F427400

General Info

Members Datasets Scaffolds Average Seq Length
376 223 363 212

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10020765|Ga0307414_100207652
Length 240
Sequence MSHRPVFEGRIGVTRGDLQLARAPARRVGGSPVESLNEHVEDAGVVAFDFDGTLTVRDSFTAFLKWRAGPARYNRGMVNLLPAAISYLGHRNRGRIKAAAVREFLIGVPRGQLEAEARAFAEIMAPRLLRPDAVRTWRRWGQRHAKLVIVTASPDIVVAPFARGLGADLLIGTELAFDDHDRVVGVFLGPNCRGAEKVRRLQDVFGPDLRLAAAYGDTSGDREMLAIADEPGYRVFQEKP

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
5 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
6 2643221584 Caulobacter sp. Root656 Isolate Unclassified
7 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
8 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
9 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
10 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2818991435 Caulobacter henricii 536 Isolate Unclassified
13 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
204 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
207 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
223 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.54
Nodule 0
Rhizoplane 4.26
Rhizosphere 65.69
Stem 0
Stem Tuber 0
Unclassified 8.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10065405 3300003322 Bacteria 2239
2 rootL2_10090676 3300003322 Bacteria 1237
3 rootL2_10315262 3300003322 Bacteria 1223
4 Ga0055526_1023914 3300003771 Bacteria 2020
5 Ga0055524_1017728 3300003775 Bacteria 2499
6 Ga0055536_1009569 3300003781 Bacteria 3986
7 Ga0055528_1007529 3300003790 Bacteria 4802
8 Ga0055530_10004614 3300003791 Bacteria 7014
9 Ga0055531_10007369 3300003794 Bacteria 6025
10 Ga0055531_10013877 3300003794 Bacteria 3679
11 Ga0055531_10017687 3300003794 Bacteria 2993
12 Ga0065165_1003957 3300005262 Bacteria 9721
13 Ga0065165_1004212 3300005262 Bacteria 9154
14 Ga0065165_1072922 3300005262 Bacteria 908
15 Ga0070683_100190256 3300005329 Bacteria 1948
16 Ga0070670_100018621 3300005331 Bacteria 5950
17 Ga0070670_100053150 3300005331 Bacteria 3478
18 Ga0070670_100173117 3300005331 Bacteria 1873
19 Ga0070666_10160247 3300005335 Bacteria 1572
20 Ga0070680_100077781 3300005336 Bacteria 2732
21 Ga0068868_100095500 3300005338 Bacteria 2400
22 Ga0070660_100050543 3300005339 Bacteria 3199
23 Ga0070660_100266066 3300005339 Bacteria 1401
24 Ga0070691_10050748 3300005341 Bacteria 1980
25 Ga0070691_10295415 3300005341 Bacteria 883
26 Ga0070668_100013502 3300005347 Bacteria 6097
27 Ga0070668_100031633 3300005347 Bacteria 4026
28 Ga0070669_100065564 3300005353 Bacteria 2675
29 Ga0070671_100052008 3300005355 Bacteria 3407
30 Ga0070671_100271502 3300005355 Bacteria 1441
31 Ga0070659_100001259 3300005366 Bacteria 18398
32 Ga0070659_100010710 3300005366 Bacteria 6757
33 Ga0070667_100000140 3300005367 Bacteria 91817
34 Ga0070667_100557007 3300005367 Bacteria 1054
35 Ga0070667_100612252 3300005367 Bacteria 1004
36 Ga0070678_100255619 3300005456 Bacteria 1471
37 Ga0070662_100059290 3300005457 Bacteria 2788
38 Ga0070662_100059808 3300005457 Bacteria 2777
39 Ga0070681_10061366 3300005458 Bacteria 3734
40 Ga0070679_100061433 3300005530 Bacteria 3745
41 Ga0068853_100149966 3300005539 Bacteria 2098
42 Ga0068853_100354911 3300005539 Bacteria 1365
43 Ga0070665_100002787 3300005548 Bacteria 18954
44 Ga0070665_100100841 3300005548 Bacteria 2891
45 Ga0070665_100464700 3300005548 Bacteria 1276
46 Ga0068855_100095219 3300005563 Bacteria 3432
47 Ga0068855_100720883 3300005563 Bacteria 1066
48 Ga0070664_100064151 3300005564 Bacteria 3133
49 Ga0070664_100306700 3300005564 Bacteria 1436
50 Ga0068856_100270095 3300005614 Bacteria 1716
51 Ga0068856_100866188 3300005614 Bacteria 922
52 Ga0068859_100000177 3300005617 Bacteria 62179
53 Ga0068859_100121303 3300005617 Bacteria 2681
54 Ga0068864_100001947 3300005618 Bacteria 16966
55 Ga0068864_100006632 3300005618 Bacteria 9476
56 Ga0068864_100235000 3300005618 Bacteria 1696
57 Ga0068864_101043532 3300005618 Bacteria 812
58 Ga0068861_100187960 3300005719 Bacteria 1724
59 Ga0068863_100000007 3300005841 Bacteria 257578
60 Ga0068863_100045294 3300005841 Bacteria 4175
61 Ga0068863_100050023 3300005841 Bacteria 3963
62 Ga0068863_100461286 3300005841 Bacteria 1248
63 Ga0068858_100000098 3300005842 Bacteria 90747
64 Ga0068858_100057991 3300005842 Bacteria 3579
65 Ga0068858_100624777 3300005842 Bacteria 1046
66 Ga0068860_100032061 3300005843 Bacteria 5052
67 Ga0068860_100064830 3300005843 Bacteria 3469
68 Ga0068860_101115830 3300005843 Bacteria 808
69 Ga0068862_100035404 3300005844 Bacteria 4228
70 Ga0068862_100065292 3300005844 Bacteria 3134
71 Ga0068862_100441632 3300005844 Bacteria 1225
72 Ga0075365_10122405 3300006038 Bacteria 1795
73 Ga0075363_100154506 3300006048 Bacteria 1296
74 Ga0075364_10008882 3300006051 Bacteria 6019
75 Ga0075367_10022484 3300006178 Bacteria 3537
76 Ga0075366_10018555 3300006195 Bacteria 4018
77 Ga0075366_10048429 3300006195 Bacteria 2520
78 Ga0097621_100350501 3300006237 Bacteria 1313
79 Ga0075370_10047749 3300006353 Bacteria 2424
80 Ga0097620_100000177 3300006931 Bacteria 62179
81 Ga0097620_100121310 3300006931 Bacteria 2681
82 Ga0097620_100587822 3300006931 Bacteria 1207
83 Ga0105250_10008323 3300009092 Bacteria 4414
84 Ga0105240_10001441 3300009093 Bacteria 40617
85 Ga0105240_10143972 3300009093 Bacteria 2846
86 Ga0105240_10241888 3300009093 Bacteria 2092
87 Ga0105240_10378307 3300009093 Bacteria 1600
