054383 3300046539 Bacteria 1439
307 Ga0495622_0006396 3300046557 Bacteria 5468
308 Ga0495622_0181066 3300046557 Bacteria 945
309 Ga0495625_0210916 3300046660 Bacteria 1277
310 Ga0495661_0082250 3300046665 Bacteria 1854
311 Ga0495623_0202345 3300046679 Bacteria 1141
312 Ga0495624_0085953 3300046690 Bacteria 1943
313 Ga0495636_0603515 3300047318 Bacteria 537
314 Ga0495672_0128139 3300047320 Bacteria 1339
315 Ga0495683_0199070 3300047323 Bacteria 904
316 Ga0495685_112193 3300047447 Bacteria 897
317 Ga0496100_0088267 3300048903 Bacteria 2110
318 Ga0496101_0013015 3300048904 Bacteria 5567
319 Ga0496101_0159908 3300048904 Bacteria 1727
320 Ga0496102_0038707 3300048905 Bacteria 4305
321 Ga0496104_0061406 3300048907 Bacteria 3563
322 Ga0496104_0354197 3300048907 Bacteria 1380
323 Ga0496105_0031727 3300048908 Bacteria 4332
324 Ga0496105_0554893 3300048908 Bacteria 896
325 Ga0496106_0143152 3300048909 Bacteria 1881
326 Ga0496106_0279886 3300048909 Bacteria 1336
327 Ga0496107_0016921 3300048910 Bacteria 5126
328 Ga0496108_0150672 3300048911 Bacteria 2007
329 Ga0496109_0196430 3300048912 Bacteria 1896
330 Ga0496109_0297039 3300048912 Bacteria 1523
331 Ga0496110_0447956 3300048913 Bacteria 1177
332 Ga0496111_0170877 3300048914 Bacteria 1615
333 Ga0496112_1014511 3300048915 Bacteria 749
334 Ga0496113_0195019 3300048916 Bacteria 1608
335 Ga0496114_0004832 3300048917 Bacteria 10496
336 Ga0496114_0009349 3300048917 Bacteria 7781
337 Ga0496114_0665920 3300048917 Bacteria 915
338 Ga0496115_0001860 3300048918 Bacteria 15092
339 Ga0496119_0087902 3300048922 Bacteria 1773
340 Ga0496120_0092858 3300048923 Bacteria 1609
341 Ga0496121_0349170 3300048924 Bacteria 986
342 Ga0496124_0279062 3300048927 Bacteria 1219
343 Ga0501031_0507066 3300049568 Bacteria 778
344 Ga0501033_0045900 3300049570 Bacteria 3250
345 Ga0501034_0324785 3300049571 Bacteria 1471
346 Ga0501037_0065617 3300049573 Bacteria 2645
347 Ga0501038_0499820 3300049574 Bacteria 930
348 Ga0501043_0585688 3300049579 Bacteria 825
349 Ga0501047_0146096 3300049581 Bacteria 2242
350 Ga0501070_0196788 3300049586 Bacteria 1655
351 Ga0501083_0128650 3300049744 Bacteria 1660
352 Ga0501083_0337474 3300049744 Bacteria 980
353 Ga0501044_0150224 3300049823 Bacteria 2312
354 nmdc:mga03683_41190_c1 3300050489 Bacteria 1897
355 nmdc:mga03n38_40894_c1 3300050490 Bacteria 2017
356 nmdc:mga0k408_23232_c1 3300050493 Bacteria 3496
357 nmdc:mga07m45_118180_c1 3300050496 Bacteria 1530
358 nmdc:mga08x19_298293_c1 3300050514 Bacteria 1119
359 nmdc:mga0sz30_127565_c1 3300050516 Bacteria 1120
360 Ga0500610_0058746 3300053079 Bacteria 2007
361 Ga0500647_0142744 3300053091 Bacteria 1122
362 Ga0500641_0009256 3300053096 Bacteria 3538
363 Ga0500641_0027215 3300053096 Bacteria 2225
364 Ga0500641_0092958 3300053096 Bacteria 1288
365 Ga0500607_018812 3300053121 Bacteria 3919
366 Ga0500614_029307 3300053123 Bacteria 1335
367 Ga0500628_115310 3300053129 Bacteria 725
368 Ga0500603_255214 3300053150 Bacteria 564
369 Ga0500604_0014425 3300053151 Bacteria 2152
370 Ga0500637_0001892 3300053178 Bacteria 9096
371 Ga0500611_061743 3300053727 Bacteria 890
372 2793079614
373 2857512346 2857509624 Bacteria 7472071
374 2874607480 2874604998 Bacteria 7834745
375 3000405933 3000405567 Bacteria 3779330
376 8006998687 8006994254 Bacteria 8309700
377 Ga0495648_0000854
378 Ga0065715_10360281
379 Ga0070676_10452264
380 Ga0070670_100250002
381 Ga0070670_100515306
382 Ga0070677_10039442
383 Ga0068869_100001853
384 Ga0068868_100049412
385 Ga0068868_100266317
386 Ga0068868_100942533
387 Ga0070689_100032293
388 Ga0070689_100134720
389 Ga0070689_100267462
390 Ga0070687_100037962
391 Ga0070661_101206295
392 Ga0070668_100000539
393 Ga0070669_100187381
394 Ga0070669_100214195
395 Ga0070669_100936666
396 Ga0070675_100537785
397 Ga0070671_100518207
398 Ga0070674_100055866
399 Ga0070674_100199402
400 Ga0070673_100635821
401 Ga0070673_100678322
402 Ga0070673_101122119
403 Ga0070688_100065821
404 Ga0070688_100400295
405 Ga0070688_100749322