88 Ga0105245_10238125 3300009098 Bacteria 1763
89 Ga0105242_10121151 3300009176 Bacteria 2245
90 Ga0105248_10011569 3300009177 Bacteria 9722
91 Ga0105248_10020874 3300009177 Bacteria 7259
92 Ga0105248_10062869 3300009177 Bacteria 4167
93 Ga0105248_10120738 3300009177 Bacteria 2957
94 Ga0105248_10393709 3300009177 Bacteria 1560
95 Ga0105237_10265719 3300009545 Bacteria 1719
96 Ga0105238_10028284 3300009551 Bacteria 5712
97 Ga0105249_10007492 3300009553 Bacteria 9521
98 Ga0105239_10517899 3300010375 Bacteria 1357
99 Ga0157373_10002242 3300013100 Bacteria 14634
100 Ga0157373_10006993 3300013100 Bacteria 8405
101 Ga0157374_10275734 3300013296 Bacteria 1659
102 Ga0163162_10010178 3300013306 Bacteria 9134
103 Ga0163162_10429672 3300013306 Bacteria 1453
104 Ga0157375_10579955 3300013308 Bacteria 1282
105 Ga0163163_10004496 3300014325 Bacteria 11902
106 Ga0163163_10096833 3300014325 Bacteria 2971
107 Ga0163163_10326118 3300014325 Bacteria 1589
108 Ga0163163_10377637 3300014325 Bacteria 1475
109 Ga0157380_10238759 3300014326 Bacteria 1637
110 Ga0157379_10005702 3300014968 Bacteria 10705
111 Ga0157379_10043897 3300014968 Bacteria 3992
112 Ga0157379_10048250 3300014968 Bacteria 3801
113 Ga0157379_10503728 3300014968 Bacteria 1122
114 Ga0182007_10183562 3300015262 Bacteria 724
115 Ga0213872_10045083 3300021361 Bacteria 2006
116 Ga0209026_1001220 3300025250 Bacteria 11824
117 Ga0209148_1012136 3300025254 Bacteria 1582
118 Ga0209565_1000718 3300025263 Bacteria 20086
119 Ga0209673_1001201 3300025273 Bacteria 27778
120 Ga0209676_1008806 3300025292 Bacteria 4442
121 Ga0209564_1010001 3300025295 Bacteria 4430
122 Ga0209758_1001461 3300025297 Bacteria 27740
123 Ga0209758_1010309 3300025297 Bacteria 5615
124 Ga0209758_1023808 3300025297 Bacteria 2753
125 Ga0209050_1000431 3300025298 Bacteria 76895
126 Ga0209050_1028704 3300025298 Bacteria 1799
127 Ga0209256_1009283 3300025299 Bacteria 4342
128 Ga0209256_1011186 3300025299 Bacteria 3626
129 Ga0207426_1092310 3300025302 Unclassified 799
130 Ga0209257_1000386 3300025304 Bacteria 88085
131 Ga0209257_1000387 3300025304 Bacteria 88061
132 Ga0209257_1005276 3300025304 Bacteria 9211
133 Ga0209257_1005281 3300025304 Bacteria 9209
134 Ga0207680_10109949 3300025903 Bacteria 1786
135 Ga0207707_10030930 3300025912 Bacteria 4683
136 Ga0207695_10000718 3300025913 Bacteria 64451
137 Ga0207695_10001929 3300025913 Bacteria 32246
138 Ga0207695_10036713 3300025913 Bacteria 5293
139 Ga0207695_10088789 3300025913 Bacteria 3110
140 Ga0207660_10108095 3300025917 Bacteria 2088
141 Ga0207657_10057619 3300025919 Bacteria 3347
142 Ga0207657_10678544 3300025919 Bacteria 801
143 Ga0207652_10171395 3300025921 Bacteria 1948
144 Ga0207681_10061345 3300025923 Bacteria 2584
145 Ga0207694_10034108 3300025924 Bacteria 3901
146 Ga0207650_10000062 3300025925 Bacteria 149776
147 Ga0207650_10088802 3300025925 Bacteria 2358
148 Ga0207650_10411360 3300025925 Bacteria 1121
149 Ga0207664_10130922 3300025929 Bacteria 2112
150 Ga0207644_10032105 3300025931 Bacteria 3661
151 Ga0207644_10062635 3300025931 Bacteria 2698
152 Ga0207690_10000053 3300025932 Bacteria 105125
153 Ga0207690_10001945 3300025932 Bacteria 12658
154 Ga0207706_10044493 3300025933 Bacteria 3935
155 Ga0207711_10020845 3300025941 Bacteria 5471
156 Ga0207711_10030377 3300025941 Bacteria 4557
157 Ga0207711_10102547 3300025941 Bacteria 2533
158 Ga0207711_10128403 3300025941 Bacteria 2270
159 Ga0207679_10050772 3300025945 Bacteria 3032
160 Ga0207679_10490691 3300025945 Bacteria 1095
161 Ga0207667_10069156 3300025949 Bacteria 3675
162 Ga0207651_10190985 3300025960 Bacteria 1634
163 Ga0207712_10001325 3300025961 Bacteria 16947
164 Ga0207712_10002244 3300025961 Bacteria 12566
165 Ga0207712_10129577 3300025961 Bacteria 1920
166 Ga0207668_10004311 3300025972 Bacteria 8351
167 Ga0207668_10017579 3300025972 Bacteria 4483
168 Ga0207658_10000264 3300025986 Bacteria 55170
169 Ga0207658_10019457 3300025986 Bacteria 4696
170 Ga0207658_10528139 3300025986 Bacteria 1054
171 Ga0207658_10738460 3300025986 Bacteria 891
172 Ga0207677_10210317 3300026023 Bacteria 1553
173 Ga0207703_10000086 3300026035 Bacteria 107307
174 Ga0207703_10031079 3300026035 Bacteria 4221
175 Ga0207639_10019774 3300026041 Bacteria 4809
176 Ga0207639_10115371 3300026041 Bacteria 2196
177 Ga0207639_10541548 3300026041 Bacteria 1068
178 Ga0207639_10760472 3300026041 Bacteria 901
179 Ga0207641_10000012 3300026088 Bacteria 375486
180 Ga0207641_10004723 3300026088 Bacteria 11745
181 Ga0207641_10027153 3300026088 Bacteria 4727
182 Ga0207641_10053882 3300026088 Bacteria 3411
183 Ga0207641_10156581 3300026088 Bacteria 2067
184 Ga0207676_10000437 3300026095 Bacteria 35190
185 Ga0207676_10000445 3300026095 Bacteria 35000
186 Ga0207676_10412015 3300026095 Bacteria 1265
187 Ga0207683_10046325 3300026121 Bacteria 3805
188 Ga0209981_1000885 3300027378 Bacteria 3752
189 Ga0268266_10000355 3300028379 Bacteria 70950
190 Ga0268266_10035697 3300028379 Bacteria 4228
191 Ga0268266_10621487 3300028379 Bacteria 1038
192 Ga0268265_10018646 3300028380 Bacteria 4811
193 Ga0268265_10057727 3300028380 Bacteria 2960
194 Ga0268265_10663025 3300028380 Bacteria 1004
195 Ga0268264_10020244 3300028381 Bacteria 5437
196 Ga0268264_10055402 3300028381 Bacteria 3313
197 Ga0268264_10315846 3300028381 Bacteria 1476
198 Ga0307517_10003553 3300028786 Bacteria 24213
199 Ga0307517_10033214 3300028786 Bacteria 5937
200 Ga0307517_10282632 3300028786 Bacteria 945
201 Ga0307517_10282795 3300028786 Bacteria 944
202 Ga0307515_10147102 3300028794 Bacteria 2488
203 Ga0265327_10007670 3300031251 Bacteria 8264
204 Ga0307513_10002479 3300031456 Bacteria 25548
205 Ga0307513_10013311 3300031456 Bacteria 10101
206 Ga0307513_10071002 3300031456 Bacteria 3636
207 Ga0307406_10007964 3300031901 Bacteria 5902
208 Ga0307414_10020765 3300032004 Bacteria 4101
209 Ga0307414_10509245 3300032004 Bacteria 1066
210 Ga0307510_10002446 3300033180 Bacteria 21094
211 Ga0373944_0004196 3300035089 Bacteria 3746
212 Ga0373943_0035616 3300035170 Bacteria 2380
213 Ga0373935_0041801 3300035692 Bacteria 2881
214 Ga0373927_0000323 3300035695 Bacteria 37618
215 Ga0373927_0526640 3300035695 Unclassified 781
216 Ga0373947_0025919 3300035725 Bacteria 3421
217 Ga0373925_0000061 3300037068 Bacteria 117783
218 Ga0373925_0089860 3300037068 Bacteria 2347
219 Ga0395899_0196590 3300037312 Bacteria 1408
220 Ga0395898_0401724 3300037466 Bacteria 1306
221 Ga0395898_0932948 3300037466 Bacteria 805
222 Ga0395905_0371588 3300037471 Bacteria 1323
223 Ga0395905_1087134 3300037471 Bacteria 703
224 Ga0395901_0087977 3300038443 Bacteria 3248
225 Ga0436365_0410577 3300039437 Bacteria 1771
226 Ga0436365_0861337 3300039437 Bacteria 1377
227 Ga0439431_0047606 3300041997 Unclassified 1106
228 Ga0439435_0026880 3300042436 Bacteria 1535
229 Ga0495638_0005267 3300046460 Bacteria 9662
230 Ga0495638_0025902 3300046460 Bacteria 3807
231 Ga0495638_0041933 3300046460 Bacteria 2892
232 Ga0495638_0081808 3300046460 Bacteria 1959
233 Ga0495650_0000017 3300046471 Bacteria 542552
234 Ga0495585_0121125 3300046492 Bacteria 1384
235 Ga0495583_0000020 3300046506 Bacteria 296185
236 Ga0495583_0074018 3300046506 Bacteria 1492
237 Ga0495606_0010478 3300046507 Bacteria 7685
238 Ga0495610_0007433 3300046512 Bacteria 7289
239 Ga0495610_0047652 3300046512 Bacteria 2107
240 Ga0495610_0165634 3300046512 Bacteria 931
241 Ga0495616_0001127 3300046513 Bacteria 18940
242 Ga0495616_0122451 3300046513 Bacteria 1199
243 Ga0495620_0177156 3300046515 Bacteria 825
244 Ga0495632_0017585 3300046519 Bacteria 3941
245 Ga0495637_0052109 3300046520 Bacteria 1710
246 Ga0495643_0116255 3300046522 Bacteria 1355
247 Ga0495648_0146743 3300046524 Bacteria 1235
248 Ga0495642_0015520 3300046528 Bacteria 2962
249 Ga0495654_0017290 3300046530 Bacteria 3794
250 Ga0495609_0056932 3300046538 Bacteria 1732
251 Ga0495609_0072649 3300046538 Bacteria 1510
252 Ga0495597_0013069 3300046542 Bacteria 3985
253 Ga0495597_0148170 3300046542 Bacteria 964
254 Ga0495645_0010417 3300046543 Bacteria 6516
255 Ga0495622_0069024 3300046557 Bacteria 1632
256 Ga0495668_0029401 3300046616 Bacteria 3105
257 Ga0495668_0062667 3300046616 Bacteria 2048
258 Ga0495668_0253744 3300046616 Bacteria 963
259 Ga0495668_0276813 3300046616 Bacteria 919
260 Ga0495611_0007730 3300046648 Bacteria 4566
261 Ga0495625_0007924 3300046660 Bacteria 9132
262 Ga0495625_0037085 3300046660 Bacteria 3578
263 Ga0495625_0044301 3300046660 Bacteria 3222
264 Ga0495625_0060289 3300046660 Bacteria 2688
265 Ga0495625_0070075 3300046660 Bacteria 2462
266 Ga0495625_0142573 3300046660 Bacteria 1615
267 Ga0495659_0118346 3300046664 Unclassified 1040
268 Ga0495669_0000003 3300046684 Bacteria 267741
269 Ga0495669_0001386 3300046684 Bacteria 10003
270 Ga0495669_0065619 3300046684 Bacteria 1648
271 Ga0495660_0077197 3300046810 Bacteria 1753
272 Ga0495660_0078286 3300046810 Bacteria 1738
273 Ga0495636_0072375 3300047318 Bacteria 1473
274 Ga0495672_0003643 3300047320 Bacteria 13052
275 Ga0495672_0076744 3300047320 Bacteria 1875
276 Ga0495683_0234977 3300047323 Bacteria 811
277 Ga0495677_0039856 3300047445 Bacteria 1717
278 Ga0495677_0048794 3300047445 Bacteria 1555
279 Ga0495673_0000082 3300047469 Bacteria 199141
280 Ga0495673_0025246 3300047469 Bacteria 2857
281 Ga0495681_0110077 3300047470 Bacteria 1194
282 Ga0495686_0040022 3300047472 Bacteria 2991
283 Ga0495686_0042444 3300047472 Bacteria 2892
284 Ga0495686_0063410 3300047472 Bacteria 2290
285 Ga0495593_0099291 3300047673 Bacteria 1494
286 Ga0496100_0399304 3300048903 Bacteria 1047
287 Ga0496102_0241530 3300048905 Bacteria 1703
288 Ga0496102_0305881 3300048905 Bacteria 1498
289 Ga0496102_1083066 3300048905 Bacteria 721
290 Ga0496103_0512325 3300048906 Bacteria 767
291 Ga0496105_1001829 3300048908 Bacteria 625
292 Ga0496106_0012191 3300048909 Bacteria 6344
293 Ga0496106_0094125 3300048909 Bacteria 2316
294 Ga0496106_0422018 3300048909 Bacteria 1072
295 Ga0496107_0000604 3300048910 Bacteria 20018
296 Ga0496107_0268366 3300048910 Bacteria 1270
297 Ga0496108_0173947 3300048911 Bacteria 1863
298 Ga0496109_0060269 3300048912 Bacteria 3468
299 Ga0496112_0038695 3300048915 Bacteria 4658
300 Ga0496115_0004245 3300048918 Bacteria 10363
301 Ga0496115_0039017 3300048918 Bacteria 3771
302 Ga0496116_0065545 3300048919 Bacteria 2329
303 Ga0496117_0011721 3300048920 Bacteria 7819
304 Ga0496118_0019884 3300048921 Bacteria 5981
305 Ga0496119_0025336 3300048922 Bacteria 4146
306 Ga0496121_0000009 3300048924 Bacteria 836971
307 Ga0496121_0001392 3300048924 Bacteria 40941
308 Ga0496126_0433374 3300048929 Bacteria 1061
309 Ga0496126_0456626 3300048929 Bacteria 1027
310 Ga0495678_137277 3300049459 Bacteria 804
311 Ga0501033_0160002 3300049570 Bacteria 1621
312 Ga0501043_0441711 3300049579 Bacteria 979
313 Ga0501043_0726312 3300049579 Bacteria 724