406 Ga0070659_100024567
407 Ga0070667_100106089
408 Ga0070667_100364337
409 Ga0070667_100389938
410 Ga0070709_10000372
411 Ga0070714_100005173
412 Ga0070713_100057436
413 Ga0070710_10000509
414 Ga0070701_10220306
415 Ga0070711_100008047
416 Ga0070705_101166141
417 Ga0070708_100435422
418 Ga0070708_100507993
419 Ga0070663_100248975
420 Ga0070678_100114685
421 Ga0070678_100197013
422 Ga0070681_11102210
423 Ga0068867_100081490
424 Ga0068867_100367755
425 Ga0068867_100770282
426 Ga0070685_10045376
427 Ga0070707_100783564
428 Ga0070697_100784016
429 Ga0068853_100447917
430 Ga0068853_100649599
431 Ga0070672_100274810
432 Ga0070672_100276028
433 Ga0070686_100255073
434 Ga0070686_100347176
435 Ga0070665_100010187
436 Ga0070704_100281454
437 Ga0068855_100041998
438 Ga0070664_100432125
439 Ga0068857_100509864
440 Ga0068857_100518329
441 Ga0068856_100038330
442 Ga0068856_100400588
443 Ga0070702_100042445
444 Ga0070702_100224644
445 Ga0068852_100010757
446 Ga0068852_100097130
447 Ga0068852_101518060
448 Ga0068859_100046174
449 Ga0068859_100786978
450 Ga0068859_100844427
451 Ga0068859_101183685
452 Ga0068864_100031589
453 Ga0068864_100048712
454 Ga0068864_100613133
455 Ga0068864_101485017
456 Ga0068866_10284419
457 Ga0068861_100250975
458 Ga0068861_100377407
459 Ga0068861_100720219
460 Ga0068851_10085318
461 Ga0068870_10064017
462 Ga0068870_10378866
463 Ga0068863_100030201
464 Ga0068863_100340206
465 Ga0068858_100019630
466 Ga0068860_100093486
467 Ga0068860_100148491
468 Ga0068860_100402269
469 Ga0068860_100461503
470 Ga0068860_100995877
471 Ga0068862_100001001
472 Ga0081455_10004399
473 Ga0081538_10148215
474 Ga0081539_10139384
475 Ga0070717_10258511
476 Ga0070717_10428284
477 Ga0075363_100322694
478 Ga0075364_10567106
479 Ga0075364_10745406
480 Ga0070716_100060990
481 Ga0070712_100008402
482 Ga0075362_10224653
483 Ga0075366_10218025
484 Ga0097621_100119528
485 Ga0097621_100265165
486 Ga0097621_101166280
487 Ga0075370_10200887
488 Ga0068871_100459768
489 Ga0075428_100107431
490 Ga0075430_100272128
491 Ga0068865_100170841
492 Ga0068865_100207422
493 Ga0068865_101273659
494 Ga0075436_100506268
495 Ga0097620_100046170
496 Ga0097620_100787054
497 Ga0097620_100844454
498 Ga0097620_101183654
499 Ga0111539_10104106
500 Ga0111539_11433326
501 Ga0105245_10126550
502 Ga0105245_10134396
503 Ga0105245_10855780
504 Ga0105245_11664763
505 Ga0105247_10022173
506 Ga0105243_10172649
507 Ga0105243_10201617
508 Ga0105243_10205422
509 Ga0105243_11870205
510 Ga0105241_10537362
511 Ga0105242_10284824
512 Ga0105242_10342478
513 Ga0105242_12015371
514 Ga0105248_10001255
515 Ga0105248_12062046
516 Ga0105237_10159014
517 Ga0105237_11592038
518 Ga0105238_10021605
519 Ga0105238_11084087
520 Ga0105238_11171431
521 Ga0105249_10246374
522 Ga0105249_10633083
523 Ga0105249_10779191
524 Ga0105249_10898754
525 Ga0105239_10036907
526 Ga0105239_10240890
527 Ga0105239_10248905
528 Ga0105246_10032495
529 Ga0105246_10034284
530 Ga0105246_10046850
531 Ga0157374_10054400
532 Ga0157374_10264942
533 Ga0157378_10185142
534 Ga0157378_10704199
535 Ga0163162_10043115
536 Ga0163162_10385155
537 Ga0163162_10557147
538 Ga0163162_10612830
539 Ga0157375_10077806
540 Ga0157375_10584588
541 Ga0163163_10030297
542 Ga0163163_10690645
543 Ga0157380_10031542
544 Ga0157380_10519716
545 Ga0157380_10873019
546 Ga0157380_11204267
547 Ga0157380_11966943
548 Ga0157380_12212927
549 Ga0157379_10037901
550 Ga0157376_10112367
551 Ga0209677_100563
552 Ga0207682_10014287
553 Ga0207692_10001401
554 Ga0207692_10444102
555 Ga0207642_10173206
556 Ga0207710_10381064
557 Ga0207699_10000245
558 Ga0207643_10029773
559 Ga0207654_10091885
560 Ga0207693_10003833
561 Ga0207693_10055131
562 Ga0207663_10002846
563 Ga0207660_10039647
564 Ga0207662_10070913
565 Ga0207681_10863212
566 Ga0207694_10099059
567 Ga0207694_10826932
568 Ga0207659_10659432
569 Ga0207687_10046115
570 Ga0207687_10137527
571 Ga0207700_10568666
572 Ga0207664_10005476
573 Ga0207644_10188395
574 Ga0207644_10393416
575 Ga0207690_10173153
576 Ga0207686_10061337