314 Ga0501047_0034598 3300049581 Bacteria 4878
315 Ga0501047_0281626 3300049581 Bacteria 1507
316 Ga0501047_0331889 3300049581 Bacteria 1359
317 Ga0501238_001692 3300049671 Bacteria 2571
318 nmdc:mga03n38_387418_c1 3300050490 Bacteria 767
319 nmdc:mga00v17_6937_c1 3300050491 Bacteria 6024
320 nmdc:mga0k408_100550_c1 3300050493 Bacteria 1705
321 nmdc:mga0k408_13933_c1 3300050493 Bacteria 4419
322 nmdc:mga06z11_67747_c1 3300050494 Bacteria 1880
323 nmdc:mga07m45_2842_c1 3300050496 Bacteria 8193
324 Ga0500635_0000307 3300053080 Bacteria 17183
325 Ga0500578_0249331 3300053086 Bacteria 1070
326 Ga0500578_0389538 3300053086 Bacteria 806
327 Ga0500643_031705 3300053087 Bacteria 1609
328 Ga0500644_0014611 3300053088 Bacteria 2220
329 Ga0500583_0026387 3300053092 Bacteria 2495
330 Ga0500651_0050012 3300053093 Bacteria 2624
331 Ga0500651_0057235 3300053093 Bacteria 2440
332 Ga0500566_0166410 3300053094 Bacteria 1144
333 Ga0500641_0031347 3300053096 Bacteria 2096
334 Ga0500554_037015 3300053102 Bacteria 1477
335 Ga0500555_000712 3300053103 Bacteria 12570
336 Ga0500556_0001498 3300053104 Bacteria 9675
337 Ga0500556_0011093 3300053104 Bacteria 2661
338 Ga0500556_0058515 3300053104 Bacteria 1413
339 Ga0500562_001017 3300053108 Bacteria 6862
340 Ga0500562_015532 3300053108 Bacteria 1953
341 Ga0500569_009366 3300053109 Bacteria 2274
342 Ga0500595_007216 3300053119 Bacteria 4627
343 Ga0500595_078989 3300053119 Bacteria 966
344 Ga0500608_000286 3300053122 Bacteria 19714
345 Ga0500642_0221023 3300053130 Bacteria 877
346 Ga0500658_0006797 3300053134 Bacteria 4230
347 Ga0500658_0043336 3300053134 Bacteria 1812
348 Ga0500559_0000318 3300053136 Bacteria 36544
349 Ga0500559_0032722 3300053136 Bacteria 2235
350 Ga0500590_002400 3300053148 Bacteria 8285
351 Ga0500603_027938 3300053150 Bacteria 1436
352 Ga0500616_0014674 3300053153 Bacteria 4494
353 Ga0500622_0008283 3300053156 Bacteria 5829
354 Ga0500624_014081 3300053157 Bacteria 1205
355 Ga0500638_128716 3300053162 Bacteria 1150
356 Ga0500636_0084045 3300053177 Bacteria 1830
357 Ga0500576_063562 3300053725 Bacteria 1607
358 Ga0500645_001292 3300053730 Bacteria 13043
359 Ga0500645_003212 3300053730 Bacteria 6769
360 Ga0500645_010733 3300053730 Bacteria 3014
361 Ga0500645_015039 3300053730 Bacteria 2458
362 Ga0500609_004615 3300053731 Bacteria 1900
363 Ga0500596_002240 3300053735 Bacteria 3836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0118346 Ga0495659_0118346_54_545 163
2 3300025960 Ga0207651_10190985 Ga0207651_101909852 166
3 3300025941 Ga0207711_10102547 Ga0207711_101025473 175
4 3300009177 Ga0105248_10393709 Ga0105248_103937091 182
5 3300014968 Ga0157379_10503728 Ga0157379_105037281 182
6 3300005457 Ga0070662_100059808 Ga0070662_1000598082 188
7 3300005336 Ga0070680_100077781 Ga0070680_1000777812 195
8 3300005339 Ga0070660_100266066 Ga0070660_1002660662 195
9 3300005458 Ga0070681_10061366 Ga0070681_100613663 195
10 3300005530 Ga0070679_100061433 Ga0070679_1000614334 195
11 3300025912 Ga0207707_10030930 Ga0207707_100309304 195
12 3300025913 Ga0207695_10000718 Ga0207695_1000071824 195
13 3300025917 Ga0207660_10108095 Ga0207660_101080951 195
14 3300046515 Ga0495620_0177156 Ga0495620_0177156_40_627 195
15 3300046528 Ga0495642_0015520 Ga0495642_0015520_1460_2104 195
16 3300047318 Ga0495636_0072375 Ga0495636_0072375_481_1125 195
17 3300047445 Ga0495677_0039856 Ga0495677_0039856_517_1161 195
18 3300048908 Ga0496105_1001829 Ga0496105_1001829_10_597 195
19 3300049581 Ga0501047_0281626 Ga0501047_0281626_39_626 195
20 3300050491 nmdc:mga00v17_6937_c1 nmdc:mga00v17_6937_c1_3341_3928 195
21 3300050493 nmdc:mga0k408_13933_c1 nmdc:mga0k408_13933_c1_3151_3738 195
22 3300050494 nmdc:mga06z11_67747_c1 nmdc:mga06z11_67747_c1_834_1421 195
23 3300050496 nmdc:mga07m45_2842_c1 nmdc:mga07m45_2842_c1_4920_5507 195
24 3300005262 Ga0065165_1072922 Ga0065165_10729221 196
25 3300005331 Ga0070670_100173117 Ga0070670_1001731173 196
26 3300005338 Ga0068868_100095500 Ga0068868_1000955004 196
27 3300005456 Ga0070678_100255619 Ga0070678_1002556191 196
28 3300005457 Ga0070662_100059290 Ga0070662_1000592903 196
29 3300005564 Ga0070664_100306700 Ga0070664_1003067002 196
30 3300005618 Ga0068864_100006632 Ga0068864_1000066327 196
31 3300005842 Ga0068858_100624777 Ga0068858_1006247771 196
32 3300006237 Ga0097621_100350501 Ga0097621_1003505012 196
33 3300013296 Ga0157374_10275734 Ga0157374_102757343 196
34 3300013306 Ga0163162_10429672 Ga0163162_104296722 196
35 3300013308 Ga0157375_10579955 Ga0157375_105799552 196
36 3300025925 Ga0207650_10411360 Ga0207650_104113602 196
37 3300025933 Ga0207706_10044493 Ga0207706_100444932 196
38 3300025986 Ga0207658_10528139 Ga0207658_105281391 196
39 3300026023 Ga0207677_10210317 Ga0207677_102103172 196
40 3300026088 Ga0207641_10156581 Ga0207641_101565812 196
41 3300026095 Ga0207676_10412015 Ga0207676_104120152 196
42 3300026121 Ga0207683_10046325 Ga0207683_100463254 196
43 3300046492 Ga0495585_0121125 Ga0495585_0121125_160_759 196
44 3300046543 Ga0495645_0010417 Ga0495645_0010417_4678_5268 196
45 3300048903 Ga0496100_0399304 Ga0496100_0399304_170_814 196
46 3300048911 Ga0496108_0173947 Ga0496108_0173947_228_872 196
47 3300048912 Ga0496109_0060269 Ga0496109_0060269_1907_2551 196
48 3300048915 Ga0496112_0038695 Ga0496112_0038695_1592_2236 196
49 3300046616 Ga0495668_0253744 Ga0495668_0253744_132_779 199
50 3300046616 Ga0495668_0029401 Ga0495668_0029401_1317_1964 200