577 Ga0207686_10633567
578 Ga0207709_10438263
579 Ga0207709_10646911
580 Ga0207670_10142423
581 Ga0207669_10019788
582 Ga0207669_10023327
583 Ga0207704_10006645
584 Ga0207704_10127394
585 Ga0207704_10369761
586 Ga0207665_10022568
587 Ga0207691_10083772
588 Ga0207691_10212760
589 Ga0207711_10053719
590 Ga0207711_10844755
591 Ga0207689_10002843
592 Ga0207689_10035172
593 Ga0207689_10515691
594 Ga0207679_10032657
595 Ga0207667_10094670
596 Ga0207667_10397488
597 Ga0207651_10021861
598 Ga0207651_10252557
599 Ga0207651_11027315
600 Ga0207668_10007115
601 Ga0207658_10110763
602 Ga0207658_10863207
603 Ga0207677_10243798
604 Ga0207677_10499096
605 Ga0207677_11063963
606 Ga0207703_10045202
607 Ga0207703_11216830
608 Ga0207678_10019339
609 Ga0207702_10023130
610 Ga0207641_10038479
611 Ga0207641_10259634
612 Ga0207648_10063137
613 Ga0207648_10163394
614 Ga0207648_10506887
615 Ga0207676_10306616
616 Ga0207676_11208040
617 Ga0207674_10051710
618 Ga0207674_10222779
619 Ga0207675_100026253
620 Ga0207675_100555415
621 Ga0207675_100800509
622 Ga0207683_10038256
623 Ga0207683_10152125
624 Ga0207698_10290712
625 Ga0268266_10396014
626 Ga0268266_10855162
627 Ga0268266_11366110
628 Ga0268265_10000975
629 Ga0268265_10089949
630 Ga0268265_10931384
631 Ga0268264_10103256
632 Ga0268264_10967569
633 Ga0307515_10454459
634 Ga0265338_10005172
635 Ga0307513_10079886
636 Ga0307513_10202210
637 Ga0307509_10194666
638 Ga0265314_10067982
639 Ga0307416_102114966
640 Ga0307414_10045053
641 Ga0373930_0026091
642 Ga0373928_0150080
643 Ga0373952_0131501
644 Ga0373936_0095672
645 Ga0373937_0668357
646 Ga0373937_0694410
647 Ga0395899_0000137
648 Ga0395899_0173789
649 Ga0395899_0223149
650 Ga0395900_0000108
651 Ga0395900_0085703
652 Ga0395898_0000632
653 Ga0395898_0026044
654 Ga0395898_0083896
655 Ga0395905_0000780
656 Ga0395905_0132544
657 Ga0436364_0729605
658 Ga0395901_0000050
659 Ga0395901_0637875
660 Ga0395901_1213666
661 Ga0436365_0961428
662 Ga0436365_1603010
663 Ga0436365_1815653
664 Ga0436361_1193008
665 Ga0439453_0014546
666 Ga0451843_0339312
667 Ga0439451_070525
668 Ga0439446_0031605
669 Ga0439446_0177366
670 Ga0439444_0024219
671 Ga0466965_0367468
672 Ga0466960_0066370
673 Ga0451576_0963099
674 Ga0466967_0027806
675 Ga0466967_0803624
676 Ga0495617_011865
677 Ga0495592_0507832
678 Ga0495603_0111586
679 Ga0495638_0005607
680 Ga0495651_0206404
681 Ga0495631_0050014
682 Ga0495621_0054383
683 Ga0495622_0006396
684 Ga0495622_0181066
685 Ga0495625_0210916
686 Ga0495661_0082250
687 Ga0495623_0202345
688 Ga0495624_0085953
689 Ga0495636_0603515
690 Ga0495672_0128139
691 Ga0495683_0199070
692 Ga0495685_112193
693 Ga0496100_0088267
694 Ga0496101_0013015
695 Ga0496101_0159908
696 Ga0496102_0038707
697 Ga0496104_0061406
698 Ga0496104_0354197
699 Ga0496105_0031727
700 Ga0496105_0554893
701 Ga0496106_0143152
702 Ga0496106_0279886
703 Ga0496107_0016921
704 Ga0496108_0150672
705 Ga0496109_0196430
706 Ga0496109_0297039
707 Ga0496110_0447956
708 Ga0496111_0170877
709 Ga0496112_1014511
710 Ga0496113_0195019
711 Ga0496114_0004832
712 Ga0496114_0009349
713 Ga0496114_0665920
714 Ga0496115_0001860
715 Ga0496119_0087902
716 Ga0496120_0092858
717 Ga0496121_0349170
718 Ga0496124_0279062
719 Ga0501031_0507066
720 Ga0501033_0045900
721 Ga0501034_0324785
722 Ga0501037_0065617
723 Ga0501038_0499820
724 Ga0501043_0585688
725 Ga0501047_0146096
726 Ga0501070_0196788
727 Ga0501083_0128650
728 Ga0501083_0337474
729 Ga0501044_0150224
730 nmdc:mga03683_41190_c1
731 nmdc:mga03n38_40894_c1
732 nmdc:mga0k408_23232_c1
733 nmdc:mga07m45_118180_c1
734 nmdc:mga08x19_298293_c1
735 nmdc:mga0sz30_127565_c1
736 Ga0500610_0058746
737 Ga0500647_0142744
738 Ga0500641_0009256
739 Ga0500641_0027215
740 Ga0500641_0092958
741 Ga0500607_018812
742 Ga0500614_029307
743 Ga0500628_115310
744 Ga0500603_255214
745 Ga0500604_0014425
746 Ga0500637_0001892
747 Ga0500611_061743
748 2793079614
749 2857512346
750 2874607480
751 3000405933
752 8006998687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