51 3300047472 Ga0495686_0063410 Ga0495686_0063410_11_640 201
52 3300005331 Ga0070670_100018621 Ga0070670_1000186214 202
53 3300005335 Ga0070666_10160247 Ga0070666_101602473 202
54 3300005347 Ga0070668_100031633 Ga0070668_1000316333 202
55 3300005367 Ga0070667_100000140 Ga0070667_1000001402 202
56 3300005548 Ga0070665_100100841 Ga0070665_1001008413 202
57 3300005617 Ga0068859_100121303 Ga0068859_1001213033 202
58 3300005618 Ga0068864_100001947 Ga0068864_10000194719 202
59 3300005841 Ga0068863_100045294 Ga0068863_1000452943 202
60 3300005843 Ga0068860_100032061 Ga0068860_1000320614 202
61 3300005844 Ga0068862_100065292 Ga0068862_1000652923 202
62 3300006931 Ga0097620_100121310 Ga0097620_1001213103 202
63 3300009098 Ga0105245_10238125 Ga0105245_102381253 202
64 3300009177 Ga0105248_10011569 Ga0105248_100115699 202
65 3300009553 Ga0105249_10007492 Ga0105249_100074923 202
66 3300014325 Ga0163163_10377637 Ga0163163_103776372 202
67 3300014968 Ga0157379_10048250 Ga0157379_100482505 202
68 3300025903 Ga0207680_10109949 Ga0207680_101099493 202
69 3300025925 Ga0207650_10000062 Ga0207650_10000062108 202
70 3300025961 Ga0207712_10001325 Ga0207712_1000132511 202
71 3300025972 Ga0207668_10017579 Ga0207668_100175794 202
72 3300025986 Ga0207658_10000264 Ga0207658_100002644 202
73 3300026088 Ga0207641_10004723 Ga0207641_100047233 202
74 3300026095 Ga0207676_10000437 Ga0207676_1000043737 202
75 3300028379 Ga0268266_10035697 Ga0268266_100356974 202
76 3300028380 Ga0268265_10018646 Ga0268265_100186464 202
77 3300028381 Ga0268264_10020244 Ga0268264_100202445 202
78 3300037312 Ga0395899_0196590 Ga0395899_0196590_113_751 202
79 3300037466 Ga0395898_0401724 Ga0395898_0401724_11_649 202
80 3300037466 Ga0395898_0932948 Ga0395898_0932948_11_649 202
81 3300037471 Ga0395905_0371588 Ga0395905_0371588_653_1291 202
82 3300038443 Ga0395901_0087977 Ga0395901_0087977_1476_2114 202
83 3300046530 Ga0495654_0017290 Ga0495654_0017290_2484_3098 202
84 3300046538 Ga0495609_0072649 Ga0495609_0072649_329_943 202
85 3300046542 Ga0495597_0013069 Ga0495597_0013069_761_1375 202
86 3300046557 Ga0495622_0069024 Ga0495622_0069024_1002_1616 202
87 3300047673 Ga0495593_0099291 Ga0495593_0099291_459_1073 202
88 3300048905 Ga0496102_0241530 Ga0496102_0241530_886_1500 202
89 3300048905 Ga0496102_0305881 Ga0496102_0305881_644_1252 202
90 3300048906 Ga0496103_0512325 Ga0496103_0512325_80_688 202
91 3300048909 Ga0496106_0422018 Ga0496106_0422018_21_635 202
92 3300048910 Ga0496107_0268366 Ga0496107_0268366_214_828 202
93 3300048918 Ga0496115_0004245 Ga0496115_0004245_1833_2495 202
94 3300048920 Ga0496117_0011721 Ga0496117_0011721_324_938 202
95 3300048921 Ga0496118_0019884 Ga0496118_0019884_1577_2191 202
96 3300048922 Ga0496119_0025336 Ga0496119_0025336_2538_3152 202
97 3300048924 Ga0496121_0000009 Ga0496121_0000009_733153_733767 202
98 3300053080 Ga0500635_0000307 Ga0500635_0000307_788_1405 202
99 3300053086 Ga0500578_0389538 Ga0500578_0389538_45_659 202
100 3300053092 Ga0500583_0026387 Ga0500583_0026387_1162_1776 202
101 3300053093 Ga0500651_0050012 Ga0500651_0050012_1255_1869 202
102 3300053109 Ga0500569_009366 Ga0500569_009366_1067_1681 202
103 3300053119 Ga0500595_007216 Ga0500595_007216_1087_1701 202
104 3300053122 Ga0500608_000286 Ga0500608_000286_4172_4786 202
105 3300053130 Ga0500642_0221023 Ga0500642_0221023_63_677 202
106 3300053134 Ga0500658_0043336 Ga0500658_0043336_107_721 202
107 3300053136 Ga0500559_0032722 Ga0500559_0032722_1398_2012 202
108 3300053148 Ga0500590_002400 Ga0500590_002400_3711_4325 202
109 3300053150 Ga0500603_027938 Ga0500603_027938_552_1169 202
110 3300053157 Ga0500624_014081 Ga0500624_014081_506_1123 202
111 3300053162 Ga0500638_128716 Ga0500638_128716_127_741 202
112 3300053177 Ga0500636_0084045 Ga0500636_0084045_1096_1713 202
113 3300053725 Ga0500576_063562 Ga0500576_063562_774_1388 202
114 3300053735 Ga0500596_002240 Ga0500596_002240_1930_2544 202
115 3300009545 Ga0105237_10265719 Ga0105237_102657192 203
116 3300005614 Ga0068856_100866188 Ga0068856_1008661882 204
117 3300009093 Ga0105240_10001441 Ga0105240_1000144144 204
118 3300025913 Ga0207695_10001929 Ga0207695_100019297 204
119 3300048929 Ga0496126_0433374 Ga0496126_0433374_398_1036 204
120 3300015262 Ga0182007_10183562 Ga0182007_101835621 205
121 3300005341 Ga0070691_10295415 Ga0070691_102954151 206
122 3300021361 Ga0213872_10045083 Ga0213872_100450833 207
123 3300025250 Ga0209026_1001220 Ga0209026_10012208 207
124 3300048905 Ga0496102_1083066 Ga0496102_1083066_26_649 207
125 3300053104 Ga0500556_0001498 Ga0500556_0001498_2122_2787 207
126 3300053108 Ga0500562_001017 Ga0500562_001017_5254_5916 207
127 3300053108 Ga0500562_015532 Ga0500562_015532_953_1618 207
128 3300053156 Ga0500622_0008283 Ga0500622_0008283_1023_1646 207
129 3300053730 Ga0500645_001292 Ga0500645_001292_6150_6815 207
130 3300005614 Ga0068856_100270095 Ga0068856_1002700953 208
131 3300025304 Ga0209257_1005281 Ga0209257_10052812 208
132 3300027378 Ga0209981_1000885 Ga0209981_10008853 208
133 3300046542 Ga0495597_0148170 Ga0495597_0148170_265_894 208
134 3300046616 Ga0495668_0276813 Ga0495668_0276813_99_728 208
135 3300053730 Ga0500645_015039 Ga0500645_015039_583_1212 208
136 3300003781 Ga0055536_1009569 Ga0055536_10095691 209
137 3300003791 Ga0055530_10004614 Ga0055530_100046145 209
138 3300003794 Ga0055531_10007369 Ga0055531_100073693 209