27

141

0.9

PF13671

AAA_33

AAA domain

21

154

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eun-assembly1.cif.gz_A-2 crystal structure of a sugar kinase (target efi-502144 from janibacter sp. htcc2649), unliganded structure 0.9464 26 187
1ko4-assembly1.cif.gz_A crystal structure of gluconate kinase 0.9274 25 189
1ko4-assembly1.cif.gz_B crystal structure of gluconate kinase 0.9269 25 189
1ko1-assembly1.cif.gz_B crystal structure of gluconate kinase 0.9255 25 189
1ko1-assembly1.cif.gz_A crystal structure of gluconate kinase 0.9244 25 189
ID Description Score Start End Superfamily
af_A0A0R0IZ75_2_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9589 28 187 3.40.50.300
4eunA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 26 187 3.40.50.300
af_Q8R0J8_1_184_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9381 26 190 3.40.50.300
af_Q4DG54_10_193_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.933 28 189 3.40.50.300
af_Q10242_7_192_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9323 28 189 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6N6XDW1-F1-model_v4 deleted 1.003 28 115
AF-A0A6G1RRH0-F1-model_v4 Gluconokinase (EC 2.7.1.12) 0.9938 28 117 GO:0005524
GO:0005737
GO:0046177
GO:0046316
AF-A0A840Y3J4-F1-model_v4 Gluconokinase (EC 2.7.1.12) 0.9866 27 190 GO:0005524
GO:0005737
GO:0046177
GO:0046316
AF-A0A4S3M048-F1-model_v4 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 0.9834 28 189 GO:0004616
GO:0005524
GO:0006098
GO:0016054
GO:0019521
GO:0046316
GO:0050661
AF-A0A858X5C1-F1-model_v4 Gluconokinase (EC 2.7.1.12) 0.9802 32 189 GO:0005524
GO:0005737
GO:0046177
GO:0046316

Map