139 3300003794 Ga0055531_10013877 Ga0055531_100138772 209
140 3300005262 Ga0065165_1004212 Ga0065165_10042124 209
141 3300005329 Ga0070683_100190256 Ga0070683_1001902562 209
142 3300005331 Ga0070670_100053150 Ga0070670_1000531502 209
143 3300005339 Ga0070660_100050543 Ga0070660_1000505431 209
144 3300005341 Ga0070691_10050748 Ga0070691_100507482 209
145 3300005347 Ga0070668_100013502 Ga0070668_1000135026 209
146 3300005353 Ga0070669_100065564 Ga0070669_1000655643 209
147 3300005355 Ga0070671_100052008 Ga0070671_1000520082 209
148 3300005355 Ga0070671_100271502 Ga0070671_1002715021 209
149 3300005366 Ga0070659_100001259 Ga0070659_10000125925 209
150 3300005367 Ga0070667_100612252 Ga0070667_1006122521 209
151 3300005539 Ga0068853_100149966 Ga0068853_1001499664 209
152 3300005548 Ga0070665_100002787 Ga0070665_10000278719 209
153 3300005548 Ga0070665_100464700 Ga0070665_1004647002 209
154 3300005563 Ga0068855_100095219 Ga0068855_1000952193 209
155 3300005617 Ga0068859_100000177 Ga0068859_1000001773 209
156 3300005618 Ga0068864_100235000 Ga0068864_1002350001 209
157 3300005618 Ga0068864_101043532 Ga0068864_1010435321 209
158 3300005719 Ga0068861_100187960 Ga0068861_1001879602 209
159 3300005841 Ga0068863_100050023 Ga0068863_1000500235 209
160 3300005841 Ga0068863_100461286 Ga0068863_1004612862 209
161 3300005842 Ga0068858_100057991 Ga0068858_1000579915 209
162 3300005843 Ga0068860_100064830 Ga0068860_1000648303 209
163 3300005843 Ga0068860_101115830 Ga0068860_1011158301 209
164 3300005844 Ga0068862_100035404 Ga0068862_1000354042 209
165 3300005844 Ga0068862_100441632 Ga0068862_1004416322 209
166 3300006038 Ga0075365_10122405 Ga0075365_101224052 209
167 3300006048 Ga0075363_100154506 Ga0075363_1001545062 209
168 3300006931 Ga0097620_100000177 Ga0097620_1000001773 209
169 3300006931 Ga0097620_100587822 Ga0097620_1005878222 209
170 3300009093 Ga0105240_10143972 Ga0105240_101439723 209
171 3300009093 Ga0105240_10241888 Ga0105240_102418883 209
172 3300009093 Ga0105240_10378307 Ga0105240_103783071 209
173 3300009176 Ga0105242_10121151 Ga0105242_101211512 209
174 3300009177 Ga0105248_10020874 Ga0105248_100208749 209
175 3300009551 Ga0105238_10028284 Ga0105238_100282844 209
176 3300013306 Ga0163162_10010178 Ga0163162_100101789 209
177 3300014325 Ga0163163_10004496 Ga0163163_100044962 209
178 3300014325 Ga0163163_10326118 Ga0163163_103261183 209
179 3300014968 Ga0157379_10005702 Ga0157379_1000570211 209
180 3300025292 Ga0209676_1008806 Ga0209676_10088066 209
181 3300025297 Ga0209758_1001461 Ga0209758_10014615 209
182 3300025298 Ga0209050_1000431 Ga0209050_10004315 209
183 3300025302 Ga0207426_1092310 Ga0207426_10923101 209
184 3300025304 Ga0209257_1000387 Ga0209257_100038730 209
185 3300025304 Ga0209257_1005276 Ga0209257_10052768 209
186 3300025913 Ga0207695_10036713 Ga0207695_100367132 209
187 3300025913 Ga0207695_10088789 Ga0207695_100887892 209
188 3300025919 Ga0207657_10057619 Ga0207657_100576192 209
189 3300025919 Ga0207657_10678544 Ga0207657_106785441 209
190 3300025921 Ga0207652_10171395 Ga0207652_101713952 209
191 3300025923 Ga0207681_10061345 Ga0207681_100613452 209
192 3300025924 Ga0207694_10034108 Ga0207694_100341083 209
193 3300025925 Ga0207650_10088802 Ga0207650_100888021 209
194 3300025931 Ga0207644_10032105 Ga0207644_100321052 209
195 3300025931 Ga0207644_10062635 Ga0207644_100626354 209
196 3300025932 Ga0207690_10000053 Ga0207690_1000005354 209
197 3300025941 Ga0207711_10020845 Ga0207711_100208455 209
198 3300025949 Ga0207667_10069156 Ga0207667_100691563 209
199 3300025961 Ga0207712_10002244 Ga0207712_1000224417 209
200 3300025961 Ga0207712_10129577 Ga0207712_101295774 209
201 3300025972 Ga0207668_10004311 Ga0207668_100043113 209
202 3300025986 Ga0207658_10019457 Ga0207658_100194577 209
203 3300026035 Ga0207703_10031079 Ga0207703_100310794 209
204 3300026041 Ga0207639_10115371 Ga0207639_101153714 209
205 3300026088 Ga0207641_10027153 Ga0207641_100271534 209
206 3300026088 Ga0207641_10053882 Ga0207641_100538823 209
207 3300028379 Ga0268266_10000355 Ga0268266_1000035570 209
208 3300028379 Ga0268266_10621487 Ga0268266_106214872 209
209 3300028380 Ga0268265_10057727 Ga0268265_100577272 209
210 3300028381 Ga0268264_10055402 Ga0268264_100554023 209
211 3300028381 Ga0268264_10315846 Ga0268264_103158462 209
212 3300028786 Ga0307517_10033214 Ga0307517_100332147 209
213 3300028786 Ga0307517_10282795 Ga0307517_102827951 209
214 3300031456 Ga0307513_10071002 Ga0307513_100710022 209
215 3300031901 Ga0307406_10007964 Ga0307406_100079647 209
216 3300046506 Ga0495583_0074018 Ga0495583_0074018_796_1464 209
217 3300046648 Ga0495611_0007730 Ga0495611_0007730_974_1618 209
218 3300046660 Ga0495625_0142573 Ga0495625_0142573_653_1321 209
219 3300046684 Ga0495669_0000003 Ga0495669_0000003_204203_204832 209
220 3300046684 Ga0495669_0001386 Ga0495669_0001386_7450_8097 209
221 3300047320 Ga0495672_0076744 Ga0495672_0076744_860_1504 209
222 3300047445 Ga0495677_0048794 Ga0495677_0048794_492_1121 209
223 3300047470 Ga0495681_0110077 Ga0495681_0110077_96_740 209
224 3300048918 Ga0496115_0039017 Ga0496115_0039017_707_1354 209
225 3300048919 Ga0496116_0065545 Ga0496116_0065545_1076_1723 209
226 3300049570 Ga0501033_0160002 Ga0501033_0160002_185_823 209
227 3300049581 Ga0501047_0331889 Ga0501047_0331889_335_973 209
228 3300050490 nmdc:mga03n38_387418_c1 nmdc:mga03n38_387418_c1_104_748 209
229 3300053088 Ga0500644_0014611 Ga0500644_0014611_1164_1802 209
230 3300053093 Ga0500651_0057235 Ga0500651_0057235_1322_1960 209
231 3300053094 Ga0500566_0166410 Ga0500566_0166410_21_668 209
232 3300003322 rootL2_10315262 rootL2_103152621 210
233 3300014325 Ga0163163_10096833 Ga0163163_100968332 210
234 3300031456 Ga0307513_10013311 Ga0307513_100133114 210
235 3300039437 Ga0436365_0410577 Ga0436365_0410577_373_1008 210
236 3300041997 Ga0439431_0047606 Ga0439431_0047606_88_750 210
237 3300005366 Ga0070659_100010710 Ga0070659_1000107104 211
238 3300005539 Ga0068853_100354911 Ga0068853_1003549111 211
239 3300005564 Ga0070664_100064151 Ga0070664_1000641514 211
240 3300013100 Ga0157373_10002242 Ga0157373_100022428 211
241 3300013100 Ga0157373_10006993 Ga0157373_100069932 211
242 3300025254 Ga0209148_1012136 Ga0209148_10121362 211
243 3300025295 Ga0209564_1010001 Ga0209564_10100011 211
244 3300025932 Ga0207690_10001945 Ga0207690_1000194511 211
245 3300025945 Ga0207679_10050772 Ga0207679_100507724 211
246 3300026041 Ga0207639_10019774 Ga0207639_100197742 211
247 3300026041 Ga0207639_10541548 Ga0207639_105415481 211
248 3300028380 Ga0268265_10663025 Ga0268265_106630251 211
249 3300028794 Ga0307515_10147102 Ga0307515_101471022 211
250 3300046460 Ga0495638_0025902 Ga0495638_0025902_2695_3348 211
251 3300046460 Ga0495638_0081808 Ga0495638_0081808_445_1098 211
252 3300046507 Ga0495606_0010478 Ga0495606_0010478_4413_5066 211
253 3300046512 Ga0495610_0007433 Ga0495610_0007433_3207_3860 211
254 3300046513 Ga0495616_0001127 Ga0495616_0001127_757_1410 211
255 3300046513 Ga0495616_0122451 Ga0495616_0122451_421_1074 211
256 3300046519 Ga0495632_0017585 Ga0495632_0017585_2120_2773 211
257 3300046524 Ga0495648_0146743 Ga0495648_0146743_324_977 211
258 3300046538 Ga0495609_0056932 Ga0495609_0056932_898_1551 211
259 3300046660 Ga0495625_0037085 Ga0495625_0037085_483_1136 211
260 3300053087 Ga0500643_031705 Ga0500643_031705_898_1551 211
261 3300053134 Ga0500658_0006797 Ga0500658_0006797_766_1419 211
262 3300053731 Ga0500609_004615 Ga0500609_004615_816_1469 211
263 3300025298 Ga0209050_1028704 Ga0209050_10287042 212
264 3300025929 Ga0207664_10130922 Ga0207664_101309223 212
265 3300028786 Ga0307517_10003553 Ga0307517_1000355326 212
266 3300028786 Ga0307517_10282632 Ga0307517_102826321 212
267 3300031456 Ga0307513_10002479 Ga0307513_100024796 212
268 3300033180 Ga0307510_10002446 Ga0307510_1000244615 212
269 3300037471 Ga0395905_1087134 Ga0395905_1087134_14_676 212
270 iso_pu_bacteria 2643221598 2644000311 212
271 iso_pu_bacteria 2643221614 2644084920 212
272 iso_pu_bacteria 2643221661 2644342472 212
273 iso_pu_bacteria 2643221666 2644365772 212
274 3300005367 Ga0070667_100557007 Ga0070667_1005570072 213
275 3300006051 Ga0075364_10008882 Ga0075364_100088825 213
276 3300006178 Ga0075367_10022484 Ga0075367_100224842 213
277 3300006353 Ga0075370_10047749 Ga0075370_100477491 213
278 3300009177 Ga0105248_10120738 Ga0105248_101207383 213
279 3300025941 Ga0207711_10128403 Ga0207711_101284033 213
280 3300025986 Ga0207658_10738460 Ga0207658_107384601 213
281 3300031251 Ga0265327_10007670 Ga0265327_100076705 213
282 3300035089 Ga0373944_0004196 Ga0373944_0004196_2085_2747 213
283 3300035170 Ga0373943_0035616 Ga0373943_0035616_190_852 213
284 3300035692 Ga0373935_0041801 Ga0373935_0041801_408_1058 213
285 3300035695 Ga0373927_0000323 Ga0373927_0000323_11425_12087 213
286 3300035725 Ga0373947_0025919 Ga0373947_0025919_787_1437 213
287 3300037068 Ga0373925_0000061 Ga0373925_0000061_84708_85370 213
288 3300037068 Ga0373925_0089860 Ga0373925_0089860_1654_2304 213
289 3300039437 Ga0436365_0861337 Ga0436365_0861337_624_1289 213
290 3300049579 Ga0501043_0441711 Ga0501043_0441711_143_805 213
291 3300049581 Ga0501047_0034598 Ga0501047_0034598_883_1545 213
292 3300053096 Ga0500641_0031347 Ga0500641_0031347_952_1599 213
293 iso_pu_bacteria 2510917020 2511125518 213
294 iso_pu_bacteria 2582581280 2585153067 213
295 iso_pu_bacteria 2582581293 2585196629 213
296 iso_pu_bacteria 2643221545 2643751383 213
297 iso_pu_bacteria 2643221552 2643778175 213
298 iso_pu_bacteria 2643221584 2643928446 213
299 iso_pu_bacteria 2643221691 2644510564 213
300 iso_pu_bacteria 2818991435 2819536632 213
301 iso_pu_bacteria 2818991454 2819645793 213
302 3300005563 Ga0068855_100720883 Ga0068855_1007208832 214
303 3300005841 Ga0068863_100000007 Ga0068863_100000007246 214
304 3300005842 Ga0068858_100000098 Ga0068858_10000009887 214
305 3300006195 Ga0075366_10048429 Ga0075366_100484293 214
306 3300009092 Ga0105250_10008323 Ga0105250_100083236 214
307 3300009177 Ga0105248_10062869 Ga0105248_100628696 214
308 3300014968 Ga0157379_10043897 Ga0157379_100438972 214
309 3300025941 Ga0207711_10030377 Ga0207711_100303776 214
310 3300025945 Ga0207679_10490691 Ga0207679_104906912 214
311 3300026035 Ga0207703_10000086 Ga0207703_10000086102 214
312 3300026088 Ga0207641_10000012 Ga0207641_1000001263 214
313 3300026095 Ga0207676_10000445 Ga0207676_100004452 214
314 3300046684 Ga0495669_0065619 Ga0495669_0065619_872_1534 214
315 3300048909 Ga0496106_0094125 Ga0496106_0094125_1400_2068 214
316 3300053119 Ga0500595_078989 Ga0500595_078989_105_767 214
317 3300053103 Ga0500555_000712 Ga0500555_000712_8410_9099 215
318 3300053104 Ga0500556_0058515 Ga0500556_0058515_454_1140 215
319 3300010375 Ga0105239_10517899 Ga0105239_105178992 216
320 3300026041 Ga0207639_10760472 Ga0207639_107604721 216
321 3300032004 Ga0307414_10020765 Ga0307414_100207652 216
322 3300032004 Ga0307414_10509245 Ga0307414_105092452 216
323 3300035695 Ga0373927_0526640 Ga0373927_0526640_25_681 216
324 3300046660 Ga0495625_0070075 Ga0495625_0070075_291_959 216
325 3300049579 Ga0501043_0726312 Ga0501043_0726312_13_678 216
326 3300003322 rootL2_10065405 rootL2_100654051 217
327 3300003322 rootL2_10090676 rootL2_100906761 217
328 3300003771 Ga0055526_1023914 Ga0055526_10239142 217
329 3300003775 Ga0055524_1017728 Ga0055524_10177282 217
330 3300003790 Ga0055528_1007529 Ga0055528_10075292 217
331 3300003794 Ga0055531_10017687 Ga0055531_100176872 217
332 3300005262 Ga0065165_1003957 Ga0065165_10039576 217
333 3300006195 Ga0075366_10018555 Ga0075366_100185553 217
334 3300014326 Ga0157380_10238759 Ga0157380_102387592 217
335 3300025263 Ga0209565_1000718 Ga0209565_10007182 217
336 3300025273 Ga0209673_1001201 Ga0209673_100120132 217
337 3300025297 Ga0209758_1010309 Ga0209758_10103093 217
338 3300025297 Ga0209758_1023808 Ga0209758_10238081 217
339 3300025299 Ga0209256_1009283 Ga0209256_10092835 217
340 3300025299 Ga0209256_1011186 Ga0209256_10111863 217
341 3300025304 Ga0209257_1000386 Ga0209257_100038664 217
342 3300042436 Ga0439435_0026880 Ga0439435_0026880_77_748 217
343 3300046460 Ga0495638_0005267 Ga0495638_0005267_2089_2760 217
344 3300046460 Ga0495638_0041933 Ga0495638_0041933_1007_1678 217
345 3300046471 Ga0495650_0000017 Ga0495650_0000017_168654_169325 217
346 3300046506 Ga0495583_0000020 Ga0495583_0000020_98722_99408 217
347 3300046512 Ga0495610_0047652 Ga0495610_0047652_380_1051 217
348 3300046512 Ga0495610_0165634 Ga0495610_0165634_42_713 217
349 3300046520 Ga0495637_0052109 Ga0495637_0052109_489_1160 217
350 3300046522 Ga0495643_0116255 Ga0495643_0116255_465_1151 217
351 3300046616 Ga0495668_0062667 Ga0495668_0062667_1212_1898 217
352 3300046660 Ga0495625_0007924 Ga0495625_0007924_1020_1706 217
353 3300046660 Ga0495625_0044301 Ga0495625_0044301_463_1134 217
354 3300046660 Ga0495625_0060289 Ga0495625_0060289_999_1670 217
355 3300046810 Ga0495660_0077197 Ga0495660_0077197_280_966 217
356 3300046810 Ga0495660_0078286 Ga0495660_0078286_717_1388 217
357 3300047320 Ga0495672_0003643 Ga0495672_0003643_981_1670 217
358 3300047323 Ga0495683_0234977 Ga0495683_0234977_54_740 217
359 3300047469 Ga0495673_0000082 Ga0495673_0000082_23711_24382 217
360 3300047469 Ga0495673_0025246 Ga0495673_0025246_1878_2549 217
361 3300047472 Ga0495686_0040022 Ga0495686_0040022_725_1414 217
362 3300047472 Ga0495686_0042444 Ga0495686_0042444_542_1213 217
363 3300048909 Ga0496106_0012191 Ga0496106_0012191_991_1677 217
364 3300048910 Ga0496107_0000604 Ga0496107_0000604_11184_11870 217
365 3300048924 Ga0496121_0001392 Ga0496121_0001392_30172_30858 217
366 3300048929 Ga0496126_0456626 Ga0496126_0456626_33_719 217
367 3300049459 Ga0495678_137277 Ga0495678_137277_23_694 217
368 3300049671 Ga0501238_001692 Ga0501238_001692_774_1445 217
369 3300050493 nmdc:mga0k408_100550_c1 nmdc:mga0k408_100550_c1_550_1221 217
370 3300053086 Ga0500578_0249331 Ga0500578_0249331_288_959 217
371 3300053102 Ga0500554_037015 Ga0500554_037015_486_1172 217
372 3300053104 Ga0500556_0011093 Ga0500556_0011093_978_1667 217
373 3300053136 Ga0500559_0000318 Ga0500559_0000318_551_1237 217
374 3300053153 Ga0500616_0014674 Ga0500616_0014674_958_1629 217
375 3300053730 Ga0500645_003212 Ga0500645_003212_3211_3900 217
376 3300053730 Ga0500645_010733 Ga0500645_010733_72_761 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

46

226

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

44

229

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bbj-assembly1.cif.gz_A copper-transporting pib-atpase in complex with beryllium fluoride representing the e2p state 0.8021 105 204
4u9p-assembly1.cif.gz_A structure of the methanofuran/methanopterin biosynthetic enzyme mj1099 from methanocaldococcus jannaschii 0.8012 110 149
3fvv-assembly1.cif.gz_A the crystal structure of the protein with unknown function from bordetella pertussis tohama i 0.7965 19 202
2b8e-assembly1.cif.gz_A copa atp binding domain 0.7662 105 204
3sky-assembly1.cif.gz_A 2.1a crystal structure of the phosphate bound atp binding domain of archaeoglobus fulgidus copb 0.7652 105 207
ID Description Score Start End Superfamily
af_I1NED2_119_223_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.904 124 207 3.40.50.1000
af_B7F8I5_74_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8963 74 185 3.40.50.620
af_Q9LMM0_24_206_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8653 23 199 3.40.50.1000
3fvvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8574 107 206 3.40.50.1000
af_Q9LMM0_24_206_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8346 23 199 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0U5JJA3-F1-model_v4 Protein involved in cell wall biosynthesis, morphogenesis and cell division 0.9489 19 212 GO:0000287
GO:0005737
GO:0006564
GO:0036424
GO:0051301
AF-A0A3A5P5W7-F1-model_v4 HAD-IB family hydrolase 0.9452 18 212 GO:0016787
AF-A0A090E0N9-F1-model_v4 HAD-superfamily hydrolase 0.9448 15 213 GO:0016020
GO:0016787
AF-A0A3D1AGI6-F1-model_v4 HAD-IB family hydrolase 0.944 19 209 GO:0016020
GO:0016787
AF-A0A286E3F6-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.944 18 205 GO:0016787

Feature Viewer

pLDDT pTM Quality
84.8 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map